--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 17 19:14:55 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/262/Gr28b-PE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3196.22         -3206.12
2      -3195.98         -3205.30
--------------------------------------
TOTAL    -3196.09         -3205.79
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.363040    0.001527    0.285603    0.436985    0.361368   1288.31   1394.66    1.000
r(A<->C){all}   0.074744    0.000388    0.037570    0.113770    0.073424    999.61   1099.29    1.000
r(A<->G){all}   0.296595    0.001595    0.218618    0.374994    0.295289    871.73    883.83    1.000
r(A<->T){all}   0.077269    0.000326    0.044113    0.113914    0.075875    866.33   1029.92    1.000
r(C<->G){all}   0.125752    0.000634    0.079668    0.177852    0.124475    973.09   1047.22    1.001
r(C<->T){all}   0.386649    0.002133    0.300756    0.479625    0.386949    755.72    809.49    1.001
r(G<->T){all}   0.038991    0.000230    0.012184    0.069326    0.037528   1159.31   1192.89    1.000
pi(A){all}      0.264446    0.000125    0.243300    0.286124    0.264267   1009.13   1058.78    1.000
pi(C){all}      0.241908    0.000120    0.220113    0.262853    0.241950   1194.79   1214.22    1.000
pi(G){all}      0.227232    0.000123    0.205417    0.248965    0.227282   1104.68   1192.07    1.000
pi(T){all}      0.266414    0.000140    0.243327    0.289176    0.266307   1035.93   1119.62    1.000
alpha{1,2}      0.063566    0.001910    0.000277    0.148511    0.057354   1366.54   1433.77    1.000
alpha{3}        2.523163    0.784647    0.984573    4.207629    2.377121   1501.00   1501.00    1.000
pinvar{all}     0.314717    0.006133    0.160949    0.469993    0.318885   1125.16   1166.05    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3040.68366
Model 2: PositiveSelection	-3040.68366
Model 0: one-ratio	-3048.721689
Model 3: discrete	-3039.649928
Model 7: beta	-3039.935164
Model 8: beta&w>1	-3039.867416


Model 0 vs 1	16.076057999999648

Model 2 vs 1	0.0

Model 8 vs 7	0.1354959999998755
>C1
MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT
SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM
NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF
LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C2
MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C3
MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C4
MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT
SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN
GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM
NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF
LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C5
MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA
SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN
GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM
NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF
LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=447 

C1              MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT
C2              MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT
C3              MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT
C4              MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT
C5              MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA
                * ** * * **********:***** :*** ****** *::*: *** *:

C1              SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
C2              SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
C3              SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
C4              SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN
C5              SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN
                ***:**:**::***:** ******::*.:********.******.*****

C1              GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM
C2              GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
C3              GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
C4              GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM
C5              GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM
                ***** ****:***:*::**:*** ** *************:****::**

C1              NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF
C2              NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
C3              NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
C4              NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF
C5              NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF
                **** :*****.**********.***::*****:***:**** ****:**

C1              LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM
C2              LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM
C3              LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM
C4              LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM
C5              LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM
                *.**:********.****************:**** *********:****

C1              YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
C2              YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
C3              YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
C4              YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
C5              YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
                **************************************************

C1              DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
C2              DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
C3              DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
C4              DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
C5              DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
                **************************************************

C1              KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
C2              KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
C3              KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
C4              KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
C5              KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
                **************************************************

C1              TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
C2              TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
C3              TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
C4              TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
C5              TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL
                ***************************************.*******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  447 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  447 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8940]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [8940]--->[8940]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.326 Mb, Max= 30.733 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT
SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM
NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF
LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C2
MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C3
MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C4
MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT
SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN
GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM
NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF
LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C5
MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA
SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN
GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM
NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF
LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL

FORMAT of file /tmp/tmp9153292024149614170aln Not Supported[FATAL:T-COFFEE]
>C1
MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT
SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM
NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF
LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C2
MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C3
MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C4
MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT
SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN
GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM
NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF
LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C5
MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA
SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN
GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM
NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF
LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:447 S:100 BS:447
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.64 C1	 C2	 96.64
TOP	    1    0	 96.64 C2	 C1	 96.64
BOT	    0    2	 96.87 C1	 C3	 96.87
TOP	    2    0	 96.87 C3	 C1	 96.87
BOT	    0    3	 92.62 C1	 C4	 92.62
TOP	    3    0	 92.62 C4	 C1	 92.62
BOT	    0    4	 91.28 C1	 C5	 91.28
TOP	    4    0	 91.28 C5	 C1	 91.28
BOT	    1    2	 99.33 C2	 C3	 99.33
TOP	    2    1	 99.33 C3	 C2	 99.33
BOT	    1    3	 92.84 C2	 C4	 92.84
TOP	    3    1	 92.84 C4	 C2	 92.84
BOT	    1    4	 91.95 C2	 C5	 91.95
TOP	    4    1	 91.95 C5	 C2	 91.95
BOT	    2    3	 93.06 C3	 C4	 93.06
TOP	    3    2	 93.06 C4	 C3	 93.06
BOT	    2    4	 92.17 C3	 C5	 92.17
TOP	    4    2	 92.17 C5	 C3	 92.17
BOT	    3    4	 92.84 C4	 C5	 92.84
TOP	    4    3	 92.84 C5	 C4	 92.84
AVG	 0	 C1	  *	 94.35
AVG	 1	 C2	  *	 95.19
AVG	 2	 C3	  *	 95.36
AVG	 3	 C4	  *	 92.84
AVG	 4	 C5	  *	 92.06
TOT	 TOT	  *	 93.96
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTGGCTCCTTAGGCGATCGGTTGGAAAATCGGGCAACCGACCACACGA
C2              ATGTGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCTCACGA
C3              ATGGGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCACACGA
C4              ATGTGGCTCCTTGGACGATTGGTCAGGAAATCGGGTAACCGACCACACGA
C5              ATGTGGCTCCTTGGGCGATTGGTTAGGAAGTCGGGTAACCGACCACACGA
                *** ********.*.***: *** .*.**.***** ********:*****

C1              CGTATACACCTGCTATCGATTGACTATATTCATGGCACTTTGTCTCGGAA
C2              CGTATACACCTGCTATCGGCTGACAACATTCATGGCACTTTGCCTCGGAA
C3              CGTATACACCTGCTATCGACTGACCATATTCATGGCACTTTGCCTCGGAA
C4              CGTATACACCTGCTATCGCCTGACCATATTCATGGCCCTCTGCCTTGGGA
C5              CGTGTACAGCTGCTATCGATTGACCATACTCATGGCCCTTTGGCTCGGGA
                ***.**** *********  **** * * *******.** ** ** **.*

C1              TTGTGCCTTACTACGTATCCATATCTTCGGAAGGCAGAGGAAAACTAACA
C2              TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA
C3              TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA
C4              TTGTGCCCTACAACGTGACCATATCTTCAGAAGGCAGAGGAGTACTAACA
C5              TTGTGCCCTACTACGTAACCGTATCTGCAGGAGGCCGAGGAAAACTGGCA
                ******* ** :****.:**.***** *.*.****.*****.:***..**

C1              TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT
C2              TCCTCCTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT
C3              TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT
C4              TCCTCCTACTTGGGCTACATCAACATCCTCATACGAATGGCCATCTATAT
C5              TCTTCGTACATCGGCTACGTCAACATCCTCATGCGAATGGCCGTTTATAT
                ** ** ***:* ******.********.****.*********.* *****

C1              GGTCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT
C2              GGGCAACTCATTCTACGGTGCCGTCAATCGGGATACGTTGATGTCCAACT
C3              GGGCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT
C4              GGGCAACTCATTCTACGGCGCCGTCCATCGGGATGCCTTGATGTCCAACT
C5              GGGCAACTCGTTCTACGGCGCCATCAATCGGAGCTCGCTAATGTCCAACT
                ** ******.******** ***.**.*****..  *  *.**********

C1              TTTTCCTTACAGACATATCCAATGTGATAGATGCTTTGCAAAAGATCAAT
C2              TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC
C3              TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC
C4              TTTTCCTTACGGGCATATCCAATGTGATCGATGGACTGCAGAAGATCAAC
C5              TCTTCCTGACGGACATATCCAACGTGATAGATGGACTGCAAAAGATCAAC
                * ***** **.*.****** ** *****.**** : ****.******** 

C1              GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTATTGAACCGAAA
C2              GGAATGCTGGGAATATTTGCCATTTTACTTATATCGCTGCTGAACCGGAA
C3              GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTGCTGAACCGGAA
C4              GGAATGCTGGGCATCTCTGCCATATTGCTTCTATCGCTGCTGCATCGCAG
C5              GGAATGCTGGGTATCTCCGCCATACTGCTCATATCGCTGCTGAATCGGAG
                *********** **.*  *****: *.** .*******. **.* ** *.

C1              AGAATTGCTAAAACTGCTGGCCACATTCGATAGACTTGAGACGGAGGCGT
C2              GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT
C3              GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT
C4              GGAATTGCTGCAACTGCTGGCCATTTTCGATGCACTCGAGACGGAGGCGT
C5              GGATTTGCTGCAACTGCTGGCCATCTTCGATGGACTCGAGACGGAGGCGT
                .**:*****..***********.  ******. *** *************

C1              TTCCACGGGTGGGCGTGGCAATGCACCAGGTTGCAGCTAATAAGAAAATG
C2              TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG
C3              TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG
C4              TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCGGCTAAGAAGAAAATG
C5              TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCAGCTAACAGGAAAATG
                ******* ***************** ***** **.***** *.*******

C1              AATCGATTGGTTATAATCCTTGTTGGCAGTATGGTGGCATATATAACCTG
C2              AATCGATTGGTTATGATCCTGGTTGGCAGTATGGTGGCATATATAACCTG
C3              AATCGATTGGTTATGATCCTGGTGGGCAGTATGGTGGCATATATAACCTG
C4              AATCGATTGGTGGCATTGCTGGTGGGCAGTATGGCGGCTTATATAACGTG
C5              AATCGCTTGGTTGGGATCCTGGTGGGCAGCATGGCGGCATATATTACCTG
                *****.***** . .:* ** ** ***** **** ***:*****:** **

C1              TAGTTTTCTGATGATCAGTTTGAGAGACACGACCACATTTTCTATCTCAG
C2              TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG
C3              TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG
C4              CAGTTTTCTGATGATCGGCCTGAGAGACGCGACCACATTTTCCATCTCAT
C5              CAGTTTTCTGATGATCGGCCTAAGAGACGCGGCCACATTTTCCATCTCAT
                 ***************.*  *.******.**.********** ****** 

C1              CAGTGATTAGTTTTTTTTCACCACATTTTATCGTGTGCGCGGTTTCTTTT
C2              CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT
C3              CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT
C4              CGGTGATTAGTTACTTTTCACCACATTGTATCGTGTGCGCGGTTTCTTTT
C5              CGGTGATTAGTTATTTCTCACCACATTTTATCGTGTGCGCGGTTTCCTTT
                *.**********: ** ********** *************.**** ***

C1              CTGGCTGGAAATGTAATGATTAAGTTACGCATATATCTGAGTGCACTTAA
C2              CTGGCTGGAAATGTAATGATAAAATTACGCATATATCTGGGTGCTCTTAA
C3              CTGGCTGGAAATGTAATGATCAAATTACGCATATATCTGGGTGCTCTTAA
C4              CTGGTCGGAAATGTAATGATCAAGTTACGCATTTACCTGGGTGCTCTTAA
C5              CTGGCTGGAAACATAATGATCAAATTACGCATATATCTGGGTGCTCTTAA
                ****  ***** .******* **.********:** ***.****:*****

C1              CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG
C2              CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG
C3              CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG
C4              CGAGGTGTTGAAAAACCTAGCCCATCAATGGGACACCCGTACTCTGAAGG
C5              CGAGGTGCTGAAAAACCTAGCCCATCAATGGGACACCCGCACCCTCAAGG
                ******* ****.************************** *  ** ****

C1              CAGTGAATCAAAAACAGCGCTCTCTACAATGTCTCGATTCATTTTCCATG
C2              CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGAACTCATTTTCCATG
C3              CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGGACTCATTTTCCATG
C4              CAGTGACTCAGAAACAGCGCTCTCTGCAGTGTCTGGATTCATTCTCCATG
C5              CAGTGGCTCAAAAACAGCGCTCCCTACAATGCCTGGATTCGTTCTCCATG
                *****..***.******** ** **.**.** ** .* **.** ******

C1              TACACCATTGTAACCAAGGATCCTGCGGAGATTATACAGGAGTCCATGGA
C2              TACACCATTGTAACAAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA
C3              TACACCATTGTAACCAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA
C4              TACACCATTGTAACCAAGGATCCTGCCGAGATCATACAGGAGTCCATGGA
C5              TACACCATCGTAACCAAGGATCCTGCCGAGATTATACAGGAGTCCATGGA
                ******** *****.*********** ***** *****************

C1              GATACATCATCTCATTTGCGAGGCAGCTGCCACGGCTAACAAATATTTTA
C2              GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA
C3              GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA
C4              GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTCA
C5              GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTTA
                ************ ***********.** ******** *********** *

C1              CCTACCAATTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
C2              CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
C3              CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
C4              CCTACCAACTGCTGACCATTATTTCCATAGCATTTCTGATCATCGTTTTC
C5              CCTACCAGCTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
                *******. *************:***************************

C1              GATGCATACTATGTTCTGGAGACGCTACTGGGAAAATCGAAGCGCGAAAG
C2              GATGCGTACTATGTCCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG
C3              GATGCGTACTATGTTCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG
C4              GATGCGTACTATGTACTGGAAACGCTGCTGGGCAAATCGAAGCGTGAAAG
C5              GATGCGTACTATGTTCTGGAGACCCTGCTGGGGAAATCGAAGCGTGAAAG
                *****.******** *****.** **.***** *********** *****

C1              CAAATTCAAAACTGTGGAATTTGTGACATTTTTCTCGTGTCAAATGATTT
C2              CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC
C3              CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC
C4              CAAATTCAAAACTGTGGAATTCGTCACGTTTTTCTCCTGCCAAATGATCC
C5              CAAATTCAAAACTGTCGAGTTCGTGACGTTTTTCTCCTGTCAAATGATCC
                ***.*********** **.** ** **.******** ** ********  

C1              TGTATCTGATCGCCATAATTTCCATTGTCGAGGGAAGTAATCGAGCCATC
C2              TGTATCTAATCGCCATTATTTCGATTGTCGAGGGAAGTAATCGCGCCATC
C3              TGTATTTGATCGCCATAATTTCCATTGTCGAGGGCAGTAATCGCGCCATC
C4              TGTATCTGATTGCCATCATTTCGATTGTCGAAGGAAGCAATCGGGCTATT
C5              TGTATCTGATCGCCATCATTTCGATTGTCGAGGGTAGCAATCGCGCCATC
                ***** *.** ***** ***** ********.** ** ***** ** ** 

C1              AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC
C2              AAGAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC
C3              AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC
C4              AAAAAGAGCGAGAAAACGGGTGGAATAGTGCACTCACTACTCAATAAAAC
C5              AAGAAGAGCGAGAAGACGGGAGGAATAGTGCACTCCCTACTCAACAAGAC
                **.***********.** **:**.***********.******** **.**

C1              CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA
C2              CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA
C3              CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA
C4              CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGCTGA
C5              CAAAAGTGCAGAGGTCAAGGAGAAACTGCAGCAGTTCTCCATGCAGTTGA
                *********:***********************.************ ***

C1              TGCATCTGAAAATTAATTTTACTGCAGCTGGTCTGTTCAACATCGACCGC
C2              TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC
C3              TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC
C4              TGCATCTGAAAATTAACTTCACCGCAGCTGGACTGTTCAACATCGACCGC
C5              TGCATCTCAAAATAAATTTCACTGCAGCTGGGCTGTTTAACATCGACCGC
                ******* *****:** ** ** **:** ** ***** ************

C1              ACATTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
C2              ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
C3              ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
C4              ACTTTGTACTTCACAATCAGCGGCGCCCTGACCACTTATCTCATCATCTT
C5              ACCCTGTACTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
                **  **** *****.******** *** **********************

C1              GCTGCAGTTCACATCCAATTCCCCGAACAATGGTTATGGGAATGGCAGCT
C2              GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT
C3              GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT
C4              GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGAAATGGCAGCT
C5              GCTGCAGTTCACGTCCAATTCCCCCAACAATGGTTATGGGAATGGCAGCT
                ************.*********** ******** *****.**********

C1              CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT
C2              CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT
C3              CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT
C4              CCTGCTGCGAGACCTTCAATAATATGACGAATCATACGCTT
C5              CTTGCTGTGAGACCTTCAGTAACATGACGAATCATACGCTT
                * ***** **********.*** ******************



>C1
ATGTGGCTCCTTAGGCGATCGGTTGGAAAATCGGGCAACCGACCACACGA
CGTATACACCTGCTATCGATTGACTATATTCATGGCACTTTGTCTCGGAA
TTGTGCCTTACTACGTATCCATATCTTCGGAAGGCAGAGGAAAACTAACA
TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT
GGTCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT
TTTTCCTTACAGACATATCCAATGTGATAGATGCTTTGCAAAAGATCAAT
GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTATTGAACCGAAA
AGAATTGCTAAAACTGCTGGCCACATTCGATAGACTTGAGACGGAGGCGT
TTCCACGGGTGGGCGTGGCAATGCACCAGGTTGCAGCTAATAAGAAAATG
AATCGATTGGTTATAATCCTTGTTGGCAGTATGGTGGCATATATAACCTG
TAGTTTTCTGATGATCAGTTTGAGAGACACGACCACATTTTCTATCTCAG
CAGTGATTAGTTTTTTTTCACCACATTTTATCGTGTGCGCGGTTTCTTTT
CTGGCTGGAAATGTAATGATTAAGTTACGCATATATCTGAGTGCACTTAA
CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG
CAGTGAATCAAAAACAGCGCTCTCTACAATGTCTCGATTCATTTTCCATG
TACACCATTGTAACCAAGGATCCTGCGGAGATTATACAGGAGTCCATGGA
GATACATCATCTCATTTGCGAGGCAGCTGCCACGGCTAACAAATATTTTA
CCTACCAATTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
GATGCATACTATGTTCTGGAGACGCTACTGGGAAAATCGAAGCGCGAAAG
CAAATTCAAAACTGTGGAATTTGTGACATTTTTCTCGTGTCAAATGATTT
TGTATCTGATCGCCATAATTTCCATTGTCGAGGGAAGTAATCGAGCCATC
AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC
CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA
TGCATCTGAAAATTAATTTTACTGCAGCTGGTCTGTTCAACATCGACCGC
ACATTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
GCTGCAGTTCACATCCAATTCCCCGAACAATGGTTATGGGAATGGCAGCT
CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT
>C2
ATGTGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCTCACGA
CGTATACACCTGCTATCGGCTGACAACATTCATGGCACTTTGCCTCGGAA
TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA
TCCTCCTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT
GGGCAACTCATTCTACGGTGCCGTCAATCGGGATACGTTGATGTCCAACT
TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC
GGAATGCTGGGAATATTTGCCATTTTACTTATATCGCTGCTGAACCGGAA
GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT
TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG
AATCGATTGGTTATGATCCTGGTTGGCAGTATGGTGGCATATATAACCTG
TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG
CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT
CTGGCTGGAAATGTAATGATAAAATTACGCATATATCTGGGTGCTCTTAA
CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG
CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGAACTCATTTTCCATG
TACACCATTGTAACAAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA
GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA
CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
GATGCGTACTATGTCCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG
CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC
TGTATCTAATCGCCATTATTTCGATTGTCGAGGGAAGTAATCGCGCCATC
AAGAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC
CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA
TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC
ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT
CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT
>C3
ATGGGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCACACGA
CGTATACACCTGCTATCGACTGACCATATTCATGGCACTTTGCCTCGGAA
TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA
TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT
GGGCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT
TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC
GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTGCTGAACCGGAA
GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT
TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG
AATCGATTGGTTATGATCCTGGTGGGCAGTATGGTGGCATATATAACCTG
TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG
CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT
CTGGCTGGAAATGTAATGATCAAATTACGCATATATCTGGGTGCTCTTAA
CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG
CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGGACTCATTTTCCATG
TACACCATTGTAACCAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA
GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA
CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
GATGCGTACTATGTTCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG
CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC
TGTATTTGATCGCCATAATTTCCATTGTCGAGGGCAGTAATCGCGCCATC
AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC
CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA
TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC
ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT
CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT
>C4
ATGTGGCTCCTTGGACGATTGGTCAGGAAATCGGGTAACCGACCACACGA
CGTATACACCTGCTATCGCCTGACCATATTCATGGCCCTCTGCCTTGGGA
TTGTGCCCTACAACGTGACCATATCTTCAGAAGGCAGAGGAGTACTAACA
TCCTCCTACTTGGGCTACATCAACATCCTCATACGAATGGCCATCTATAT
GGGCAACTCATTCTACGGCGCCGTCCATCGGGATGCCTTGATGTCCAACT
TTTTCCTTACGGGCATATCCAATGTGATCGATGGACTGCAGAAGATCAAC
GGAATGCTGGGCATCTCTGCCATATTGCTTCTATCGCTGCTGCATCGCAG
GGAATTGCTGCAACTGCTGGCCATTTTCGATGCACTCGAGACGGAGGCGT
TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCGGCTAAGAAGAAAATG
AATCGATTGGTGGCATTGCTGGTGGGCAGTATGGCGGCTTATATAACGTG
CAGTTTTCTGATGATCGGCCTGAGAGACGCGACCACATTTTCCATCTCAT
CGGTGATTAGTTACTTTTCACCACATTGTATCGTGTGCGCGGTTTCTTTT
CTGGTCGGAAATGTAATGATCAAGTTACGCATTTACCTGGGTGCTCTTAA
CGAGGTGTTGAAAAACCTAGCCCATCAATGGGACACCCGTACTCTGAAGG
CAGTGACTCAGAAACAGCGCTCTCTGCAGTGTCTGGATTCATTCTCCATG
TACACCATTGTAACCAAGGATCCTGCCGAGATCATACAGGAGTCCATGGA
GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTCA
CCTACCAACTGCTGACCATTATTTCCATAGCATTTCTGATCATCGTTTTC
GATGCGTACTATGTACTGGAAACGCTGCTGGGCAAATCGAAGCGTGAAAG
CAAATTCAAAACTGTGGAATTCGTCACGTTTTTCTCCTGCCAAATGATCC
TGTATCTGATTGCCATCATTTCGATTGTCGAAGGAAGCAATCGGGCTATT
AAAAAGAGCGAGAAAACGGGTGGAATAGTGCACTCACTACTCAATAAAAC
CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGCTGA
TGCATCTGAAAATTAACTTCACCGCAGCTGGACTGTTCAACATCGACCGC
ACTTTGTACTTCACAATCAGCGGCGCCCTGACCACTTATCTCATCATCTT
GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGAAATGGCAGCT
CCTGCTGCGAGACCTTCAATAATATGACGAATCATACGCTT
>C5
ATGTGGCTCCTTGGGCGATTGGTTAGGAAGTCGGGTAACCGACCACACGA
CGTGTACAGCTGCTATCGATTGACCATACTCATGGCCCTTTGGCTCGGGA
TTGTGCCCTACTACGTAACCGTATCTGCAGGAGGCCGAGGAAAACTGGCA
TCTTCGTACATCGGCTACGTCAACATCCTCATGCGAATGGCCGTTTATAT
GGGCAACTCGTTCTACGGCGCCATCAATCGGAGCTCGCTAATGTCCAACT
TCTTCCTGACGGACATATCCAACGTGATAGATGGACTGCAAAAGATCAAC
GGAATGCTGGGTATCTCCGCCATACTGCTCATATCGCTGCTGAATCGGAG
GGATTTGCTGCAACTGCTGGCCATCTTCGATGGACTCGAGACGGAGGCGT
TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCAGCTAACAGGAAAATG
AATCGCTTGGTTGGGATCCTGGTGGGCAGCATGGCGGCATATATTACCTG
CAGTTTTCTGATGATCGGCCTAAGAGACGCGGCCACATTTTCCATCTCAT
CGGTGATTAGTTATTTCTCACCACATTTTATCGTGTGCGCGGTTTCCTTT
CTGGCTGGAAACATAATGATCAAATTACGCATATATCTGGGTGCTCTTAA
CGAGGTGCTGAAAAACCTAGCCCATCAATGGGACACCCGCACCCTCAAGG
CAGTGGCTCAAAAACAGCGCTCCCTACAATGCCTGGATTCGTTCTCCATG
TACACCATCGTAACCAAGGATCCTGCCGAGATTATACAGGAGTCCATGGA
GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTTA
CCTACCAGCTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC
GATGCGTACTATGTTCTGGAGACCCTGCTGGGGAAATCGAAGCGTGAAAG
CAAATTCAAAACTGTCGAGTTCGTGACGTTTTTCTCCTGTCAAATGATCC
TGTATCTGATCGCCATCATTTCGATTGTCGAGGGTAGCAATCGCGCCATC
AAGAAGAGCGAGAAGACGGGAGGAATAGTGCACTCCCTACTCAACAAGAC
CAAAAGTGCAGAGGTCAAGGAGAAACTGCAGCAGTTCTCCATGCAGTTGA
TGCATCTCAAAATAAATTTCACTGCAGCTGGGCTGTTTAACATCGACCGC
ACCCTGTACTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT
GCTGCAGTTCACGTCCAATTCCCCCAACAATGGTTATGGGAATGGCAGCT
CTTGCTGTGAGACCTTCAGTAACATGACGAATCATACGCTT
>C1
MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT
SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM
NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF
LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C2
MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C3
MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT
SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN
GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM
NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF
LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C4
MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT
SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN
GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM
NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF
LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL
>C5
MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA
SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN
GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM
NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF
LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM
YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF
DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI
KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR
TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1341 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479409763
      Setting output file names to "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1037292650
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4969495876
      Seed = 1876618103
      Swapseed = 1479409763
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 31 unique site patterns
      Division 2 has 21 unique site patterns
      Division 3 has 77 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3809.066545 -- -25.624409
         Chain 2 -- -3793.156629 -- -25.624409
         Chain 3 -- -3672.573272 -- -25.624409
         Chain 4 -- -3735.941661 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3784.790812 -- -25.624409
         Chain 2 -- -3672.141718 -- -25.624409
         Chain 3 -- -3791.963973 -- -25.624409
         Chain 4 -- -3788.709725 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3809.067] (-3793.157) (-3672.573) (-3735.942) * [-3784.791] (-3672.142) (-3791.964) (-3788.710) 
        500 -- (-3263.010) (-3269.976) (-3255.388) [-3269.168] * (-3267.818) [-3256.463] (-3259.813) (-3262.815) -- 0:33:19
       1000 -- [-3240.511] (-3245.772) (-3243.356) (-3257.294) * (-3247.089) (-3247.683) [-3246.755] (-3241.869) -- 0:16:39
       1500 -- (-3221.891) [-3222.046] (-3230.031) (-3236.956) * (-3231.046) (-3239.147) [-3228.817] (-3236.598) -- 0:11:05
       2000 -- (-3215.491) [-3203.170] (-3218.330) (-3226.853) * (-3213.319) (-3241.803) (-3226.069) [-3215.110] -- 0:08:19
       2500 -- (-3213.267) [-3205.780] (-3215.318) (-3229.302) * (-3207.440) (-3228.642) (-3227.456) [-3204.867] -- 0:06:39
       3000 -- (-3213.205) (-3204.110) (-3200.952) [-3212.879] * (-3206.819) (-3206.633) (-3215.074) [-3205.284] -- 0:05:32
       3500 -- (-3210.096) [-3202.353] (-3202.193) (-3204.978) * [-3205.935] (-3201.319) (-3205.564) (-3202.140) -- 0:04:44
       4000 -- [-3196.870] (-3202.487) (-3203.148) (-3200.287) * (-3198.307) [-3200.653] (-3207.731) (-3201.455) -- 0:04:09
       4500 -- [-3200.701] (-3195.660) (-3202.613) (-3202.483) * [-3199.113] (-3202.855) (-3214.675) (-3200.246) -- 0:07:22
       5000 -- (-3204.591) (-3198.751) [-3203.160] (-3201.186) * (-3205.860) [-3196.840] (-3214.009) (-3202.653) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-3198.590] (-3194.995) (-3196.857) (-3195.449) * (-3204.607) (-3201.356) (-3208.431) [-3197.135] -- 0:06:01
       6000 -- (-3202.975) (-3195.231) [-3196.482] (-3201.273) * [-3202.374] (-3201.160) (-3204.320) (-3203.219) -- 0:05:31
       6500 -- (-3197.498) (-3197.573) (-3202.218) [-3204.502] * (-3200.524) (-3199.165) [-3199.292] (-3216.058) -- 0:05:05
       7000 -- (-3197.039) [-3198.709] (-3201.030) (-3212.258) * (-3199.213) [-3194.694] (-3194.530) (-3208.100) -- 0:04:43
       7500 -- (-3197.806) (-3197.142) (-3202.547) [-3199.637] * [-3203.471] (-3196.310) (-3197.226) (-3207.600) -- 0:04:24
       8000 -- (-3199.703) (-3208.389) (-3204.298) [-3202.590] * (-3197.079) (-3196.866) [-3193.950] (-3206.357) -- 0:04:08
       8500 -- (-3199.650) (-3209.433) [-3201.456] (-3200.959) * (-3200.389) (-3199.561) (-3194.154) [-3206.285] -- 0:05:49
       9000 -- (-3202.065) [-3206.464] (-3198.709) (-3201.973) * (-3195.283) (-3200.503) (-3198.237) [-3197.702] -- 0:05:30
       9500 -- (-3197.813) [-3200.385] (-3200.017) (-3203.347) * (-3199.420) (-3198.983) (-3201.226) [-3200.439] -- 0:05:12
      10000 -- (-3198.264) (-3204.208) [-3200.176] (-3203.646) * (-3201.451) (-3200.263) (-3202.499) [-3197.923] -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-3194.711] (-3198.410) (-3201.545) (-3200.222) * (-3194.603) (-3198.250) (-3206.227) [-3200.643] -- 0:04:42
      11000 -- (-3199.202) [-3203.152] (-3199.724) (-3196.940) * (-3200.357) (-3203.628) (-3203.374) [-3198.553] -- 0:04:29
      11500 -- (-3202.529) (-3207.267) (-3202.083) [-3197.967] * (-3202.867) (-3199.973) [-3200.520] (-3202.625) -- 0:04:17
      12000 -- (-3199.070) [-3198.289] (-3202.888) (-3196.103) * (-3198.484) (-3207.096) (-3207.762) [-3204.542] -- 0:04:07
      12500 -- [-3196.205] (-3200.883) (-3198.815) (-3201.336) * (-3199.060) (-3200.985) [-3200.465] (-3202.017) -- 0:05:16
      13000 -- (-3199.581) (-3195.199) (-3202.429) [-3200.641] * (-3199.284) (-3200.331) (-3197.817) [-3196.996] -- 0:05:03
      13500 -- (-3200.840) [-3195.798] (-3202.217) (-3212.534) * [-3202.732] (-3200.982) (-3193.747) (-3198.934) -- 0:04:52
      14000 -- (-3199.755) [-3200.192] (-3204.796) (-3202.911) * (-3203.783) (-3198.797) (-3197.906) [-3197.610] -- 0:04:41
      14500 -- (-3208.473) (-3206.255) (-3205.002) [-3197.852] * [-3198.734] (-3197.332) (-3194.721) (-3201.330) -- 0:04:31
      15000 -- (-3202.599) (-3204.689) (-3202.663) [-3197.285] * [-3199.961] (-3196.504) (-3205.012) (-3199.132) -- 0:04:22

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-3203.460) (-3204.367) (-3202.420) [-3197.518] * (-3204.658) [-3199.370] (-3197.730) (-3198.589) -- 0:04:14
      16000 -- (-3198.331) [-3205.223] (-3206.861) (-3193.200) * (-3207.247) [-3197.141] (-3196.753) (-3199.189) -- 0:04:06
      16500 -- (-3200.599) [-3196.143] (-3199.688) (-3197.399) * (-3199.005) [-3199.110] (-3197.075) (-3208.031) -- 0:04:58
      17000 -- (-3204.832) [-3196.644] (-3196.647) (-3194.446) * [-3202.688] (-3197.657) (-3197.045) (-3203.363) -- 0:04:49
      17500 -- [-3196.381] (-3206.808) (-3203.518) (-3200.859) * (-3202.587) (-3200.295) (-3199.730) [-3199.001] -- 0:04:40
      18000 -- (-3198.559) (-3205.904) [-3195.144] (-3201.529) * (-3199.515) (-3198.598) (-3208.986) [-3202.811] -- 0:04:32
      18500 -- (-3203.507) [-3198.517] (-3201.107) (-3206.641) * (-3198.252) (-3194.581) [-3198.964] (-3197.897) -- 0:04:25
      19000 -- (-3198.188) [-3198.719] (-3202.509) (-3197.944) * [-3198.062] (-3199.322) (-3196.201) (-3198.094) -- 0:04:18
      19500 -- (-3204.883) (-3196.846) (-3202.515) [-3196.125] * [-3200.794] (-3198.297) (-3209.389) (-3198.385) -- 0:04:11
      20000 -- (-3198.006) (-3194.429) [-3196.332] (-3197.294) * (-3202.138) [-3202.222] (-3205.495) (-3201.347) -- 0:04:05

      Average standard deviation of split frequencies: 0.000000

      20500 -- [-3203.337] (-3202.417) (-3199.209) (-3200.344) * (-3212.770) (-3204.252) (-3201.759) [-3195.002] -- 0:04:46
      21000 -- (-3206.192) [-3197.148] (-3195.043) (-3200.738) * (-3198.455) [-3195.966] (-3204.432) (-3203.337) -- 0:04:39
      21500 -- (-3202.935) [-3196.580] (-3196.090) (-3200.440) * (-3199.443) [-3200.652] (-3205.410) (-3196.861) -- 0:04:33
      22000 -- (-3199.519) (-3202.613) (-3199.671) [-3198.353] * [-3199.646] (-3198.305) (-3200.881) (-3206.913) -- 0:04:26
      22500 -- (-3197.573) (-3201.604) (-3194.074) [-3199.840] * (-3197.869) (-3199.947) (-3201.806) [-3197.372] -- 0:04:20
      23000 -- (-3203.470) (-3202.640) [-3200.995] (-3197.752) * (-3200.681) [-3199.827] (-3200.696) (-3203.272) -- 0:04:14
      23500 -- (-3206.310) (-3200.474) (-3203.074) [-3193.685] * (-3202.766) (-3199.020) (-3203.143) [-3197.548] -- 0:04:09
      24000 -- (-3203.419) [-3198.043] (-3202.308) (-3200.468) * (-3202.735) (-3195.909) (-3202.557) [-3192.368] -- 0:04:04
      24500 -- (-3196.092) [-3200.530] (-3197.717) (-3205.761) * (-3206.947) (-3202.640) (-3199.404) [-3198.130] -- 0:04:38
      25000 -- (-3202.183) (-3201.833) [-3197.342] (-3208.391) * [-3202.331] (-3203.370) (-3204.281) (-3205.570) -- 0:04:33

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-3201.698) (-3203.702) [-3199.295] (-3198.910) * (-3203.614) (-3198.382) (-3202.557) [-3199.959] -- 0:04:27
      26000 -- [-3199.591] (-3198.177) (-3202.101) (-3202.213) * (-3212.194) (-3201.506) (-3209.829) [-3199.471] -- 0:04:22
      26500 -- (-3201.464) (-3198.539) [-3199.440] (-3203.727) * (-3201.302) (-3201.859) (-3199.763) [-3198.962] -- 0:04:17
      27000 -- (-3205.576) (-3199.498) [-3198.740] (-3198.148) * [-3196.923] (-3194.795) (-3200.678) (-3202.759) -- 0:04:12
      27500 -- (-3202.358) (-3205.698) (-3197.435) [-3197.592] * (-3202.303) (-3200.608) [-3199.228] (-3200.821) -- 0:04:07
      28000 -- (-3198.391) (-3203.249) [-3198.633] (-3202.141) * (-3201.357) [-3199.837] (-3202.476) (-3206.135) -- 0:04:03
      28500 -- (-3201.747) (-3209.200) [-3200.149] (-3203.087) * (-3200.410) (-3197.274) [-3199.077] (-3207.279) -- 0:04:32
      29000 -- (-3208.323) (-3201.812) [-3199.805] (-3200.698) * (-3194.607) (-3204.415) [-3197.806] (-3206.821) -- 0:04:27
      29500 -- (-3198.732) (-3196.233) (-3197.087) [-3195.538] * [-3199.085] (-3201.443) (-3205.378) (-3199.411) -- 0:04:23
      30000 -- (-3200.716) [-3194.236] (-3198.806) (-3195.201) * (-3198.951) [-3199.233] (-3200.377) (-3199.681) -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-3209.646) [-3196.555] (-3194.073) (-3195.623) * [-3193.743] (-3197.239) (-3204.698) (-3204.858) -- 0:04:14
      31000 -- (-3205.692) (-3198.283) [-3201.133] (-3197.247) * (-3200.813) (-3200.305) (-3202.083) [-3197.568] -- 0:04:10
      31500 -- (-3201.033) [-3195.593] (-3196.859) (-3197.795) * (-3208.590) [-3199.523] (-3205.013) (-3197.287) -- 0:04:05
      32000 -- (-3207.820) [-3201.188] (-3194.106) (-3198.153) * (-3208.169) [-3202.230] (-3201.474) (-3198.604) -- 0:04:02
      32500 -- (-3203.254) [-3197.068] (-3202.629) (-3193.710) * (-3206.570) (-3196.449) [-3200.186] (-3201.095) -- 0:03:58
      33000 -- (-3200.607) (-3204.638) [-3198.916] (-3196.120) * (-3200.611) [-3201.331] (-3196.114) (-3194.064) -- 0:04:23
      33500 -- (-3205.737) [-3201.075] (-3200.595) (-3200.801) * (-3208.837) (-3198.274) (-3202.756) [-3197.422] -- 0:04:19
      34000 -- (-3203.976) (-3202.933) [-3195.079] (-3201.542) * (-3202.125) [-3194.728] (-3202.933) (-3201.226) -- 0:04:15
      34500 -- (-3200.771) (-3201.425) (-3205.683) [-3201.040] * (-3200.163) [-3199.055] (-3199.366) (-3198.411) -- 0:04:11
      35000 -- (-3203.579) (-3198.778) (-3195.751) [-3198.942] * (-3198.803) (-3195.928) [-3198.983] (-3199.051) -- 0:04:08

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-3200.463) (-3200.627) [-3197.903] (-3199.911) * (-3202.601) [-3195.640] (-3197.585) (-3195.022) -- 0:04:04
      36000 -- (-3199.216) [-3195.020] (-3197.450) (-3199.677) * (-3197.938) (-3203.965) [-3207.877] (-3199.220) -- 0:04:01
      36500 -- (-3198.572) (-3197.702) [-3200.086] (-3201.935) * [-3196.355] (-3200.991) (-3203.820) (-3196.783) -- 0:03:57
      37000 -- (-3201.363) (-3200.822) [-3194.784] (-3199.218) * [-3196.006] (-3196.752) (-3198.100) (-3196.837) -- 0:04:20
      37500 -- (-3206.385) [-3198.842] (-3200.484) (-3205.779) * (-3198.644) (-3198.734) (-3204.820) [-3198.126] -- 0:04:16
      38000 -- (-3206.569) [-3198.361] (-3199.918) (-3203.680) * (-3205.041) (-3205.976) (-3200.663) [-3199.553] -- 0:04:13
      38500 -- [-3205.241] (-3193.367) (-3202.414) (-3202.048) * (-3198.915) (-3202.564) (-3210.012) [-3199.091] -- 0:04:09
      39000 -- (-3193.397) [-3195.848] (-3199.606) (-3204.390) * (-3200.124) (-3205.983) [-3199.506] (-3201.344) -- 0:04:06
      39500 -- [-3193.723] (-3199.310) (-3197.754) (-3198.948) * [-3201.810] (-3204.220) (-3196.309) (-3200.133) -- 0:04:03
      40000 -- (-3198.520) (-3203.575) (-3196.961) [-3197.818] * [-3196.125] (-3197.652) (-3197.051) (-3200.485) -- 0:04:00

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-3199.116) (-3205.777) (-3200.958) [-3199.506] * [-3199.307] (-3200.678) (-3198.902) (-3199.291) -- 0:03:56
      41000 -- [-3197.102] (-3199.456) (-3201.417) (-3202.707) * (-3205.720) (-3203.385) (-3193.332) [-3203.627] -- 0:04:17
      41500 -- (-3196.966) (-3205.583) [-3203.634] (-3201.442) * (-3205.598) (-3204.180) [-3204.261] (-3203.151) -- 0:04:14
      42000 -- (-3194.742) (-3212.253) (-3203.192) [-3204.066] * [-3198.696] (-3195.583) (-3199.669) (-3200.494) -- 0:04:10
      42500 -- [-3196.595] (-3209.917) (-3199.364) (-3197.868) * [-3201.638] (-3202.660) (-3199.577) (-3210.011) -- 0:04:07
      43000 -- [-3198.931] (-3209.394) (-3199.766) (-3194.609) * [-3206.842] (-3205.225) (-3201.108) (-3195.500) -- 0:04:04
      43500 -- (-3197.306) (-3209.248) (-3200.680) [-3196.771] * [-3200.060] (-3203.462) (-3195.505) (-3203.483) -- 0:04:01
      44000 -- (-3199.971) (-3197.391) (-3196.264) [-3195.508] * [-3197.317] (-3197.499) (-3198.484) (-3199.413) -- 0:03:59
      44500 -- (-3202.880) [-3201.454] (-3196.473) (-3199.861) * (-3198.444) [-3197.851] (-3207.418) (-3197.806) -- 0:03:56
      45000 -- (-3198.348) (-3203.834) [-3201.445] (-3200.028) * [-3195.263] (-3199.970) (-3199.066) (-3197.690) -- 0:03:53

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-3196.398) (-3206.428) (-3202.030) [-3196.735] * (-3202.597) (-3204.027) [-3202.937] (-3212.726) -- 0:04:11
      46000 -- (-3201.270) (-3199.912) (-3202.770) [-3198.943] * (-3202.239) [-3197.974] (-3203.408) (-3212.310) -- 0:04:08
      46500 -- [-3201.264] (-3198.479) (-3205.490) (-3201.534) * (-3196.795) (-3195.892) [-3206.104] (-3210.677) -- 0:04:06
      47000 -- (-3197.941) [-3196.355] (-3204.970) (-3201.865) * (-3196.612) [-3199.897] (-3201.279) (-3200.765) -- 0:04:03
      47500 -- [-3198.739] (-3198.346) (-3199.401) (-3204.780) * (-3198.764) (-3199.863) [-3199.212] (-3203.021) -- 0:04:00
      48000 -- (-3198.577) (-3199.434) [-3197.216] (-3199.593) * (-3202.566) (-3206.138) [-3196.972] (-3203.220) -- 0:03:58
      48500 -- [-3201.174] (-3198.182) (-3198.645) (-3200.977) * [-3205.732] (-3211.529) (-3203.017) (-3204.641) -- 0:03:55
      49000 -- [-3194.764] (-3199.033) (-3199.301) (-3202.242) * (-3200.776) (-3212.495) [-3204.389] (-3204.025) -- 0:03:52
      49500 -- (-3196.119) [-3197.892] (-3197.778) (-3200.248) * (-3199.042) (-3208.171) [-3198.173] (-3202.562) -- 0:04:09
      50000 -- (-3200.723) (-3202.166) [-3201.291] (-3204.330) * (-3199.204) [-3197.414] (-3197.509) (-3198.582) -- 0:04:06

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-3203.206) (-3212.791) (-3205.069) [-3198.550] * [-3203.641] (-3197.068) (-3203.088) (-3204.185) -- 0:04:04
      51000 -- (-3202.977) (-3198.844) [-3198.202] (-3196.662) * [-3201.488] (-3195.747) (-3204.566) (-3199.003) -- 0:04:01
      51500 -- (-3198.468) [-3203.856] (-3196.949) (-3196.715) * (-3197.497) [-3201.857] (-3197.569) (-3200.837) -- 0:03:59
      52000 -- (-3206.970) [-3202.681] (-3203.422) (-3201.533) * (-3202.472) (-3200.311) (-3205.462) [-3196.806] -- 0:03:57
      52500 -- [-3199.878] (-3204.346) (-3201.481) (-3196.135) * [-3200.716] (-3197.849) (-3214.509) (-3200.894) -- 0:03:54
      53000 -- [-3197.922] (-3205.619) (-3197.407) (-3197.229) * (-3207.308) (-3202.278) [-3200.064] (-3199.064) -- 0:03:52
      53500 -- (-3199.114) [-3201.165] (-3199.328) (-3201.658) * [-3202.926] (-3207.128) (-3198.211) (-3195.768) -- 0:03:49
      54000 -- (-3207.542) (-3199.773) (-3201.811) [-3194.454] * [-3202.659] (-3204.980) (-3199.812) (-3197.467) -- 0:04:05
      54500 -- (-3201.008) (-3205.445) [-3202.830] (-3195.635) * (-3202.729) [-3203.277] (-3199.773) (-3201.150) -- 0:04:02
      55000 -- (-3210.849) [-3204.014] (-3198.088) (-3199.289) * (-3202.071) (-3208.540) [-3201.728] (-3202.105) -- 0:04:00

      Average standard deviation of split frequencies: 0.000000

      55500 -- [-3200.583] (-3207.254) (-3203.146) (-3199.460) * [-3204.110] (-3199.884) (-3197.431) (-3205.459) -- 0:03:58
      56000 -- (-3203.193) [-3198.500] (-3204.849) (-3198.670) * (-3196.178) (-3202.834) [-3196.489] (-3196.608) -- 0:03:56
      56500 -- [-3196.947] (-3199.565) (-3198.082) (-3198.909) * [-3212.411] (-3202.295) (-3197.446) (-3199.043) -- 0:03:53
      57000 -- (-3200.287) (-3198.839) (-3200.850) [-3201.822] * (-3205.281) (-3200.690) (-3198.475) [-3200.034] -- 0:03:51
      57500 -- (-3199.007) (-3202.254) [-3201.437] (-3200.758) * (-3198.617) (-3202.405) [-3195.931] (-3198.776) -- 0:03:49
      58000 -- (-3200.291) (-3194.393) (-3198.564) [-3200.069] * (-3206.308) (-3201.752) [-3198.322] (-3205.273) -- 0:04:03
      58500 -- (-3205.916) (-3206.822) (-3207.320) [-3199.523] * (-3198.306) (-3199.485) (-3198.048) [-3201.307] -- 0:04:01
      59000 -- (-3204.029) (-3209.595) (-3206.706) [-3199.067] * (-3202.838) (-3206.557) (-3195.583) [-3198.912] -- 0:03:59
      59500 -- (-3206.832) [-3194.306] (-3199.425) (-3206.115) * (-3206.164) (-3203.197) [-3196.599] (-3201.021) -- 0:03:57
      60000 -- (-3204.426) (-3202.257) [-3194.042] (-3195.532) * (-3202.582) (-3206.041) [-3197.006] (-3206.378) -- 0:03:55

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-3199.908) (-3200.377) (-3199.275) [-3193.306] * (-3206.762) [-3200.046] (-3199.341) (-3196.620) -- 0:03:52
      61000 -- (-3201.303) (-3199.385) [-3201.469] (-3200.859) * (-3197.085) (-3196.009) [-3197.325] (-3196.260) -- 0:03:50
      61500 -- (-3204.129) (-3197.667) (-3195.987) [-3200.007] * (-3201.597) (-3202.262) (-3197.663) [-3196.932] -- 0:03:48
      62000 -- [-3201.946] (-3199.219) (-3197.410) (-3195.891) * (-3202.710) [-3199.698] (-3199.229) (-3200.010) -- 0:04:02
      62500 -- (-3202.107) [-3198.878] (-3199.905) (-3199.922) * (-3201.772) (-3206.745) (-3204.365) [-3195.791] -- 0:04:00
      63000 -- (-3202.066) (-3196.207) [-3198.017] (-3206.742) * (-3202.243) (-3207.621) [-3198.925] (-3202.206) -- 0:03:57
      63500 -- [-3195.425] (-3196.302) (-3199.468) (-3202.215) * (-3204.084) [-3200.783] (-3196.276) (-3203.922) -- 0:03:55
      64000 -- [-3196.399] (-3202.825) (-3195.241) (-3201.432) * (-3200.792) (-3201.737) [-3203.913] (-3204.537) -- 0:03:54
      64500 -- [-3196.784] (-3192.423) (-3198.705) (-3203.979) * (-3201.884) [-3201.051] (-3196.168) (-3200.579) -- 0:03:52
      65000 -- (-3193.005) (-3198.295) [-3201.293] (-3205.053) * (-3199.458) [-3199.384] (-3201.301) (-3200.746) -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-3200.862) (-3202.275) (-3197.042) [-3205.794] * [-3207.791] (-3203.490) (-3199.009) (-3196.470) -- 0:03:48
      66000 -- [-3195.519] (-3203.401) (-3203.359) (-3202.699) * (-3205.847) (-3207.211) [-3195.662] (-3201.679) -- 0:03:46
      66500 -- (-3198.137) (-3197.270) [-3198.484] (-3202.913) * (-3208.840) [-3202.067] (-3195.616) (-3203.682) -- 0:03:58
      67000 -- (-3202.384) [-3204.824] (-3199.912) (-3199.234) * (-3209.017) [-3204.600] (-3197.178) (-3196.369) -- 0:03:56
      67500 -- (-3201.183) [-3201.245] (-3203.922) (-3201.998) * (-3203.515) (-3197.870) [-3192.938] (-3198.175) -- 0:03:54
      68000 -- (-3206.214) [-3199.073] (-3198.202) (-3200.247) * (-3210.777) (-3198.272) (-3196.009) [-3201.070] -- 0:03:53
      68500 -- (-3204.988) [-3203.689] (-3199.560) (-3197.056) * (-3208.988) (-3202.598) [-3197.672] (-3199.105) -- 0:03:51
      69000 -- (-3204.851) (-3205.046) [-3197.005] (-3199.741) * (-3204.995) (-3200.931) (-3200.852) [-3206.746] -- 0:03:49
      69500 -- [-3200.850] (-3200.262) (-3199.686) (-3198.681) * (-3202.279) (-3207.080) (-3199.213) [-3209.269] -- 0:03:47
      70000 -- (-3203.704) (-3199.302) [-3200.848] (-3197.453) * (-3203.113) [-3198.041] (-3197.720) (-3202.229) -- 0:03:45

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-3196.436) (-3203.385) [-3200.295] (-3203.724) * [-3197.538] (-3202.553) (-3198.992) (-3198.157) -- 0:03:57
      71000 -- (-3202.176) [-3195.239] (-3199.000) (-3199.420) * (-3194.891) (-3205.513) [-3196.060] (-3205.764) -- 0:03:55
      71500 -- (-3198.787) (-3199.604) (-3201.356) [-3204.125] * [-3201.073] (-3204.810) (-3198.362) (-3200.894) -- 0:03:53
      72000 -- (-3202.761) [-3197.981] (-3204.851) (-3197.806) * (-3205.427) (-3205.158) (-3204.711) [-3200.814] -- 0:03:52
      72500 -- [-3200.323] (-3194.832) (-3202.210) (-3207.615) * (-3204.731) (-3200.946) [-3194.662] (-3198.384) -- 0:03:50
      73000 -- (-3198.371) (-3197.396) [-3200.014] (-3201.304) * (-3197.862) (-3207.359) (-3197.539) [-3200.824] -- 0:03:48
      73500 -- (-3198.351) (-3199.014) (-3207.162) [-3195.326] * (-3198.609) (-3204.035) (-3204.898) [-3201.700] -- 0:03:46
      74000 -- (-3201.197) (-3200.689) [-3203.881] (-3196.423) * [-3198.574] (-3203.344) (-3198.498) (-3206.084) -- 0:03:45
      74500 -- [-3194.728] (-3198.990) (-3202.426) (-3203.586) * (-3196.306) (-3196.772) (-3203.472) [-3194.530] -- 0:03:56
      75000 -- [-3197.963] (-3200.712) (-3207.755) (-3194.313) * (-3204.099) [-3207.457] (-3196.117) (-3201.233) -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-3203.920) (-3202.747) [-3200.120] (-3197.973) * (-3199.840) [-3200.717] (-3200.698) (-3197.161) -- 0:03:52
      76000 -- [-3203.353] (-3197.064) (-3205.985) (-3194.241) * (-3195.411) (-3200.174) (-3210.178) [-3201.327] -- 0:03:51
      76500 -- (-3199.674) [-3201.691] (-3203.263) (-3196.067) * (-3196.018) [-3204.848] (-3196.651) (-3209.896) -- 0:03:49
      77000 -- (-3202.544) (-3210.066) (-3203.306) [-3196.930] * (-3197.119) (-3201.804) [-3194.398] (-3199.741) -- 0:03:47
      77500 -- [-3195.008] (-3203.050) (-3199.054) (-3195.663) * (-3198.642) (-3203.666) [-3197.754] (-3202.696) -- 0:03:46
      78000 -- (-3203.543) (-3206.519) (-3202.389) [-3199.479] * (-3197.352) (-3204.383) (-3196.503) [-3196.300] -- 0:03:44
      78500 -- [-3203.593] (-3205.397) (-3203.046) (-3201.062) * (-3200.482) (-3198.980) (-3213.708) [-3204.168] -- 0:03:43
      79000 -- (-3206.262) (-3208.379) [-3198.985] (-3202.367) * [-3200.277] (-3203.414) (-3196.981) (-3199.679) -- 0:03:53
      79500 -- (-3196.260) [-3204.999] (-3201.242) (-3200.775) * (-3206.726) (-3199.416) [-3199.974] (-3197.978) -- 0:03:51
      80000 -- (-3200.014) (-3205.420) [-3199.887] (-3204.164) * (-3197.750) [-3197.729] (-3197.097) (-3198.894) -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-3196.060) [-3202.605] (-3208.703) (-3206.322) * (-3195.747) (-3201.711) (-3202.360) [-3202.558] -- 0:03:48
      81000 -- (-3201.293) (-3202.761) (-3200.379) [-3197.241] * (-3196.678) [-3205.167] (-3197.406) (-3198.375) -- 0:03:46
      81500 -- (-3198.792) [-3197.100] (-3200.343) (-3198.659) * [-3203.593] (-3199.750) (-3200.965) (-3199.639) -- 0:03:45
      82000 -- [-3203.783] (-3196.356) (-3205.676) (-3210.548) * [-3202.819] (-3203.044) (-3202.884) (-3203.933) -- 0:03:43
      82500 -- (-3200.916) [-3204.792] (-3200.632) (-3199.147) * [-3206.586] (-3198.967) (-3197.323) (-3199.681) -- 0:03:42
      83000 -- (-3199.813) (-3201.524) [-3200.614] (-3206.608) * (-3203.776) (-3205.889) (-3196.090) [-3202.436] -- 0:03:52
      83500 -- [-3195.186] (-3201.688) (-3203.064) (-3200.241) * (-3200.941) (-3211.377) (-3200.104) [-3197.676] -- 0:03:50
      84000 -- (-3197.319) [-3198.543] (-3198.200) (-3201.955) * (-3198.587) (-3197.068) (-3203.562) [-3193.471] -- 0:03:49
      84500 -- [-3204.423] (-3198.140) (-3202.401) (-3209.788) * (-3196.693) (-3195.951) [-3198.207] (-3201.716) -- 0:03:47
      85000 -- [-3201.461] (-3196.668) (-3196.105) (-3215.665) * (-3199.056) (-3198.861) [-3192.398] (-3200.141) -- 0:03:46

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-3198.461) (-3200.287) [-3199.911] (-3210.668) * [-3197.705] (-3195.362) (-3196.642) (-3211.194) -- 0:03:44
      86000 -- (-3204.972) [-3196.510] (-3199.779) (-3199.924) * [-3202.353] (-3197.221) (-3196.219) (-3199.745) -- 0:03:43
      86500 -- (-3202.899) (-3201.052) [-3199.258] (-3208.909) * (-3199.578) (-3196.089) (-3203.531) [-3198.107] -- 0:03:41
      87000 -- (-3199.424) [-3197.887] (-3206.402) (-3204.168) * (-3199.299) [-3199.678] (-3196.604) (-3199.810) -- 0:03:50
      87500 -- (-3199.536) (-3199.405) [-3197.608] (-3203.715) * [-3197.879] (-3198.508) (-3201.784) (-3204.655) -- 0:03:49
      88000 -- [-3202.707] (-3198.210) (-3200.509) (-3195.413) * (-3205.697) [-3200.910] (-3204.030) (-3203.680) -- 0:03:48
      88500 -- (-3198.709) (-3201.309) (-3200.419) [-3197.955] * [-3202.134] (-3200.368) (-3203.738) (-3197.296) -- 0:03:46
      89000 -- (-3204.042) (-3198.019) [-3203.995] (-3199.491) * (-3196.917) [-3203.271] (-3198.289) (-3204.605) -- 0:03:45
      89500 -- (-3201.366) [-3195.363] (-3197.383) (-3199.613) * [-3200.520] (-3198.468) (-3200.223) (-3199.878) -- 0:03:43
      90000 -- [-3206.533] (-3200.080) (-3196.155) (-3198.744) * (-3196.742) (-3194.320) (-3203.358) [-3199.849] -- 0:03:42

      Average standard deviation of split frequencies: 0.000000

      90500 -- [-3197.033] (-3206.491) (-3197.120) (-3198.693) * [-3199.530] (-3195.718) (-3206.556) (-3200.583) -- 0:03:41
      91000 -- (-3198.940) (-3206.659) (-3202.052) [-3196.165] * (-3196.999) (-3197.030) (-3214.221) [-3197.302] -- 0:03:39
      91500 -- (-3200.932) [-3196.711] (-3195.690) (-3201.540) * (-3201.079) (-3195.975) [-3207.350] (-3202.204) -- 0:03:48
      92000 -- (-3200.776) (-3198.206) (-3195.549) [-3201.668] * [-3201.118] (-3197.129) (-3202.296) (-3201.509) -- 0:03:47
      92500 -- (-3201.329) [-3194.786] (-3216.395) (-3198.629) * (-3207.591) (-3199.668) (-3201.045) [-3194.411] -- 0:03:45
      93000 -- (-3203.009) [-3206.816] (-3199.910) (-3196.902) * [-3200.963] (-3198.485) (-3205.069) (-3209.920) -- 0:03:44
      93500 -- (-3200.429) [-3196.103] (-3201.179) (-3197.227) * (-3202.272) (-3200.688) (-3201.624) [-3203.883] -- 0:03:42
      94000 -- (-3207.534) [-3204.718] (-3198.225) (-3196.910) * [-3197.143] (-3198.642) (-3205.652) (-3211.468) -- 0:03:41
      94500 -- (-3209.686) (-3197.636) (-3200.276) [-3196.067] * (-3202.209) [-3200.677] (-3197.763) (-3201.104) -- 0:03:40
      95000 -- (-3212.224) [-3202.904] (-3207.843) (-3212.950) * (-3198.995) (-3196.326) (-3203.632) [-3201.529] -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-3205.192) (-3201.607) [-3201.330] (-3203.805) * (-3203.687) (-3195.901) (-3198.020) [-3196.782] -- 0:03:47
      96000 -- [-3202.844] (-3198.800) (-3197.483) (-3203.870) * (-3199.992) (-3203.037) (-3206.447) [-3195.411] -- 0:03:46
      96500 -- (-3206.838) (-3207.582) (-3193.782) [-3201.877] * (-3199.233) (-3208.691) (-3204.080) [-3196.848] -- 0:03:44
      97000 -- (-3202.469) (-3204.924) (-3201.931) [-3202.190] * (-3200.494) (-3202.066) [-3198.720] (-3202.934) -- 0:03:43
      97500 -- (-3198.062) (-3212.293) [-3199.594] (-3195.374) * (-3201.073) (-3200.368) [-3202.692] (-3199.503) -- 0:03:42
      98000 -- [-3201.770] (-3200.038) (-3202.951) (-3197.768) * (-3201.581) (-3200.200) (-3200.040) [-3198.212] -- 0:03:40
      98500 -- (-3199.239) (-3197.351) [-3198.273] (-3201.927) * [-3201.391] (-3200.123) (-3196.894) (-3207.888) -- 0:03:39
      99000 -- (-3197.484) (-3194.299) (-3200.358) [-3199.824] * (-3196.213) (-3202.365) [-3200.664] (-3198.313) -- 0:03:38
      99500 -- (-3200.299) (-3203.172) (-3200.809) [-3195.793] * (-3201.482) (-3202.829) [-3199.260] (-3200.189) -- 0:03:46
      100000 -- (-3208.321) (-3201.002) [-3196.030] (-3199.124) * (-3204.962) (-3198.767) (-3201.082) [-3202.740] -- 0:03:45

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-3201.888) [-3200.552] (-3195.510) (-3196.536) * (-3206.006) (-3199.875) (-3208.634) [-3201.754] -- 0:03:43
      101000 -- (-3207.697) (-3200.244) (-3199.489) [-3203.660] * (-3203.074) (-3202.352) [-3198.326] (-3199.039) -- 0:03:42
      101500 -- [-3202.485] (-3196.620) (-3196.359) (-3203.441) * (-3207.936) (-3202.927) (-3199.247) [-3202.078] -- 0:03:41
      102000 -- [-3200.500] (-3198.740) (-3208.856) (-3202.721) * (-3205.951) (-3205.821) (-3203.258) [-3201.835] -- 0:03:40
      102500 -- (-3203.593) [-3197.825] (-3196.290) (-3200.193) * (-3204.670) [-3198.797] (-3201.033) (-3202.588) -- 0:03:38
      103000 -- (-3202.602) (-3198.239) (-3209.401) [-3202.250] * (-3199.397) (-3200.423) (-3196.599) [-3207.916] -- 0:03:37
      103500 -- [-3198.475] (-3201.115) (-3200.608) (-3195.238) * [-3199.496] (-3204.124) (-3200.329) (-3200.505) -- 0:03:36
      104000 -- (-3199.071) [-3194.589] (-3203.665) (-3202.729) * (-3197.514) [-3206.505] (-3202.307) (-3207.740) -- 0:03:44
      104500 -- (-3205.189) [-3195.908] (-3203.440) (-3204.923) * (-3199.914) (-3200.216) [-3198.008] (-3204.349) -- 0:03:42
      105000 -- (-3204.074) [-3199.960] (-3202.131) (-3201.569) * (-3206.542) (-3200.584) [-3192.921] (-3202.692) -- 0:03:41

      Average standard deviation of split frequencies: 0.000000

      105500 -- [-3196.999] (-3198.737) (-3201.516) (-3213.845) * (-3203.060) (-3207.084) [-3195.367] (-3205.661) -- 0:03:40
      106000 -- [-3198.726] (-3200.103) (-3202.959) (-3200.823) * (-3197.944) (-3202.274) [-3197.062] (-3197.614) -- 0:03:39
      106500 -- (-3203.685) (-3204.884) [-3198.806] (-3203.144) * (-3203.330) (-3201.770) (-3198.683) [-3194.385] -- 0:03:38
      107000 -- [-3201.396] (-3204.044) (-3204.178) (-3196.853) * (-3201.385) (-3208.684) (-3199.233) [-3196.404] -- 0:03:36
      107500 -- (-3210.470) [-3193.775] (-3202.262) (-3192.674) * (-3197.274) [-3196.720] (-3201.031) (-3201.321) -- 0:03:35
      108000 -- [-3201.547] (-3199.993) (-3203.862) (-3196.821) * (-3200.715) (-3202.059) [-3200.631] (-3203.981) -- 0:03:43
      108500 -- (-3199.952) (-3205.770) (-3206.632) [-3197.494] * (-3206.774) (-3200.063) (-3205.091) [-3194.186] -- 0:03:41
      109000 -- [-3201.085] (-3201.415) (-3203.034) (-3202.794) * (-3197.821) (-3204.194) [-3202.407] (-3198.918) -- 0:03:40
      109500 -- [-3199.416] (-3211.210) (-3201.091) (-3209.404) * [-3193.984] (-3200.491) (-3199.556) (-3195.588) -- 0:03:39
      110000 -- (-3205.198) [-3199.198] (-3197.663) (-3196.867) * [-3196.882] (-3200.974) (-3202.754) (-3200.273) -- 0:03:38

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-3199.908) (-3205.676) [-3201.629] (-3198.782) * [-3196.006] (-3201.248) (-3196.777) (-3200.596) -- 0:03:37
      111000 -- [-3194.540] (-3205.362) (-3195.269) (-3197.240) * (-3202.674) (-3199.925) (-3199.613) [-3205.908] -- 0:03:36
      111500 -- (-3195.342) (-3202.051) (-3196.982) [-3193.634] * (-3198.223) (-3198.926) [-3196.537] (-3207.229) -- 0:03:35
      112000 -- (-3199.978) (-3200.085) [-3203.369] (-3202.593) * (-3201.671) (-3202.619) (-3196.994) [-3200.538] -- 0:03:42
      112500 -- (-3202.508) (-3201.783) (-3200.356) [-3197.336] * (-3199.754) [-3199.187] (-3201.042) (-3198.145) -- 0:03:40
      113000 -- (-3203.574) [-3201.941] (-3204.711) (-3197.947) * (-3196.813) (-3202.057) [-3201.209] (-3201.101) -- 0:03:39
      113500 -- (-3197.799) (-3209.131) [-3201.019] (-3202.124) * [-3200.603] (-3203.304) (-3203.620) (-3197.567) -- 0:03:38
      114000 -- (-3201.146) (-3202.382) [-3202.422] (-3200.837) * (-3201.353) (-3200.823) [-3200.333] (-3194.697) -- 0:03:37
      114500 -- [-3200.146] (-3205.360) (-3199.332) (-3205.713) * (-3197.600) (-3200.675) [-3193.547] (-3200.974) -- 0:03:36
      115000 -- (-3202.928) (-3202.599) (-3203.942) [-3200.740] * [-3199.124] (-3197.581) (-3196.625) (-3198.949) -- 0:03:35

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-3194.395) (-3201.157) (-3199.643) [-3200.251] * (-3202.342) (-3202.516) (-3203.781) [-3200.849] -- 0:03:34
      116000 -- (-3197.782) (-3209.629) [-3204.072] (-3199.821) * (-3200.257) [-3197.721] (-3203.588) (-3211.101) -- 0:03:33
      116500 -- (-3207.518) [-3202.856] (-3202.042) (-3201.683) * [-3198.578] (-3207.717) (-3197.904) (-3219.860) -- 0:03:39
      117000 -- (-3201.086) (-3197.822) [-3197.881] (-3209.283) * [-3203.398] (-3198.385) (-3199.947) (-3203.779) -- 0:03:38
      117500 -- (-3211.859) (-3196.779) [-3202.238] (-3210.052) * (-3203.322) [-3202.762] (-3197.733) (-3208.984) -- 0:03:37
      118000 -- (-3203.547) (-3195.781) (-3201.829) [-3205.390] * (-3203.679) (-3201.743) [-3195.499] (-3206.240) -- 0:03:36
      118500 -- (-3200.067) [-3202.736] (-3202.502) (-3202.066) * [-3202.993] (-3196.550) (-3199.457) (-3200.656) -- 0:03:35
      119000 -- (-3204.689) [-3199.526] (-3204.115) (-3206.022) * (-3197.550) (-3198.619) [-3195.362] (-3195.737) -- 0:03:34
      119500 -- (-3205.128) [-3195.619] (-3206.704) (-3196.814) * (-3198.287) (-3205.286) (-3201.213) [-3198.901] -- 0:03:33
      120000 -- (-3202.975) (-3197.477) (-3202.236) [-3199.702] * (-3201.065) [-3196.834] (-3203.354) (-3202.371) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-3204.013) (-3203.056) (-3199.904) [-3196.001] * [-3200.994] (-3201.305) (-3194.893) (-3202.001) -- 0:03:38
      121000 -- [-3198.020] (-3200.857) (-3203.960) (-3199.845) * (-3200.864) (-3205.561) [-3197.773] (-3200.998) -- 0:03:37
      121500 -- (-3197.329) (-3196.764) (-3195.313) [-3197.516] * (-3201.150) (-3200.367) [-3198.791] (-3202.894) -- 0:03:36
      122000 -- [-3198.888] (-3195.862) (-3197.540) (-3199.348) * [-3197.093] (-3200.488) (-3201.852) (-3202.104) -- 0:03:35
      122500 -- (-3202.073) [-3198.502] (-3197.821) (-3199.370) * (-3199.838) (-3198.316) [-3202.250] (-3196.761) -- 0:03:34
      123000 -- (-3199.978) [-3201.080] (-3201.765) (-3201.163) * (-3205.460) (-3199.123) [-3198.010] (-3194.856) -- 0:03:33
      123500 -- (-3193.446) [-3199.477] (-3201.246) (-3200.046) * [-3208.135] (-3197.317) (-3199.251) (-3195.977) -- 0:03:32
      124000 -- (-3195.273) (-3202.440) [-3196.840] (-3196.915) * (-3199.285) (-3196.611) [-3202.091] (-3203.202) -- 0:03:31
      124500 -- (-3200.291) [-3198.468] (-3198.033) (-3205.877) * (-3198.193) (-3196.101) [-3194.225] (-3196.477) -- 0:03:37
      125000 -- (-3206.239) (-3201.143) [-3197.114] (-3203.448) * [-3198.230] (-3197.365) (-3201.467) (-3200.790) -- 0:03:37

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-3200.680) [-3201.049] (-3201.899) (-3201.853) * [-3199.312] (-3202.386) (-3203.426) (-3195.077) -- 0:03:36
      126000 -- (-3200.563) [-3200.539] (-3196.768) (-3208.671) * [-3207.325] (-3199.797) (-3199.875) (-3200.557) -- 0:03:35
      126500 -- (-3197.963) (-3204.348) (-3195.094) [-3203.806] * [-3203.943] (-3204.223) (-3197.159) (-3200.485) -- 0:03:34
      127000 -- [-3201.175] (-3200.814) (-3200.001) (-3201.374) * (-3198.826) [-3202.078] (-3200.205) (-3200.563) -- 0:03:33
      127500 -- (-3195.377) (-3200.643) (-3199.281) [-3196.530] * [-3198.236] (-3196.845) (-3196.002) (-3200.405) -- 0:03:32
      128000 -- (-3198.022) [-3200.424] (-3196.904) (-3199.021) * (-3197.078) (-3204.444) (-3201.125) [-3196.973] -- 0:03:31
      128500 -- (-3202.373) (-3202.618) (-3196.284) [-3200.067] * (-3203.100) (-3203.059) [-3197.332] (-3205.303) -- 0:03:37
      129000 -- (-3208.488) (-3196.719) [-3193.757] (-3202.814) * [-3196.359] (-3204.247) (-3201.062) (-3200.144) -- 0:03:36
      129500 -- (-3205.479) (-3198.873) [-3197.545] (-3202.620) * (-3204.506) (-3201.248) [-3205.496] (-3200.350) -- 0:03:35
      130000 -- (-3197.027) [-3198.148] (-3211.251) (-3198.979) * [-3199.278] (-3204.799) (-3207.139) (-3195.494) -- 0:03:34

      Average standard deviation of split frequencies: 0.000000

      130500 -- [-3204.273] (-3196.276) (-3197.636) (-3196.638) * [-3195.603] (-3204.615) (-3203.354) (-3194.594) -- 0:03:33
      131000 -- (-3203.862) (-3201.233) [-3203.428] (-3208.929) * (-3200.855) (-3204.630) [-3197.642] (-3200.344) -- 0:03:32
      131500 -- (-3193.996) [-3208.697] (-3205.942) (-3199.641) * (-3198.252) [-3200.016] (-3207.673) (-3199.190) -- 0:03:31
      132000 -- [-3195.931] (-3196.138) (-3204.772) (-3208.355) * (-3195.782) (-3203.036) [-3199.071] (-3199.823) -- 0:03:30
      132500 -- [-3193.584] (-3195.662) (-3202.908) (-3200.770) * (-3196.456) (-3198.489) (-3202.632) [-3198.120] -- 0:03:29
      133000 -- (-3193.884) (-3197.049) (-3209.861) [-3198.272] * [-3200.450] (-3196.958) (-3208.498) (-3195.177) -- 0:03:35
      133500 -- (-3200.904) [-3199.909] (-3199.828) (-3195.313) * (-3194.035) [-3194.705] (-3204.685) (-3199.586) -- 0:03:34
      134000 -- (-3206.767) (-3203.472) [-3195.294] (-3198.232) * [-3191.409] (-3204.446) (-3209.414) (-3201.319) -- 0:03:33
      134500 -- [-3198.944] (-3204.734) (-3195.380) (-3197.289) * (-3198.149) (-3205.648) (-3215.833) [-3200.152] -- 0:03:32
      135000 -- (-3195.934) (-3204.045) (-3201.199) [-3193.548] * (-3200.097) (-3206.942) (-3198.053) [-3196.663] -- 0:03:31

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-3200.314) (-3204.970) (-3201.406) [-3200.108] * [-3198.016] (-3202.699) (-3196.972) (-3198.438) -- 0:03:30
      136000 -- (-3198.813) [-3200.252] (-3201.463) (-3204.693) * [-3196.214] (-3200.610) (-3201.549) (-3200.393) -- 0:03:29
      136500 -- (-3202.207) (-3196.660) (-3203.220) [-3195.647] * [-3197.163] (-3200.138) (-3203.224) (-3198.611) -- 0:03:28
      137000 -- (-3203.479) (-3203.818) [-3196.716] (-3193.589) * (-3202.454) [-3197.279] (-3199.683) (-3196.071) -- 0:03:34
      137500 -- (-3210.193) (-3202.051) (-3200.964) [-3197.535] * [-3194.741] (-3200.933) (-3204.418) (-3200.313) -- 0:03:33
      138000 -- (-3207.551) (-3196.629) (-3195.816) [-3193.891] * (-3196.562) [-3199.686] (-3209.722) (-3196.020) -- 0:03:32
      138500 -- (-3215.512) (-3200.729) (-3200.587) [-3199.346] * (-3195.704) (-3205.110) [-3203.777] (-3196.533) -- 0:03:31
      139000 -- (-3203.349) (-3210.091) (-3202.075) [-3199.524] * (-3199.278) [-3200.279] (-3204.606) (-3198.156) -- 0:03:30
      139500 -- (-3199.232) [-3201.856] (-3207.497) (-3195.978) * (-3198.481) (-3196.909) (-3200.840) [-3201.753] -- 0:03:29
      140000 -- (-3201.316) (-3198.929) [-3202.338] (-3201.013) * (-3197.005) [-3198.032] (-3204.798) (-3199.890) -- 0:03:28

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-3200.265) [-3199.994] (-3205.041) (-3196.835) * (-3198.276) (-3197.781) [-3202.258] (-3197.893) -- 0:03:27
      141000 -- (-3202.191) [-3197.603] (-3206.437) (-3196.431) * (-3197.419) [-3200.465] (-3204.514) (-3205.627) -- 0:03:33
      141500 -- [-3201.911] (-3201.723) (-3208.203) (-3200.319) * (-3200.163) (-3196.823) (-3203.050) [-3205.264] -- 0:03:32
      142000 -- (-3196.913) [-3206.449] (-3198.643) (-3201.974) * (-3197.064) (-3199.009) (-3200.376) [-3196.666] -- 0:03:31
      142500 -- [-3195.423] (-3203.109) (-3195.203) (-3197.994) * (-3201.460) (-3199.766) [-3204.557] (-3199.289) -- 0:03:30
      143000 -- (-3199.546) (-3193.964) (-3194.660) [-3199.067] * (-3203.668) (-3202.978) [-3195.347] (-3196.862) -- 0:03:29
      143500 -- (-3198.355) (-3205.019) (-3196.802) [-3196.715] * (-3197.522) [-3199.716] (-3196.485) (-3200.245) -- 0:03:28
      144000 -- (-3200.008) (-3200.390) (-3199.487) [-3199.869] * [-3195.076] (-3202.528) (-3197.601) (-3207.928) -- 0:03:28
      144500 -- (-3197.618) (-3202.144) (-3200.894) [-3196.405] * (-3202.650) [-3201.196] (-3199.251) (-3204.393) -- 0:03:27
      145000 -- (-3207.486) (-3198.308) (-3208.176) [-3205.746] * (-3202.100) [-3205.114] (-3195.719) (-3198.144) -- 0:03:26

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-3201.772) (-3197.906) (-3205.881) [-3197.661] * (-3202.222) (-3208.062) (-3194.725) [-3205.297] -- 0:03:31
      146000 -- (-3197.405) (-3196.013) (-3205.491) [-3206.161] * [-3197.105] (-3200.388) (-3201.826) (-3198.468) -- 0:03:30
      146500 -- (-3200.238) [-3199.397] (-3201.874) (-3200.165) * (-3192.833) (-3202.651) [-3198.889] (-3201.345) -- 0:03:29
      147000 -- (-3194.114) (-3199.319) (-3195.296) [-3203.075] * (-3199.039) [-3198.065] (-3207.833) (-3200.024) -- 0:03:28
      147500 -- (-3201.320) [-3196.253] (-3203.886) (-3202.929) * [-3196.033] (-3196.565) (-3202.043) (-3197.167) -- 0:03:28
      148000 -- (-3196.306) (-3199.867) [-3198.250] (-3196.837) * [-3201.606] (-3204.640) (-3197.024) (-3198.894) -- 0:03:27
      148500 -- [-3200.065] (-3201.741) (-3203.484) (-3201.510) * (-3199.780) (-3195.954) [-3197.547] (-3203.571) -- 0:03:26
      149000 -- (-3208.316) (-3197.973) [-3197.432] (-3194.470) * [-3198.478] (-3197.433) (-3203.116) (-3197.659) -- 0:03:25
      149500 -- (-3206.465) [-3196.734] (-3199.644) (-3203.126) * (-3202.548) [-3201.508] (-3204.110) (-3198.991) -- 0:03:30
      150000 -- [-3197.913] (-3197.398) (-3207.507) (-3197.697) * [-3203.366] (-3202.420) (-3199.362) (-3199.885) -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      150500 -- [-3198.495] (-3195.819) (-3200.135) (-3208.736) * [-3199.684] (-3202.432) (-3204.548) (-3207.536) -- 0:03:28
      151000 -- (-3201.041) [-3200.078] (-3206.729) (-3199.294) * (-3201.336) (-3201.966) (-3208.459) [-3199.291] -- 0:03:28
      151500 -- [-3196.763] (-3204.666) (-3200.224) (-3199.123) * (-3199.427) (-3202.967) [-3200.258] (-3203.358) -- 0:03:27
      152000 -- (-3199.517) [-3201.594] (-3197.471) (-3200.334) * (-3197.194) (-3198.392) (-3196.823) [-3199.510] -- 0:03:26
      152500 -- (-3199.710) (-3206.442) [-3201.538] (-3204.914) * (-3201.677) (-3202.732) [-3200.517] (-3207.278) -- 0:03:25
      153000 -- (-3197.681) (-3199.126) (-3199.735) [-3199.882] * [-3198.005] (-3204.635) (-3208.159) (-3202.004) -- 0:03:24
      153500 -- (-3202.840) (-3195.383) [-3193.406] (-3216.178) * [-3197.645] (-3197.786) (-3205.805) (-3201.571) -- 0:03:29
      154000 -- (-3210.544) [-3199.131] (-3210.566) (-3203.663) * (-3201.957) (-3203.579) (-3198.525) [-3196.987] -- 0:03:28
      154500 -- (-3201.682) (-3201.638) [-3197.745] (-3198.322) * (-3200.409) (-3198.617) (-3208.446) [-3200.780] -- 0:03:27
      155000 -- [-3200.062] (-3199.030) (-3195.508) (-3197.302) * (-3196.098) (-3197.489) (-3202.424) [-3203.200] -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-3198.210) [-3196.735] (-3199.550) (-3197.669) * (-3201.454) (-3205.310) (-3203.058) [-3202.042] -- 0:03:26
      156000 -- (-3205.651) (-3208.568) [-3198.968] (-3207.296) * (-3206.512) (-3202.242) (-3202.038) [-3203.707] -- 0:03:25
      156500 -- (-3199.818) (-3200.468) [-3200.365] (-3199.330) * (-3202.687) (-3202.357) (-3206.052) [-3196.324] -- 0:03:24
      157000 -- [-3197.816] (-3199.322) (-3204.272) (-3195.411) * (-3209.732) (-3195.162) [-3198.601] (-3207.312) -- 0:03:24
      157500 -- (-3199.986) (-3197.297) (-3202.561) [-3194.468] * (-3204.832) (-3195.153) [-3201.860] (-3205.875) -- 0:03:28
      158000 -- (-3204.698) [-3207.121] (-3206.001) (-3200.815) * (-3198.007) [-3200.328] (-3200.779) (-3194.745) -- 0:03:27
      158500 -- (-3203.638) [-3201.402] (-3195.932) (-3196.302) * (-3195.510) [-3193.465] (-3198.218) (-3194.285) -- 0:03:27
      159000 -- (-3199.207) (-3202.616) (-3202.868) [-3194.939] * (-3199.316) (-3197.344) [-3194.881] (-3203.541) -- 0:03:26
      159500 -- (-3198.056) [-3196.459] (-3197.245) (-3194.895) * (-3197.920) (-3200.917) [-3196.702] (-3206.837) -- 0:03:25
      160000 -- (-3196.174) (-3203.305) [-3195.756] (-3197.477) * [-3198.991] (-3202.260) (-3201.650) (-3202.868) -- 0:03:24

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-3199.824) [-3197.674] (-3195.653) (-3194.815) * (-3200.285) [-3205.388] (-3196.621) (-3210.992) -- 0:03:23
      161000 -- (-3206.027) [-3194.643] (-3202.045) (-3202.361) * (-3202.379) (-3202.204) [-3199.895] (-3206.087) -- 0:03:23
      161500 -- (-3203.109) (-3199.359) (-3205.908) [-3197.259] * (-3199.138) [-3202.794] (-3199.504) (-3201.942) -- 0:03:22
      162000 -- [-3196.046] (-3197.979) (-3199.915) (-3199.107) * (-3201.448) [-3195.534] (-3202.766) (-3202.539) -- 0:03:26
      162500 -- (-3199.428) [-3198.365] (-3194.104) (-3200.093) * (-3205.174) (-3200.735) (-3196.743) [-3198.380] -- 0:03:26
      163000 -- [-3195.070] (-3201.954) (-3199.870) (-3203.581) * (-3198.995) [-3197.288] (-3195.599) (-3194.968) -- 0:03:25
      163500 -- (-3198.348) (-3205.592) [-3196.131] (-3198.753) * (-3202.171) (-3199.015) (-3197.881) [-3196.916] -- 0:03:24
      164000 -- (-3200.885) (-3205.080) [-3197.248] (-3202.027) * (-3202.819) [-3201.639] (-3202.078) (-3195.013) -- 0:03:23
      164500 -- (-3197.254) (-3207.693) [-3196.483] (-3206.335) * [-3197.741] (-3203.206) (-3200.459) (-3202.332) -- 0:03:23
      165000 -- (-3196.290) [-3205.938] (-3195.917) (-3210.200) * [-3197.569] (-3198.538) (-3198.965) (-3200.065) -- 0:03:22

      Average standard deviation of split frequencies: 0.000000

      165500 -- (-3201.725) (-3201.452) [-3197.586] (-3200.384) * [-3199.519] (-3202.750) (-3203.289) (-3196.385) -- 0:03:21
      166000 -- (-3195.835) (-3207.628) (-3199.253) [-3204.488] * (-3196.914) (-3206.167) [-3197.023] (-3196.072) -- 0:03:25
      166500 -- (-3198.313) (-3200.781) [-3200.281] (-3196.459) * (-3197.750) [-3198.060] (-3200.798) (-3197.659) -- 0:03:25
      167000 -- (-3204.752) (-3202.000) [-3196.036] (-3198.246) * (-3197.386) (-3200.027) (-3198.305) [-3198.661] -- 0:03:24
      167500 -- (-3196.214) (-3205.482) [-3196.992] (-3202.681) * [-3197.824] (-3199.492) (-3199.474) (-3202.510) -- 0:03:23
      168000 -- [-3197.948] (-3208.885) (-3204.582) (-3199.459) * (-3200.150) [-3197.448] (-3204.175) (-3204.759) -- 0:03:23
      168500 -- (-3201.770) (-3205.183) (-3203.222) [-3197.960] * (-3201.609) (-3205.117) [-3204.298] (-3196.763) -- 0:03:22
      169000 -- [-3195.909] (-3202.473) (-3201.602) (-3203.620) * (-3206.688) (-3198.223) [-3197.999] (-3198.968) -- 0:03:21
      169500 -- (-3198.558) (-3198.597) [-3196.343] (-3199.364) * (-3202.292) (-3200.704) [-3196.644] (-3200.137) -- 0:03:20
      170000 -- (-3201.776) [-3196.594] (-3211.135) (-3196.496) * (-3200.309) (-3202.951) (-3202.284) [-3196.591] -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-3195.927) (-3202.986) (-3208.158) [-3196.086] * (-3198.629) (-3201.180) (-3200.788) [-3196.251] -- 0:03:24
      171000 -- (-3200.766) (-3198.725) (-3197.703) [-3197.188] * [-3195.861] (-3203.151) (-3198.673) (-3201.388) -- 0:03:23
      171500 -- [-3197.510] (-3199.145) (-3199.876) (-3194.749) * (-3207.131) (-3202.077) (-3200.714) [-3201.272] -- 0:03:22
      172000 -- (-3194.434) [-3196.127] (-3200.315) (-3199.424) * (-3202.358) [-3199.528] (-3195.798) (-3198.263) -- 0:03:22
      172500 -- [-3198.114] (-3203.848) (-3205.172) (-3196.172) * (-3202.778) (-3208.840) [-3196.734] (-3200.771) -- 0:03:21
      173000 -- (-3199.138) [-3201.256] (-3200.633) (-3198.647) * (-3198.418) [-3206.703] (-3199.713) (-3198.148) -- 0:03:20
      173500 -- [-3201.504] (-3200.124) (-3196.798) (-3194.300) * (-3201.579) (-3199.829) (-3194.475) [-3200.083] -- 0:03:20
      174000 -- (-3200.053) (-3200.774) [-3197.141] (-3198.212) * [-3195.447] (-3204.553) (-3203.965) (-3200.021) -- 0:03:24
      174500 -- (-3203.676) [-3198.409] (-3198.914) (-3196.523) * (-3197.005) (-3209.151) [-3195.240] (-3201.428) -- 0:03:23
      175000 -- [-3200.396] (-3197.591) (-3200.770) (-3196.053) * [-3200.769] (-3204.363) (-3201.838) (-3208.083) -- 0:03:22

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-3206.643) (-3204.168) (-3198.283) [-3200.564] * (-3197.337) (-3199.681) [-3195.773] (-3212.534) -- 0:03:22
      176000 -- [-3201.799] (-3202.217) (-3206.773) (-3200.941) * [-3194.894] (-3201.018) (-3198.671) (-3199.882) -- 0:03:21
      176500 -- (-3200.451) (-3202.075) (-3203.592) [-3195.269] * [-3195.387] (-3197.436) (-3207.814) (-3215.031) -- 0:03:20
      177000 -- (-3204.269) (-3202.541) (-3210.518) [-3196.631] * (-3200.225) (-3197.594) (-3208.530) [-3202.524] -- 0:03:19
      177500 -- (-3199.631) (-3211.002) [-3202.285] (-3205.200) * (-3199.711) (-3200.394) (-3200.041) [-3199.162] -- 0:03:19
      178000 -- [-3197.132] (-3211.869) (-3203.221) (-3205.097) * (-3204.371) [-3194.858] (-3197.482) (-3199.523) -- 0:03:18
      178500 -- (-3198.371) (-3205.877) [-3199.256] (-3206.674) * (-3199.197) [-3197.828] (-3198.145) (-3203.434) -- 0:03:22
      179000 -- [-3198.910] (-3205.558) (-3198.075) (-3201.184) * (-3197.372) (-3200.224) (-3199.210) [-3199.093] -- 0:03:21
      179500 -- (-3201.094) (-3207.655) (-3195.198) [-3197.900] * (-3200.767) (-3201.180) (-3199.328) [-3206.068] -- 0:03:21
      180000 -- (-3202.799) (-3195.994) [-3196.357] (-3202.884) * [-3199.425] (-3196.924) (-3194.390) (-3207.911) -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      180500 -- [-3194.974] (-3204.534) (-3198.481) (-3200.874) * (-3198.610) [-3201.054] (-3197.600) (-3201.111) -- 0:03:19
      181000 -- (-3197.318) (-3208.236) [-3198.784] (-3200.643) * (-3200.426) [-3202.429] (-3198.700) (-3201.974) -- 0:03:19
      181500 -- (-3201.946) (-3199.886) [-3199.014] (-3203.701) * (-3200.194) (-3195.855) [-3200.899] (-3206.743) -- 0:03:18
      182000 -- (-3197.376) [-3196.925] (-3203.282) (-3206.411) * (-3196.055) [-3198.640] (-3202.802) (-3208.399) -- 0:03:17
      182500 -- (-3203.720) (-3194.401) [-3204.785] (-3198.746) * (-3199.548) (-3198.942) [-3197.159] (-3197.558) -- 0:03:21
      183000 -- (-3201.243) (-3201.359) (-3202.384) [-3194.253] * (-3201.270) (-3204.200) (-3201.123) [-3195.337] -- 0:03:20
      183500 -- [-3198.817] (-3201.175) (-3199.115) (-3195.444) * (-3196.783) (-3201.026) (-3200.310) [-3196.077] -- 0:03:20
      184000 -- (-3202.412) (-3200.185) (-3195.550) [-3199.472] * (-3199.485) (-3197.707) [-3201.232] (-3197.603) -- 0:03:19
      184500 -- (-3202.470) (-3201.302) [-3202.590] (-3203.133) * (-3201.334) (-3200.111) (-3198.692) [-3196.323] -- 0:03:18
      185000 -- (-3202.353) (-3196.584) (-3197.361) [-3196.659] * (-3202.303) [-3194.457] (-3198.283) (-3202.667) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-3200.310) (-3194.946) (-3204.647) [-3204.163] * (-3196.354) (-3204.573) (-3199.291) [-3202.281] -- 0:03:17
      186000 -- (-3198.057) (-3200.849) (-3201.216) [-3205.468] * (-3196.991) (-3205.526) [-3196.108] (-3198.413) -- 0:03:21
      186500 -- [-3195.478] (-3195.888) (-3200.316) (-3196.551) * [-3196.634] (-3202.229) (-3204.573) (-3205.524) -- 0:03:20
      187000 -- (-3194.973) (-3196.291) [-3197.491] (-3202.044) * [-3196.237] (-3209.993) (-3207.191) (-3198.183) -- 0:03:19
      187500 -- (-3204.088) (-3202.158) (-3202.497) [-3196.965] * (-3200.184) [-3198.747] (-3203.191) (-3203.854) -- 0:03:19
      188000 -- (-3201.716) (-3199.740) (-3204.954) [-3202.955] * (-3195.781) [-3196.525] (-3201.277) (-3207.155) -- 0:03:18
      188500 -- (-3198.918) (-3205.267) (-3205.448) [-3196.910] * [-3199.556] (-3197.106) (-3199.595) (-3201.070) -- 0:03:18
      189000 -- (-3195.117) (-3200.237) [-3199.137] (-3199.097) * (-3201.867) (-3205.494) (-3199.382) [-3195.779] -- 0:03:17
      189500 -- [-3195.803] (-3201.654) (-3206.663) (-3208.768) * (-3201.977) (-3198.336) (-3196.729) [-3195.249] -- 0:03:21
      190000 -- [-3200.474] (-3200.887) (-3201.203) (-3201.695) * (-3204.050) (-3196.003) [-3199.613] (-3194.604) -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-3201.232) [-3203.739] (-3200.869) (-3205.271) * (-3196.491) [-3199.520] (-3199.579) (-3203.237) -- 0:03:19
      191000 -- (-3204.273) [-3199.092] (-3199.369) (-3200.133) * [-3200.563] (-3198.504) (-3205.492) (-3197.744) -- 0:03:19
      191500 -- [-3199.229] (-3204.114) (-3198.081) (-3204.306) * (-3198.447) (-3201.668) (-3200.474) [-3196.315] -- 0:03:18
      192000 -- (-3198.176) (-3196.840) [-3197.957] (-3192.372) * (-3198.339) (-3208.215) (-3200.780) [-3201.254] -- 0:03:17
      192500 -- (-3200.838) [-3202.180] (-3194.280) (-3200.924) * [-3197.158] (-3201.930) (-3195.759) (-3196.435) -- 0:03:17
      193000 -- (-3200.871) (-3204.468) [-3196.387] (-3197.356) * [-3195.509] (-3200.672) (-3198.973) (-3193.373) -- 0:03:20
      193500 -- [-3203.330] (-3198.189) (-3194.904) (-3202.755) * (-3197.120) [-3197.004] (-3202.693) (-3197.034) -- 0:03:20
      194000 -- (-3202.507) [-3200.873] (-3195.718) (-3202.900) * [-3201.598] (-3197.217) (-3209.622) (-3196.505) -- 0:03:19
      194500 -- [-3198.942] (-3198.785) (-3200.829) (-3195.739) * (-3194.272) (-3207.910) (-3209.859) [-3198.921] -- 0:03:18
      195000 -- (-3202.470) (-3199.129) [-3206.889] (-3196.718) * (-3200.040) [-3207.909] (-3204.789) (-3202.314) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-3206.694) (-3197.152) (-3203.211) [-3198.851] * (-3196.201) (-3197.697) [-3203.997] (-3200.973) -- 0:03:17
      196000 -- (-3200.391) (-3205.899) [-3194.602] (-3196.900) * (-3205.454) (-3201.584) [-3200.804] (-3202.639) -- 0:03:16
      196500 -- (-3198.188) (-3210.543) (-3196.001) [-3196.407] * (-3202.052) (-3196.531) [-3199.421] (-3202.250) -- 0:03:16
      197000 -- [-3195.034] (-3201.326) (-3199.943) (-3197.385) * (-3199.439) (-3202.022) (-3200.120) [-3197.529] -- 0:03:19
      197500 -- (-3196.871) [-3197.444] (-3198.060) (-3204.600) * (-3204.332) (-3204.711) (-3198.273) [-3196.698] -- 0:03:19
      198000 -- (-3194.968) (-3200.486) (-3199.910) [-3196.479] * (-3201.196) [-3205.892] (-3202.243) (-3198.817) -- 0:03:18
      198500 -- (-3200.187) (-3199.729) [-3199.466] (-3206.016) * (-3211.528) (-3206.524) [-3199.042] (-3198.787) -- 0:03:17
      199000 -- (-3198.299) (-3206.220) (-3201.168) [-3199.485] * (-3208.631) [-3206.187] (-3196.319) (-3198.929) -- 0:03:17
      199500 -- [-3195.895] (-3203.812) (-3199.035) (-3206.664) * (-3201.072) [-3202.792] (-3201.521) (-3198.959) -- 0:03:16
      200000 -- (-3198.958) [-3198.735] (-3203.301) (-3203.393) * (-3197.644) [-3205.103] (-3204.961) (-3203.263) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-3206.125) (-3199.376) [-3198.881] (-3198.475) * (-3196.365) (-3201.893) [-3197.036] (-3200.013) -- 0:03:19
      201000 -- (-3199.628) (-3200.962) (-3203.193) [-3197.487] * (-3200.551) (-3196.103) (-3202.638) [-3199.120] -- 0:03:18
      201500 -- (-3199.595) [-3196.679] (-3202.247) (-3198.511) * (-3194.985) (-3199.747) [-3202.332] (-3199.731) -- 0:03:18
      202000 -- [-3199.225] (-3198.940) (-3201.932) (-3206.237) * (-3202.546) (-3198.940) (-3203.093) [-3202.062] -- 0:03:17
      202500 -- (-3196.055) (-3196.903) [-3201.868] (-3208.344) * (-3204.046) [-3196.248] (-3196.335) (-3196.262) -- 0:03:16
      203000 -- (-3198.869) [-3199.828] (-3215.375) (-3201.626) * [-3201.331] (-3200.111) (-3200.802) (-3201.405) -- 0:03:16
      203500 -- (-3196.626) (-3193.858) [-3204.544] (-3203.225) * (-3198.952) (-3199.183) (-3202.267) [-3201.914] -- 0:03:15
      204000 -- (-3200.354) (-3197.020) (-3196.044) [-3202.450] * (-3202.311) [-3198.437] (-3200.317) (-3197.378) -- 0:03:15
      204500 -- [-3194.764] (-3208.121) (-3196.490) (-3200.675) * [-3198.121] (-3200.612) (-3198.989) (-3198.174) -- 0:03:14
      205000 -- [-3202.180] (-3197.894) (-3203.130) (-3196.998) * (-3196.682) (-3199.052) [-3208.168] (-3199.477) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      205500 -- [-3202.815] (-3199.145) (-3198.799) (-3202.172) * [-3197.766] (-3201.723) (-3204.031) (-3205.452) -- 0:03:17
      206000 -- [-3200.391] (-3199.490) (-3204.211) (-3194.452) * (-3199.219) (-3202.563) (-3203.072) [-3201.028] -- 0:03:16
      206500 -- (-3201.037) (-3198.746) (-3198.410) [-3199.314] * [-3194.928] (-3199.081) (-3207.151) (-3210.148) -- 0:03:15
      207000 -- (-3206.210) (-3197.893) [-3205.952] (-3197.590) * [-3200.553] (-3196.301) (-3198.010) (-3202.182) -- 0:03:15
      207500 -- (-3204.201) (-3200.865) [-3199.905] (-3198.473) * (-3196.134) [-3194.702] (-3199.643) (-3201.510) -- 0:03:14
      208000 -- [-3200.812] (-3204.434) (-3207.388) (-3200.187) * [-3199.441] (-3200.854) (-3208.695) (-3196.831) -- 0:03:14
      208500 -- (-3208.504) [-3196.766] (-3204.032) (-3196.804) * (-3200.570) [-3207.865] (-3206.736) (-3200.703) -- 0:03:13
      209000 -- (-3204.742) (-3197.205) [-3202.810] (-3193.380) * (-3201.166) [-3200.886] (-3200.047) (-3195.923) -- 0:03:16
      209500 -- [-3194.891] (-3196.212) (-3198.394) (-3199.110) * [-3198.749] (-3199.671) (-3201.787) (-3199.398) -- 0:03:16
      210000 -- (-3202.401) (-3209.093) (-3200.056) [-3197.955] * (-3197.545) (-3199.195) [-3201.787] (-3210.400) -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-3200.963) (-3204.912) [-3196.591] (-3195.872) * (-3195.872) [-3203.349] (-3200.884) (-3202.199) -- 0:03:15
      211000 -- [-3196.613] (-3206.032) (-3201.793) (-3192.520) * (-3197.874) (-3205.049) [-3202.972] (-3203.709) -- 0:03:14
      211500 -- (-3209.105) (-3203.605) (-3197.313) [-3196.193] * (-3205.509) (-3197.394) (-3202.196) [-3197.686] -- 0:03:13
      212000 -- (-3198.678) [-3205.233] (-3198.028) (-3203.907) * (-3204.401) (-3201.978) [-3201.490] (-3197.414) -- 0:03:13
      212500 -- (-3206.229) (-3197.780) (-3200.988) [-3200.666] * (-3195.155) [-3196.989] (-3197.764) (-3203.361) -- 0:03:12
      213000 -- [-3198.093] (-3199.873) (-3199.637) (-3206.460) * (-3197.185) (-3202.598) (-3203.166) [-3210.001] -- 0:03:15
      213500 -- (-3201.299) (-3197.885) [-3202.885] (-3202.014) * [-3195.859] (-3196.870) (-3200.355) (-3201.526) -- 0:03:15
      214000 -- (-3196.130) (-3196.554) [-3202.012] (-3202.030) * (-3195.111) (-3200.772) [-3198.064] (-3205.111) -- 0:03:14
      214500 -- (-3202.171) [-3197.550] (-3196.693) (-3200.416) * (-3213.860) (-3203.043) [-3198.366] (-3207.406) -- 0:03:14
      215000 -- (-3198.454) (-3200.175) (-3203.963) [-3198.037] * (-3202.161) (-3208.863) [-3200.055] (-3198.064) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-3201.023) (-3194.233) [-3203.418] (-3200.204) * [-3194.717] (-3202.990) (-3196.287) (-3195.627) -- 0:03:12
      216000 -- (-3202.664) (-3197.402) [-3196.590] (-3199.235) * (-3200.823) [-3203.197] (-3195.072) (-3202.890) -- 0:03:12
      216500 -- (-3198.731) (-3203.338) [-3198.908] (-3201.354) * (-3205.890) (-3209.466) [-3195.552] (-3202.717) -- 0:03:11
      217000 -- (-3198.630) (-3204.512) [-3196.995] (-3195.935) * (-3200.460) [-3200.009] (-3201.877) (-3198.313) -- 0:03:14
      217500 -- (-3197.623) [-3195.650] (-3195.492) (-3205.084) * (-3198.622) (-3196.477) [-3192.199] (-3201.780) -- 0:03:14
      218000 -- (-3205.892) (-3198.181) [-3197.005] (-3204.660) * (-3207.221) [-3203.383] (-3202.452) (-3200.923) -- 0:03:13
      218500 -- (-3205.310) (-3197.913) [-3201.480] (-3201.724) * (-3201.378) (-3199.973) [-3196.679] (-3204.038) -- 0:03:13
      219000 -- [-3198.243] (-3196.438) (-3200.507) (-3198.169) * (-3203.272) (-3197.362) (-3199.337) [-3202.241] -- 0:03:12
      219500 -- (-3200.375) (-3196.820) [-3200.516] (-3199.815) * (-3201.930) [-3196.067] (-3201.086) (-3198.947) -- 0:03:12
      220000 -- (-3199.141) (-3197.246) [-3197.192] (-3199.659) * (-3200.188) (-3194.658) (-3204.564) [-3196.759] -- 0:03:11

      Average standard deviation of split frequencies: 0.000000

      220500 -- [-3199.564] (-3204.013) (-3198.802) (-3206.683) * [-3200.094] (-3200.360) (-3212.046) (-3199.901) -- 0:03:10
      221000 -- (-3205.426) (-3203.536) (-3198.046) [-3199.343] * (-3197.258) (-3198.540) (-3200.368) [-3200.924] -- 0:03:13
      221500 -- (-3202.159) [-3200.354] (-3205.818) (-3197.497) * (-3201.312) (-3197.203) [-3196.506] (-3201.990) -- 0:03:13
      222000 -- [-3205.748] (-3198.592) (-3197.221) (-3194.665) * (-3198.469) (-3199.649) [-3198.340] (-3201.025) -- 0:03:12
      222500 -- (-3203.621) (-3200.582) (-3202.749) [-3202.609] * (-3199.800) (-3207.766) (-3206.289) [-3199.338] -- 0:03:12
      223000 -- (-3199.122) [-3203.630] (-3196.662) (-3202.461) * [-3202.514] (-3207.424) (-3196.818) (-3205.017) -- 0:03:11
      223500 -- (-3199.853) [-3204.885] (-3201.965) (-3201.963) * (-3201.117) (-3200.037) [-3196.953] (-3201.883) -- 0:03:11
      224000 -- (-3198.943) (-3203.077) [-3202.145] (-3203.163) * (-3200.318) (-3200.781) (-3194.084) [-3197.851] -- 0:03:14
      224500 -- (-3198.452) (-3205.735) (-3204.816) [-3195.405] * [-3202.715] (-3200.204) (-3204.299) (-3198.913) -- 0:03:13
      225000 -- (-3200.722) (-3200.391) [-3198.302] (-3195.939) * [-3195.193] (-3195.007) (-3212.752) (-3200.749) -- 0:03:12

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-3202.074) (-3203.626) [-3198.633] (-3199.374) * (-3205.122) [-3195.386] (-3208.658) (-3199.131) -- 0:03:12
      226000 -- (-3198.622) (-3206.843) (-3196.786) [-3201.239] * (-3200.943) (-3207.963) (-3204.685) [-3195.807] -- 0:03:11
      226500 -- (-3202.194) (-3200.357) [-3194.081] (-3202.036) * [-3197.644] (-3199.571) (-3199.582) (-3201.069) -- 0:03:11
      227000 -- (-3196.045) (-3198.892) (-3207.705) [-3194.875] * [-3193.068] (-3199.779) (-3201.096) (-3205.016) -- 0:03:10
      227500 -- (-3197.744) (-3199.482) (-3207.760) [-3194.730] * (-3204.745) [-3207.708] (-3206.298) (-3213.345) -- 0:03:13
      228000 -- [-3197.569] (-3201.695) (-3196.566) (-3203.317) * [-3202.257] (-3200.530) (-3208.971) (-3196.994) -- 0:03:13
      228500 -- (-3197.286) (-3201.392) (-3199.210) [-3194.834] * (-3194.177) [-3202.582] (-3207.604) (-3200.652) -- 0:03:12
      229000 -- (-3200.033) (-3200.379) [-3194.775] (-3193.798) * (-3204.682) (-3197.310) (-3203.041) [-3198.876] -- 0:03:11
      229500 -- (-3195.658) [-3199.508] (-3196.980) (-3206.361) * (-3199.821) [-3200.010] (-3201.386) (-3195.845) -- 0:03:11
      230000 -- (-3198.317) [-3197.471] (-3201.821) (-3200.184) * [-3200.104] (-3211.015) (-3199.600) (-3201.020) -- 0:03:10

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-3211.056) (-3199.754) (-3198.026) [-3199.057] * (-3200.318) [-3198.122] (-3198.824) (-3200.229) -- 0:03:10
      231000 -- (-3200.205) [-3203.144] (-3200.632) (-3198.865) * [-3205.729] (-3198.796) (-3199.974) (-3205.628) -- 0:03:09
      231500 -- (-3195.949) (-3206.772) (-3205.820) [-3201.656] * (-3207.709) (-3203.442) [-3200.158] (-3205.037) -- 0:03:12
      232000 -- (-3207.844) [-3206.636] (-3198.029) (-3200.116) * (-3202.292) (-3204.923) (-3197.051) [-3202.663] -- 0:03:12
      232500 -- (-3194.580) [-3200.270] (-3199.305) (-3199.716) * (-3206.330) (-3200.582) (-3203.213) [-3196.284] -- 0:03:11
      233000 -- (-3202.571) [-3198.951] (-3196.227) (-3198.206) * (-3199.849) (-3205.770) [-3198.818] (-3198.660) -- 0:03:10
      233500 -- (-3201.349) (-3199.849) [-3197.611] (-3197.042) * (-3199.354) (-3206.850) [-3202.317] (-3198.224) -- 0:03:10
      234000 -- (-3202.994) (-3198.823) (-3203.248) [-3197.360] * (-3201.398) (-3196.068) [-3198.084] (-3197.937) -- 0:03:09
      234500 -- (-3198.753) (-3196.512) (-3198.688) [-3199.390] * (-3199.349) (-3199.770) [-3199.751] (-3199.065) -- 0:03:09
      235000 -- [-3199.539] (-3201.949) (-3198.043) (-3200.439) * [-3192.562] (-3202.599) (-3201.697) (-3201.380) -- 0:03:08

      Average standard deviation of split frequencies: 0.000999

      235500 -- (-3201.430) (-3204.300) [-3196.225] (-3202.906) * [-3200.071] (-3203.137) (-3195.035) (-3196.353) -- 0:03:11
      236000 -- [-3199.446] (-3201.621) (-3196.328) (-3204.257) * (-3201.159) (-3204.464) [-3196.079] (-3202.234) -- 0:03:11
      236500 -- (-3202.719) [-3200.096] (-3199.683) (-3199.499) * (-3200.424) (-3204.305) [-3199.391] (-3210.533) -- 0:03:10
      237000 -- (-3197.974) [-3199.491] (-3201.748) (-3211.912) * [-3198.150] (-3203.397) (-3199.212) (-3198.211) -- 0:03:09
      237500 -- (-3197.257) (-3194.703) [-3196.998] (-3197.588) * (-3198.136) (-3197.991) [-3201.365] (-3200.044) -- 0:03:09
      238000 -- (-3203.612) [-3197.413] (-3200.584) (-3194.973) * (-3205.275) [-3200.103] (-3196.884) (-3199.660) -- 0:03:08
      238500 -- (-3197.604) (-3204.944) [-3199.927] (-3203.930) * (-3196.194) (-3200.227) [-3195.630] (-3198.497) -- 0:03:08
      239000 -- (-3209.928) (-3202.204) [-3197.428] (-3199.757) * (-3198.999) (-3199.646) [-3202.185] (-3200.919) -- 0:03:07
      239500 -- (-3199.417) [-3193.805] (-3198.430) (-3194.341) * [-3199.173] (-3192.044) (-3198.892) (-3202.147) -- 0:03:10
      240000 -- (-3207.341) (-3197.079) (-3202.816) [-3201.428] * (-3199.681) (-3203.792) [-3197.077] (-3200.164) -- 0:03:10

      Average standard deviation of split frequencies: 0.000979

      240500 -- (-3196.495) [-3198.825] (-3207.044) (-3208.077) * [-3202.719] (-3204.992) (-3199.148) (-3202.674) -- 0:03:09
      241000 -- [-3198.704] (-3203.975) (-3195.873) (-3200.073) * (-3199.867) (-3194.872) (-3197.980) [-3201.940] -- 0:03:08
      241500 -- [-3201.935] (-3199.309) (-3200.987) (-3199.796) * [-3193.038] (-3200.197) (-3202.317) (-3204.832) -- 0:03:08
      242000 -- (-3199.002) (-3196.888) (-3203.112) [-3202.290] * (-3200.019) [-3199.828] (-3203.391) (-3200.084) -- 0:03:07
      242500 -- (-3200.958) (-3198.488) [-3197.579] (-3204.962) * (-3198.832) (-3203.618) [-3197.734] (-3196.707) -- 0:03:07
      243000 -- [-3198.032] (-3197.208) (-3200.899) (-3197.707) * (-3200.111) [-3199.250] (-3199.158) (-3198.826) -- 0:03:06
      243500 -- [-3197.270] (-3201.126) (-3202.575) (-3204.457) * (-3203.944) (-3199.945) [-3195.661] (-3196.069) -- 0:03:09
      244000 -- (-3205.812) [-3204.161] (-3197.560) (-3198.664) * (-3201.418) (-3195.672) (-3199.006) [-3198.389] -- 0:03:09
      244500 -- (-3197.639) (-3209.752) (-3197.245) [-3198.868] * (-3197.194) [-3198.798] (-3197.289) (-3195.625) -- 0:03:08
      245000 -- [-3202.676] (-3206.396) (-3198.506) (-3197.055) * (-3195.223) [-3201.447] (-3207.553) (-3199.832) -- 0:03:07

      Average standard deviation of split frequencies: 0.000958

      245500 -- (-3196.014) (-3198.498) (-3205.101) [-3200.385] * [-3201.483] (-3206.020) (-3200.302) (-3200.782) -- 0:03:07
      246000 -- (-3194.232) (-3198.021) [-3203.048] (-3199.096) * (-3205.420) (-3206.804) (-3203.847) [-3197.213] -- 0:03:06
      246500 -- (-3203.334) [-3203.082] (-3198.883) (-3195.357) * (-3206.107) (-3203.768) [-3194.172] (-3199.671) -- 0:03:06
      247000 -- (-3207.069) [-3210.603] (-3202.463) (-3195.321) * (-3200.173) (-3201.052) (-3205.546) [-3198.211] -- 0:03:05
      247500 -- (-3200.533) (-3204.568) [-3199.181] (-3198.258) * (-3202.306) (-3196.507) (-3200.674) [-3197.659] -- 0:03:05
      248000 -- (-3198.352) (-3198.952) [-3196.438] (-3200.694) * (-3202.908) [-3195.968] (-3203.338) (-3202.077) -- 0:03:08
      248500 -- [-3196.889] (-3200.092) (-3206.676) (-3202.320) * (-3204.544) (-3199.363) (-3199.248) [-3194.735] -- 0:03:07
      249000 -- [-3200.195] (-3197.379) (-3204.327) (-3194.688) * (-3193.810) (-3206.026) [-3197.542] (-3199.991) -- 0:03:06
      249500 -- (-3199.338) [-3199.574] (-3212.127) (-3206.532) * (-3201.759) [-3196.839] (-3208.023) (-3201.917) -- 0:03:06
      250000 -- [-3202.338] (-3200.993) (-3200.891) (-3202.681) * (-3197.776) (-3201.627) [-3201.434] (-3199.216) -- 0:03:06

      Average standard deviation of split frequencies: 0.000940

      250500 -- (-3200.993) [-3196.320] (-3199.651) (-3202.870) * (-3205.296) [-3202.176] (-3199.497) (-3200.823) -- 0:03:05
      251000 -- (-3202.329) (-3201.646) [-3200.618] (-3194.024) * (-3199.643) [-3206.753] (-3200.878) (-3211.100) -- 0:03:05
      251500 -- (-3196.754) (-3198.885) [-3202.997] (-3195.534) * [-3199.058] (-3204.754) (-3207.330) (-3199.578) -- 0:03:04
      252000 -- (-3198.031) (-3201.261) (-3196.628) [-3200.571] * (-3199.830) [-3210.877] (-3203.024) (-3201.028) -- 0:03:07
      252500 -- (-3196.595) (-3196.719) [-3200.814] (-3201.433) * [-3197.500] (-3200.165) (-3205.432) (-3195.783) -- 0:03:06
      253000 -- (-3198.613) (-3198.650) (-3201.333) [-3199.189] * [-3201.168] (-3203.185) (-3200.928) (-3196.891) -- 0:03:06
      253500 -- (-3210.037) [-3199.636] (-3203.062) (-3198.752) * (-3202.908) [-3199.952] (-3204.501) (-3197.918) -- 0:03:05
      254000 -- (-3200.806) (-3198.029) [-3196.789] (-3196.172) * [-3202.120] (-3207.203) (-3197.428) (-3197.313) -- 0:03:05
      254500 -- [-3194.638] (-3197.520) (-3206.026) (-3200.908) * (-3203.642) (-3203.859) [-3196.964] (-3199.838) -- 0:03:04
      255000 -- (-3197.116) [-3199.000] (-3202.915) (-3198.183) * (-3199.330) (-3204.503) [-3203.791] (-3195.773) -- 0:03:04

      Average standard deviation of split frequencies: 0.000921

      255500 -- (-3203.673) (-3196.607) (-3195.581) [-3200.096] * [-3198.968] (-3203.980) (-3200.461) (-3199.094) -- 0:03:03
      256000 -- (-3200.913) (-3193.747) (-3200.992) [-3198.844] * (-3200.379) (-3206.448) [-3200.528] (-3199.974) -- 0:03:06
      256500 -- (-3200.419) (-3204.276) (-3204.152) [-3203.015] * (-3208.074) (-3207.380) [-3195.905] (-3197.959) -- 0:03:05
      257000 -- (-3200.467) (-3210.628) [-3201.533] (-3204.568) * (-3202.381) (-3211.993) (-3200.306) [-3195.789] -- 0:03:05
      257500 -- (-3196.751) (-3197.353) (-3203.556) [-3197.013] * (-3197.198) [-3203.426] (-3197.741) (-3204.863) -- 0:03:04
      258000 -- [-3198.298] (-3213.134) (-3196.872) (-3211.674) * (-3207.681) (-3206.268) (-3198.066) [-3198.895] -- 0:03:04
      258500 -- (-3195.105) (-3206.840) (-3210.714) [-3197.503] * [-3197.613] (-3203.565) (-3195.450) (-3194.650) -- 0:03:03
      259000 -- (-3198.114) (-3211.085) (-3202.644) [-3197.793] * (-3200.188) (-3199.948) [-3201.606] (-3201.298) -- 0:03:03
      259500 -- [-3200.584] (-3205.568) (-3207.001) (-3201.444) * (-3197.565) (-3201.101) [-3203.008] (-3200.310) -- 0:03:02
      260000 -- (-3195.835) (-3200.428) [-3197.992] (-3197.916) * (-3201.045) (-3196.845) [-3193.788] (-3207.452) -- 0:03:02

      Average standard deviation of split frequencies: 0.000904

      260500 -- [-3193.284] (-3200.452) (-3197.315) (-3193.296) * (-3209.736) (-3201.777) [-3197.072] (-3201.863) -- 0:03:04
      261000 -- (-3197.834) (-3198.213) [-3198.358] (-3200.208) * (-3203.864) (-3203.462) (-3200.765) [-3198.736] -- 0:03:04
      261500 -- [-3206.451] (-3201.391) (-3207.222) (-3203.425) * [-3195.716] (-3202.628) (-3201.849) (-3196.175) -- 0:03:03
      262000 -- (-3200.500) (-3199.848) (-3198.413) [-3196.835] * (-3209.002) (-3206.322) (-3195.421) [-3194.967] -- 0:03:03
      262500 -- (-3201.397) [-3195.267] (-3203.797) (-3196.359) * (-3198.707) (-3203.469) [-3199.729] (-3200.484) -- 0:03:02
      263000 -- (-3196.801) [-3199.960] (-3200.595) (-3194.502) * (-3200.391) (-3205.010) [-3201.545] (-3201.061) -- 0:03:02
      263500 -- (-3201.864) [-3198.020] (-3203.509) (-3201.088) * (-3204.710) (-3195.143) (-3202.310) [-3201.011] -- 0:03:01
      264000 -- (-3196.452) (-3201.566) [-3197.799] (-3203.197) * (-3205.822) (-3199.908) (-3194.257) [-3204.401] -- 0:03:01
      264500 -- (-3199.105) (-3203.284) [-3198.697] (-3198.764) * (-3205.104) (-3197.184) [-3197.842] (-3198.895) -- 0:03:03
      265000 -- (-3200.066) (-3202.640) [-3203.501] (-3196.584) * (-3197.831) [-3199.100] (-3199.097) (-3201.638) -- 0:03:03

      Average standard deviation of split frequencies: 0.000886

      265500 -- (-3195.588) (-3198.706) [-3200.152] (-3204.251) * [-3199.122] (-3195.701) (-3195.299) (-3208.315) -- 0:03:02
      266000 -- [-3198.775] (-3202.590) (-3197.431) (-3197.244) * (-3201.792) [-3202.095] (-3206.282) (-3203.599) -- 0:03:02
      266500 -- [-3194.390] (-3201.095) (-3203.606) (-3198.808) * (-3201.294) [-3198.357] (-3198.229) (-3207.622) -- 0:03:01
      267000 -- (-3204.654) [-3196.522] (-3200.588) (-3203.244) * (-3203.011) (-3208.815) [-3196.262] (-3202.055) -- 0:03:01
      267500 -- (-3204.810) [-3200.404] (-3200.343) (-3195.536) * (-3201.135) [-3194.977] (-3207.019) (-3200.826) -- 0:03:00
      268000 -- (-3211.082) (-3203.749) (-3200.363) [-3200.367] * (-3203.720) (-3208.302) [-3208.883] (-3202.794) -- 0:03:00
      268500 -- (-3197.884) (-3198.116) (-3196.169) [-3198.566] * [-3199.858] (-3200.764) (-3205.116) (-3200.177) -- 0:03:02
      269000 -- [-3201.648] (-3203.844) (-3200.680) (-3199.502) * (-3199.303) [-3201.276] (-3197.480) (-3199.080) -- 0:03:02
      269500 -- (-3204.117) (-3199.136) (-3196.603) [-3201.547] * (-3202.035) [-3197.690] (-3203.097) (-3201.059) -- 0:03:01
      270000 -- (-3204.592) (-3204.111) (-3195.862) [-3201.812] * (-3200.333) [-3202.299] (-3195.224) (-3202.918) -- 0:03:01

      Average standard deviation of split frequencies: 0.000871

      270500 -- (-3208.500) (-3207.997) (-3198.864) [-3197.099] * (-3201.424) [-3195.414] (-3207.172) (-3205.018) -- 0:03:00
      271000 -- (-3198.900) (-3200.041) (-3198.351) [-3205.379] * (-3199.472) [-3199.986] (-3202.785) (-3202.208) -- 0:03:00
      271500 -- (-3203.404) (-3200.212) [-3199.364] (-3195.971) * (-3199.041) (-3204.014) [-3201.032] (-3198.633) -- 0:02:59
      272000 -- (-3199.875) [-3196.251] (-3196.864) (-3203.548) * [-3198.881] (-3198.450) (-3202.021) (-3203.337) -- 0:02:59
      272500 -- (-3201.367) [-3201.781] (-3204.946) (-3204.421) * [-3200.131] (-3197.745) (-3204.789) (-3206.374) -- 0:03:01
      273000 -- (-3214.234) (-3200.746) (-3204.828) [-3197.004] * (-3199.436) [-3200.404] (-3196.492) (-3199.836) -- 0:03:01
      273500 -- (-3197.254) (-3195.798) [-3200.821] (-3194.305) * (-3197.356) (-3204.906) [-3198.185] (-3198.651) -- 0:03:00
      274000 -- (-3197.651) [-3198.737] (-3205.829) (-3196.609) * (-3196.498) (-3207.093) [-3201.932] (-3197.167) -- 0:03:00
      274500 -- [-3195.876] (-3198.862) (-3202.083) (-3198.609) * (-3198.975) (-3206.545) [-3197.376] (-3201.332) -- 0:02:59
      275000 -- (-3196.322) [-3199.024] (-3200.082) (-3206.647) * (-3197.979) (-3204.981) (-3206.054) [-3202.706] -- 0:02:59

      Average standard deviation of split frequencies: 0.000854

      275500 -- (-3202.380) (-3207.060) (-3199.650) [-3200.799] * (-3201.719) (-3199.997) (-3198.456) [-3204.502] -- 0:02:58
      276000 -- [-3205.385] (-3202.383) (-3201.351) (-3201.269) * [-3195.192] (-3199.245) (-3199.520) (-3196.019) -- 0:02:58
      276500 -- (-3199.721) [-3205.589] (-3202.920) (-3203.011) * (-3200.835) [-3201.879] (-3196.270) (-3199.094) -- 0:02:57
      277000 -- [-3198.538] (-3201.400) (-3197.603) (-3200.511) * (-3195.882) (-3203.721) (-3196.614) [-3201.184] -- 0:03:00
      277500 -- (-3200.252) (-3199.681) (-3206.864) [-3205.028] * (-3200.390) [-3202.328] (-3197.651) (-3200.887) -- 0:02:59
      278000 -- (-3198.367) (-3194.622) (-3203.556) [-3199.135] * [-3198.445] (-3197.219) (-3207.448) (-3201.444) -- 0:02:59
      278500 -- (-3199.200) (-3197.811) [-3202.533] (-3202.737) * (-3199.893) (-3196.086) (-3208.722) [-3197.072] -- 0:02:58
      279000 -- (-3199.838) [-3199.745] (-3195.437) (-3204.341) * (-3197.249) [-3201.714] (-3197.028) (-3195.016) -- 0:02:58
      279500 -- [-3198.175] (-3202.985) (-3195.751) (-3204.794) * [-3203.161] (-3201.862) (-3197.570) (-3199.115) -- 0:02:57
      280000 -- (-3198.223) [-3196.958] (-3203.854) (-3213.297) * (-3197.454) (-3203.546) (-3198.656) [-3199.493] -- 0:03:00

      Average standard deviation of split frequencies: 0.000840

      280500 -- [-3198.171] (-3196.493) (-3213.042) (-3203.769) * (-3199.892) (-3197.010) (-3203.423) [-3200.124] -- 0:02:59
      281000 -- (-3203.885) [-3198.423] (-3202.653) (-3193.589) * (-3206.506) (-3204.208) (-3206.309) [-3198.011] -- 0:02:59
      281500 -- (-3199.731) (-3200.657) (-3202.232) [-3198.861] * (-3207.742) (-3198.957) (-3203.198) [-3199.330] -- 0:02:58
      282000 -- (-3200.309) [-3200.220] (-3195.851) (-3197.234) * [-3197.144] (-3195.688) (-3198.306) (-3197.125) -- 0:02:58
      282500 -- (-3195.553) [-3198.701] (-3201.828) (-3202.491) * (-3201.238) [-3202.342] (-3200.517) (-3201.288) -- 0:02:57
      283000 -- (-3197.721) (-3208.428) (-3200.677) [-3200.898] * (-3198.931) (-3206.649) (-3200.733) [-3201.744] -- 0:02:57
      283500 -- (-3194.083) (-3199.749) (-3206.483) [-3196.285] * (-3205.768) (-3201.173) [-3195.786] (-3196.498) -- 0:02:59
      284000 -- (-3202.031) (-3200.144) (-3204.423) [-3196.950] * (-3207.038) (-3199.931) [-3198.649] (-3196.775) -- 0:02:59
      284500 -- [-3193.411] (-3197.797) (-3206.200) (-3200.137) * (-3213.111) (-3200.341) [-3200.855] (-3198.345) -- 0:02:58
      285000 -- (-3201.388) (-3205.372) (-3203.804) [-3194.028] * (-3202.011) [-3196.762] (-3202.936) (-3204.841) -- 0:02:58

      Average standard deviation of split frequencies: 0.000824

      285500 -- (-3195.545) (-3201.271) (-3203.949) [-3198.016] * [-3205.912] (-3207.879) (-3200.472) (-3201.141) -- 0:02:57
      286000 -- (-3205.111) [-3197.790] (-3198.568) (-3199.044) * (-3206.812) [-3197.557] (-3202.688) (-3201.790) -- 0:02:57
      286500 -- (-3197.513) [-3195.692] (-3204.375) (-3199.843) * (-3199.778) [-3199.400] (-3196.600) (-3205.911) -- 0:02:56
      287000 -- [-3196.904] (-3202.444) (-3199.813) (-3211.415) * (-3201.150) (-3196.102) [-3197.968] (-3197.805) -- 0:02:56
      287500 -- (-3201.450) [-3201.861] (-3199.585) (-3205.472) * (-3201.727) (-3197.856) [-3196.575] (-3200.695) -- 0:02:55
      288000 -- (-3199.840) [-3196.223] (-3197.181) (-3201.180) * [-3200.268] (-3203.438) (-3200.973) (-3195.536) -- 0:02:58
      288500 -- (-3199.838) (-3198.685) (-3201.814) [-3200.013] * (-3198.053) (-3206.322) [-3199.572] (-3204.512) -- 0:02:57
      289000 -- (-3197.663) [-3201.337] (-3203.964) (-3195.866) * (-3195.653) [-3201.175] (-3199.008) (-3204.008) -- 0:02:57
      289500 -- (-3208.945) (-3201.829) [-3200.368] (-3201.445) * (-3201.313) (-3201.421) [-3197.558] (-3199.153) -- 0:02:56
      290000 -- (-3196.726) (-3198.851) (-3199.147) [-3200.111] * (-3198.354) (-3200.726) (-3200.183) [-3200.407] -- 0:02:56

      Average standard deviation of split frequencies: 0.000811

      290500 -- (-3198.344) (-3201.214) (-3197.645) [-3202.707] * [-3204.255] (-3200.200) (-3209.022) (-3199.800) -- 0:02:55
      291000 -- (-3194.692) [-3203.148] (-3195.060) (-3205.281) * [-3194.948] (-3196.452) (-3206.562) (-3200.068) -- 0:02:55
      291500 -- (-3198.529) (-3198.500) [-3201.131] (-3206.382) * [-3197.051] (-3205.317) (-3199.270) (-3202.460) -- 0:02:54
      292000 -- (-3197.242) (-3206.732) [-3193.081] (-3197.645) * [-3195.590] (-3202.479) (-3197.982) (-3200.949) -- 0:02:57
      292500 -- (-3197.920) [-3194.746] (-3198.710) (-3201.027) * (-3199.777) (-3197.324) [-3197.341] (-3200.851) -- 0:02:56
      293000 -- (-3204.293) (-3196.375) (-3195.606) [-3197.181] * (-3197.885) (-3195.848) [-3194.242] (-3206.369) -- 0:02:56
      293500 -- (-3206.390) (-3202.670) [-3201.939] (-3196.096) * (-3197.834) (-3202.513) [-3194.560] (-3197.287) -- 0:02:55
      294000 -- (-3198.472) (-3197.591) (-3209.809) [-3197.528] * (-3201.743) (-3196.897) (-3195.086) [-3200.136] -- 0:02:55
      294500 -- (-3202.201) [-3199.204] (-3201.829) (-3202.275) * (-3199.729) (-3199.536) [-3197.512] (-3205.661) -- 0:02:54
      295000 -- (-3197.531) [-3196.287] (-3197.102) (-3203.242) * (-3199.802) (-3205.021) [-3201.437] (-3193.996) -- 0:02:54

      Average standard deviation of split frequencies: 0.000796

      295500 -- [-3199.096] (-3201.448) (-3204.180) (-3197.417) * [-3194.452] (-3202.404) (-3200.694) (-3200.211) -- 0:02:54
      296000 -- [-3198.310] (-3200.471) (-3207.939) (-3201.609) * (-3202.235) (-3207.914) [-3197.714] (-3204.350) -- 0:02:56
      296500 -- [-3198.789] (-3198.223) (-3200.180) (-3198.305) * [-3202.765] (-3200.647) (-3204.449) (-3196.848) -- 0:02:55
      297000 -- (-3204.160) [-3197.224] (-3197.975) (-3201.457) * (-3199.535) (-3195.719) (-3196.189) [-3206.542] -- 0:02:55
      297500 -- (-3205.313) (-3196.349) [-3197.999] (-3200.802) * (-3199.902) [-3198.349] (-3206.247) (-3200.458) -- 0:02:54
      298000 -- (-3199.491) [-3208.633] (-3197.003) (-3194.071) * (-3201.278) [-3200.329] (-3197.315) (-3205.312) -- 0:02:54
      298500 -- (-3194.441) (-3204.727) [-3194.009] (-3202.580) * [-3195.562] (-3195.798) (-3204.203) (-3200.067) -- 0:02:53
      299000 -- [-3201.176] (-3201.062) (-3203.559) (-3204.188) * [-3195.996] (-3196.043) (-3202.182) (-3198.678) -- 0:02:53
      299500 -- (-3196.835) (-3198.301) [-3202.727] (-3211.428) * (-3198.641) (-3200.735) (-3201.628) [-3199.032] -- 0:02:55
      300000 -- (-3192.119) (-3203.051) [-3196.795] (-3196.616) * (-3197.516) (-3203.771) [-3201.288] (-3199.064) -- 0:02:55

      Average standard deviation of split frequencies: 0.000784

      300500 -- [-3204.202] (-3199.295) (-3196.837) (-3206.614) * (-3202.165) (-3197.294) [-3202.790] (-3194.852) -- 0:02:54
      301000 -- (-3210.860) (-3196.936) (-3197.959) [-3198.842] * (-3196.759) (-3198.392) (-3204.556) [-3198.198] -- 0:02:54
      301500 -- (-3195.566) [-3195.235] (-3198.066) (-3200.607) * (-3197.578) (-3198.420) [-3198.776] (-3199.807) -- 0:02:53
      302000 -- (-3197.153) (-3194.508) (-3204.997) [-3197.417] * [-3197.567] (-3199.659) (-3204.992) (-3200.013) -- 0:02:53
      302500 -- (-3196.965) (-3201.293) [-3199.956] (-3197.065) * [-3194.535] (-3203.588) (-3203.501) (-3201.677) -- 0:02:55
      303000 -- (-3196.720) (-3196.514) [-3198.844] (-3199.339) * (-3205.297) (-3205.537) (-3205.345) [-3196.343] -- 0:02:54
      303500 -- [-3199.384] (-3200.642) (-3194.527) (-3209.211) * [-3195.771] (-3197.040) (-3200.283) (-3200.207) -- 0:02:54
      304000 -- (-3204.746) (-3197.007) [-3197.233] (-3207.116) * [-3195.230] (-3200.430) (-3207.137) (-3201.439) -- 0:02:54
      304500 -- [-3200.321] (-3197.505) (-3197.105) (-3206.318) * [-3199.893] (-3199.375) (-3202.837) (-3199.442) -- 0:02:53
      305000 -- (-3198.155) (-3196.946) [-3198.761] (-3205.191) * (-3196.092) (-3200.822) [-3200.718] (-3198.041) -- 0:02:53

      Average standard deviation of split frequencies: 0.000770

      305500 -- (-3197.657) [-3195.822] (-3196.645) (-3209.127) * (-3206.880) [-3196.590] (-3203.887) (-3205.483) -- 0:02:52
      306000 -- (-3194.567) [-3192.129] (-3205.865) (-3204.748) * (-3214.102) (-3196.961) (-3202.152) [-3197.946] -- 0:02:52
      306500 -- (-3198.340) (-3197.048) [-3199.328] (-3204.538) * [-3198.460] (-3201.369) (-3198.091) (-3202.532) -- 0:02:54
      307000 -- (-3205.183) (-3197.874) [-3201.258] (-3204.163) * (-3196.958) [-3199.864] (-3198.538) (-3202.768) -- 0:02:53
      307500 -- (-3201.197) (-3193.761) [-3196.263] (-3207.442) * (-3204.180) (-3198.950) (-3204.550) [-3196.779] -- 0:02:53
      308000 -- (-3195.927) (-3201.253) [-3199.223] (-3202.088) * [-3195.293] (-3200.070) (-3200.642) (-3201.767) -- 0:02:53
      308500 -- (-3199.084) [-3201.825] (-3193.329) (-3221.712) * [-3194.942] (-3200.208) (-3198.494) (-3211.713) -- 0:02:52
      309000 -- (-3203.114) [-3198.617] (-3200.001) (-3209.251) * [-3197.215] (-3200.257) (-3197.204) (-3198.677) -- 0:02:52
      309500 -- (-3209.190) (-3198.973) (-3202.116) [-3205.445] * [-3204.369] (-3197.539) (-3204.627) (-3195.282) -- 0:02:51
      310000 -- (-3197.972) (-3204.188) (-3202.052) [-3204.684] * (-3196.473) [-3194.928] (-3206.823) (-3198.347) -- 0:02:51

      Average standard deviation of split frequencies: 0.000759

      310500 -- [-3196.237] (-3205.407) (-3201.879) (-3199.711) * (-3198.831) (-3202.403) (-3208.566) [-3202.891] -- 0:02:53
      311000 -- (-3198.448) (-3200.766) (-3204.240) [-3196.863] * (-3201.609) (-3201.187) [-3200.137] (-3193.498) -- 0:02:52
      311500 -- (-3198.686) [-3206.768] (-3200.279) (-3201.540) * (-3201.678) [-3203.270] (-3199.490) (-3197.522) -- 0:02:52
      312000 -- [-3196.154] (-3198.600) (-3204.593) (-3201.398) * (-3195.394) [-3198.158] (-3197.460) (-3201.291) -- 0:02:52
      312500 -- [-3203.744] (-3205.158) (-3196.963) (-3206.363) * (-3199.785) (-3200.432) (-3201.526) [-3193.567] -- 0:02:51
      313000 -- (-3194.602) [-3200.345] (-3203.177) (-3203.329) * [-3198.222] (-3196.518) (-3199.996) (-3198.418) -- 0:02:51
      313500 -- (-3197.927) (-3194.653) (-3203.777) [-3202.020] * [-3198.689] (-3201.727) (-3199.648) (-3194.143) -- 0:02:50
      314000 -- (-3199.225) [-3202.088] (-3203.841) (-3201.874) * (-3197.887) [-3196.768] (-3201.887) (-3204.575) -- 0:02:52
      314500 -- (-3196.385) (-3198.153) (-3201.493) [-3203.953] * (-3197.358) (-3197.433) [-3201.049] (-3200.619) -- 0:02:52
      315000 -- (-3195.870) [-3198.477] (-3201.517) (-3201.223) * (-3202.372) (-3203.361) (-3196.510) [-3201.066] -- 0:02:51

      Average standard deviation of split frequencies: 0.000746

      315500 -- (-3198.773) (-3196.242) (-3201.224) [-3197.333] * [-3195.560] (-3192.376) (-3209.092) (-3201.213) -- 0:02:51
      316000 -- (-3204.756) (-3197.706) [-3196.626] (-3199.772) * (-3200.667) [-3196.470] (-3200.568) (-3197.355) -- 0:02:51
      316500 -- (-3200.076) (-3197.218) (-3199.727) [-3197.041] * (-3197.352) (-3199.954) (-3203.707) [-3201.111] -- 0:02:50
      317000 -- [-3200.295] (-3199.359) (-3199.485) (-3196.437) * (-3198.783) [-3195.419] (-3203.417) (-3204.878) -- 0:02:50
      317500 -- [-3200.220] (-3198.804) (-3192.952) (-3198.989) * [-3200.106] (-3199.551) (-3210.758) (-3196.570) -- 0:02:49
      318000 -- (-3198.188) (-3197.775) (-3201.589) [-3201.595] * (-3198.376) (-3197.994) (-3201.225) [-3196.077] -- 0:02:51
      318500 -- (-3201.891) [-3198.496] (-3201.247) (-3209.748) * (-3197.005) (-3195.230) (-3201.108) [-3197.570] -- 0:02:51
      319000 -- (-3199.706) [-3195.891] (-3195.592) (-3210.650) * (-3199.380) (-3197.508) (-3195.588) [-3200.534] -- 0:02:50
      319500 -- (-3197.773) [-3197.744] (-3203.096) (-3213.687) * [-3199.927] (-3201.706) (-3195.645) (-3195.750) -- 0:02:50
      320000 -- (-3197.727) (-3201.955) [-3196.927] (-3210.313) * (-3203.440) (-3202.715) (-3196.002) [-3195.922] -- 0:02:50

      Average standard deviation of split frequencies: 0.000735

      320500 -- (-3197.162) (-3199.809) [-3199.502] (-3201.640) * (-3197.998) [-3198.316] (-3198.607) (-3200.425) -- 0:02:49
      321000 -- (-3200.072) [-3197.501] (-3198.549) (-3198.851) * (-3194.540) [-3198.081] (-3201.105) (-3199.385) -- 0:02:49
      321500 -- (-3199.470) (-3201.242) [-3196.831] (-3201.133) * [-3199.386] (-3197.937) (-3198.998) (-3203.231) -- 0:02:48
      322000 -- (-3206.440) (-3205.827) (-3202.768) [-3198.072] * (-3200.548) (-3195.583) [-3193.620] (-3194.774) -- 0:02:50
      322500 -- (-3204.330) [-3196.654] (-3204.086) (-3200.565) * (-3197.403) (-3196.778) [-3198.473] (-3198.717) -- 0:02:50
      323000 -- (-3202.877) (-3199.402) (-3198.824) [-3199.657] * (-3199.568) (-3198.021) (-3196.641) [-3200.886] -- 0:02:49
      323500 -- [-3198.263] (-3203.534) (-3198.640) (-3205.100) * [-3197.578] (-3200.903) (-3198.537) (-3201.050) -- 0:02:49
      324000 -- [-3199.397] (-3195.605) (-3198.128) (-3199.378) * (-3203.813) (-3199.303) [-3200.441] (-3198.320) -- 0:02:49
      324500 -- (-3197.009) (-3200.473) (-3197.799) [-3202.585] * (-3199.843) (-3202.417) [-3199.070] (-3201.343) -- 0:02:48
      325000 -- [-3196.732] (-3204.776) (-3206.445) (-3200.195) * (-3207.196) [-3201.401] (-3204.584) (-3200.368) -- 0:02:48

      Average standard deviation of split frequencies: 0.000723

      325500 -- (-3196.554) (-3197.901) [-3193.502] (-3201.253) * [-3202.472] (-3197.333) (-3198.684) (-3201.513) -- 0:02:47
      326000 -- (-3195.744) (-3203.892) [-3200.402] (-3198.611) * [-3198.016] (-3202.970) (-3204.841) (-3211.614) -- 0:02:49
      326500 -- [-3199.816] (-3199.357) (-3197.398) (-3198.404) * [-3195.381] (-3195.784) (-3201.123) (-3207.941) -- 0:02:49
      327000 -- (-3205.955) (-3199.433) (-3200.148) [-3194.169] * (-3202.970) (-3195.474) [-3200.197] (-3210.057) -- 0:02:48
      327500 -- (-3199.444) (-3200.025) [-3200.954] (-3209.845) * (-3201.492) [-3199.558] (-3200.414) (-3199.498) -- 0:02:48
      328000 -- (-3201.524) (-3198.711) [-3198.479] (-3199.875) * (-3201.789) [-3198.374] (-3206.225) (-3201.072) -- 0:02:48
      328500 -- (-3204.301) (-3202.458) (-3203.242) [-3199.794] * (-3204.130) (-3198.744) (-3200.186) [-3202.612] -- 0:02:47
      329000 -- (-3206.986) [-3197.564] (-3203.605) (-3201.679) * [-3198.070] (-3204.718) (-3205.444) (-3204.206) -- 0:02:47
      329500 -- (-3211.033) (-3196.198) (-3198.803) [-3199.511] * (-3202.414) (-3197.865) (-3205.891) [-3203.862] -- 0:02:46
      330000 -- (-3202.805) (-3198.894) (-3202.028) [-3202.371] * [-3198.160] (-3196.693) (-3205.713) (-3202.167) -- 0:02:48

      Average standard deviation of split frequencies: 0.000713

      330500 -- (-3202.891) (-3200.343) [-3199.115] (-3196.473) * (-3193.194) [-3202.104] (-3198.470) (-3213.613) -- 0:02:48
      331000 -- (-3197.857) [-3202.866] (-3204.451) (-3195.135) * (-3198.053) (-3198.907) [-3197.783] (-3205.177) -- 0:02:47
      331500 -- (-3199.122) [-3197.248] (-3200.200) (-3196.700) * [-3199.302] (-3200.359) (-3197.101) (-3206.653) -- 0:02:47
      332000 -- (-3208.140) (-3202.436) (-3206.054) [-3196.099] * (-3197.607) (-3206.539) [-3202.188] (-3205.052) -- 0:02:47
      332500 -- (-3202.246) (-3199.185) (-3202.789) [-3196.965] * (-3201.099) (-3198.443) [-3199.600] (-3200.249) -- 0:02:46
      333000 -- (-3198.697) (-3199.241) (-3198.837) [-3200.423] * [-3196.882] (-3200.400) (-3196.569) (-3200.264) -- 0:02:46
      333500 -- (-3199.262) (-3198.950) (-3198.953) [-3200.165] * (-3198.865) [-3203.978] (-3203.196) (-3197.300) -- 0:02:45
      334000 -- (-3199.991) [-3196.784] (-3197.524) (-3202.224) * (-3202.582) (-3196.913) [-3194.369] (-3201.473) -- 0:02:45
      334500 -- (-3197.350) [-3198.752] (-3196.153) (-3199.831) * (-3201.181) (-3200.830) [-3205.380] (-3204.143) -- 0:02:47
      335000 -- (-3199.507) [-3198.040] (-3211.130) (-3198.120) * (-3199.630) (-3200.407) (-3196.888) [-3196.290] -- 0:02:46

      Average standard deviation of split frequencies: 0.000701

      335500 -- (-3200.471) [-3199.598] (-3200.145) (-3201.841) * (-3200.561) (-3197.831) (-3197.500) [-3193.765] -- 0:02:46
      336000 -- (-3206.857) [-3201.392] (-3203.392) (-3203.262) * [-3203.270] (-3198.020) (-3198.580) (-3196.164) -- 0:02:46
      336500 -- (-3199.740) [-3201.168] (-3200.992) (-3204.765) * (-3200.022) (-3205.896) [-3197.685] (-3197.472) -- 0:02:45
      337000 -- (-3202.034) (-3197.976) [-3199.192] (-3198.761) * [-3202.722] (-3200.806) (-3199.684) (-3199.705) -- 0:02:45
      337500 -- (-3202.301) (-3197.208) [-3200.705] (-3196.636) * (-3201.936) (-3200.188) (-3197.446) [-3199.527] -- 0:02:44
      338000 -- [-3200.406] (-3201.615) (-3201.445) (-3198.102) * (-3200.407) (-3200.693) [-3192.118] (-3194.445) -- 0:02:44
      338500 -- [-3199.380] (-3196.653) (-3200.466) (-3201.689) * [-3198.313] (-3201.102) (-3201.551) (-3195.401) -- 0:02:46
      339000 -- [-3197.815] (-3202.287) (-3201.291) (-3200.385) * [-3200.940] (-3205.816) (-3195.965) (-3197.718) -- 0:02:45
      339500 -- [-3196.025] (-3204.784) (-3203.409) (-3200.429) * (-3197.933) (-3206.733) (-3197.803) [-3198.677] -- 0:02:45
      340000 -- [-3203.624] (-3199.110) (-3206.804) (-3197.826) * [-3199.675] (-3208.945) (-3199.009) (-3196.890) -- 0:02:45

      Average standard deviation of split frequencies: 0.000692

      340500 -- (-3197.412) (-3197.943) [-3199.563] (-3210.190) * (-3203.169) [-3199.327] (-3201.901) (-3196.983) -- 0:02:44
      341000 -- (-3202.584) (-3193.692) [-3204.573] (-3200.368) * (-3199.809) (-3199.441) (-3199.044) [-3198.479] -- 0:02:44
      341500 -- (-3192.899) [-3196.877] (-3201.154) (-3203.653) * [-3198.290] (-3202.036) (-3201.481) (-3202.763) -- 0:02:43
      342000 -- (-3201.738) [-3199.402] (-3199.088) (-3206.424) * (-3195.595) [-3199.622] (-3196.086) (-3199.225) -- 0:02:43
      342500 -- (-3201.775) (-3207.493) (-3199.108) [-3195.618] * (-3198.964) (-3198.047) [-3198.503] (-3199.461) -- 0:02:45
      343000 -- [-3196.829] (-3201.965) (-3199.978) (-3200.732) * (-3199.634) [-3197.797] (-3201.713) (-3200.543) -- 0:02:44
      343500 -- (-3200.976) (-3199.370) (-3198.363) [-3197.514] * [-3194.958] (-3203.358) (-3197.065) (-3193.859) -- 0:02:44
      344000 -- [-3200.148] (-3205.468) (-3195.855) (-3203.097) * [-3195.777] (-3207.056) (-3202.086) (-3196.443) -- 0:02:44
      344500 -- (-3200.642) [-3200.509] (-3198.815) (-3196.383) * [-3203.013] (-3199.063) (-3195.156) (-3204.035) -- 0:02:43
      345000 -- [-3202.150] (-3198.169) (-3198.472) (-3201.263) * [-3202.374] (-3196.123) (-3202.501) (-3200.542) -- 0:02:43

      Average standard deviation of split frequencies: 0.000681

      345500 -- (-3201.825) [-3195.041] (-3200.763) (-3198.010) * (-3195.740) (-3195.554) [-3199.255] (-3207.136) -- 0:02:42
      346000 -- (-3203.761) (-3201.048) [-3202.679] (-3196.398) * (-3201.086) (-3200.306) [-3206.926] (-3203.230) -- 0:02:42
      346500 -- (-3201.153) (-3198.256) [-3199.122] (-3201.757) * (-3201.298) [-3203.352] (-3203.604) (-3199.966) -- 0:02:44
      347000 -- (-3201.334) [-3198.426] (-3195.443) (-3201.220) * [-3198.524] (-3200.557) (-3204.096) (-3197.398) -- 0:02:43
      347500 -- (-3197.871) (-3202.056) (-3195.120) [-3199.863] * (-3206.021) (-3201.930) (-3208.778) [-3198.531] -- 0:02:43
      348000 -- (-3198.920) [-3201.756] (-3194.018) (-3203.233) * [-3199.930] (-3200.430) (-3200.407) (-3202.456) -- 0:02:43
      348500 -- (-3202.119) (-3207.490) (-3197.404) [-3199.578] * (-3201.654) [-3199.180] (-3205.154) (-3210.686) -- 0:02:42
      349000 -- (-3199.120) (-3200.052) (-3197.010) [-3200.825] * (-3200.052) (-3199.390) (-3198.555) [-3200.230] -- 0:02:42
      349500 -- (-3197.113) [-3205.092] (-3197.916) (-3197.170) * (-3204.009) [-3197.626] (-3205.211) (-3200.543) -- 0:02:41
      350000 -- [-3198.469] (-3192.195) (-3199.593) (-3202.395) * (-3199.404) (-3197.905) (-3196.556) [-3207.174] -- 0:02:41

      Average standard deviation of split frequencies: 0.000672

      350500 -- (-3199.982) (-3193.764) (-3209.224) [-3199.763] * (-3202.891) (-3198.701) [-3197.594] (-3198.784) -- 0:02:41
      351000 -- (-3199.282) [-3195.858] (-3202.328) (-3201.676) * [-3197.342] (-3205.227) (-3195.861) (-3205.387) -- 0:02:42
      351500 -- (-3194.639) [-3203.541] (-3206.655) (-3205.154) * [-3197.366] (-3210.624) (-3196.863) (-3202.240) -- 0:02:42
      352000 -- (-3197.659) (-3202.388) (-3206.664) [-3202.782] * [-3197.735] (-3203.999) (-3196.312) (-3206.279) -- 0:02:42
      352500 -- (-3197.550) [-3199.430] (-3204.510) (-3205.860) * [-3195.289] (-3199.995) (-3200.219) (-3201.119) -- 0:02:41
      353000 -- (-3199.199) (-3202.774) [-3200.422] (-3199.544) * (-3196.695) (-3198.087) (-3198.211) [-3202.731] -- 0:02:41
      353500 -- [-3201.672] (-3199.769) (-3202.077) (-3206.840) * [-3195.753] (-3201.592) (-3195.643) (-3201.885) -- 0:02:40
      354000 -- [-3193.634] (-3202.840) (-3203.023) (-3202.534) * [-3194.716] (-3204.665) (-3198.624) (-3205.705) -- 0:02:40
      354500 -- (-3202.466) (-3203.336) (-3200.340) [-3203.451] * [-3201.911] (-3199.432) (-3202.499) (-3214.280) -- 0:02:40
      355000 -- (-3198.065) (-3195.232) [-3195.862] (-3205.276) * (-3202.101) (-3201.098) [-3197.267] (-3202.407) -- 0:02:41

      Average standard deviation of split frequencies: 0.000662

      355500 -- [-3198.458] (-3198.536) (-3198.723) (-3207.023) * [-3202.051] (-3205.702) (-3200.680) (-3207.574) -- 0:02:41
      356000 -- (-3206.789) (-3200.875) (-3199.016) [-3201.817] * (-3195.797) (-3197.490) (-3203.336) [-3198.690] -- 0:02:41
      356500 -- (-3193.233) (-3199.791) (-3197.286) [-3195.307] * (-3200.535) [-3194.701] (-3207.052) (-3204.101) -- 0:02:40
      357000 -- (-3201.184) (-3202.088) [-3195.473] (-3200.720) * [-3197.137] (-3195.954) (-3200.006) (-3206.600) -- 0:02:40
      357500 -- [-3195.385] (-3201.812) (-3201.495) (-3195.793) * (-3193.002) [-3198.392] (-3201.629) (-3200.165) -- 0:02:39
      358000 -- (-3202.172) (-3196.315) (-3199.204) [-3197.783] * [-3194.816] (-3197.765) (-3200.109) (-3196.875) -- 0:02:39
      358500 -- [-3201.174] (-3199.693) (-3199.924) (-3194.923) * (-3200.199) (-3204.494) [-3202.669] (-3195.712) -- 0:02:39
      359000 -- (-3201.609) (-3196.085) (-3224.202) [-3200.058] * (-3196.487) (-3203.151) (-3197.825) [-3200.820] -- 0:02:40
      359500 -- (-3198.928) (-3196.915) (-3205.655) [-3199.832] * [-3201.534] (-3198.905) (-3200.201) (-3198.985) -- 0:02:40
      360000 -- (-3200.312) (-3202.991) [-3203.815] (-3203.145) * (-3199.727) (-3202.281) [-3201.278] (-3198.655) -- 0:02:40

      Average standard deviation of split frequencies: 0.000654

      360500 -- (-3201.679) (-3198.454) [-3195.093] (-3203.629) * [-3201.644] (-3194.363) (-3200.130) (-3196.818) -- 0:02:39
      361000 -- (-3202.124) (-3200.191) (-3196.057) [-3198.893] * [-3201.612] (-3205.090) (-3200.124) (-3197.845) -- 0:02:39
      361500 -- (-3202.816) [-3194.151] (-3201.863) (-3197.313) * (-3197.857) (-3212.752) (-3197.987) [-3204.122] -- 0:02:38
      362000 -- (-3197.599) [-3200.398] (-3197.864) (-3205.194) * (-3198.348) (-3204.821) (-3200.701) [-3197.541] -- 0:02:38
      362500 -- (-3205.352) (-3201.926) [-3203.580] (-3197.056) * (-3200.619) [-3200.780] (-3201.355) (-3197.365) -- 0:02:38
      363000 -- (-3199.633) [-3201.656] (-3201.105) (-3201.359) * (-3196.708) (-3194.964) (-3200.229) [-3196.801] -- 0:02:39
      363500 -- (-3203.405) [-3197.559] (-3200.264) (-3201.051) * (-3201.678) (-3194.673) (-3200.842) [-3195.900] -- 0:02:39
      364000 -- [-3209.565] (-3198.899) (-3197.809) (-3199.175) * (-3203.144) [-3193.106] (-3202.674) (-3193.767) -- 0:02:39
      364500 -- (-3207.794) [-3198.229] (-3195.393) (-3200.441) * (-3205.530) [-3198.239] (-3196.877) (-3195.305) -- 0:02:38
      365000 -- [-3201.876] (-3204.050) (-3198.302) (-3197.270) * (-3197.252) (-3208.890) [-3199.376] (-3202.210) -- 0:02:38

      Average standard deviation of split frequencies: 0.000644

      365500 -- [-3203.255] (-3197.032) (-3198.564) (-3203.513) * (-3205.386) [-3198.663] (-3197.234) (-3199.898) -- 0:02:37
      366000 -- (-3195.137) (-3202.048) (-3197.857) [-3202.703] * [-3200.236] (-3195.200) (-3195.989) (-3202.693) -- 0:02:37
      366500 -- (-3204.945) [-3198.272] (-3200.772) (-3202.621) * (-3195.480) (-3198.329) (-3197.237) [-3200.185] -- 0:02:37
      367000 -- [-3194.338] (-3195.745) (-3198.056) (-3200.269) * [-3194.305] (-3201.972) (-3198.636) (-3205.752) -- 0:02:36
      367500 -- (-3199.357) [-3200.701] (-3198.133) (-3198.093) * (-3202.249) (-3202.354) [-3193.128] (-3201.714) -- 0:02:38
      368000 -- (-3199.342) [-3201.429] (-3198.215) (-3198.312) * [-3198.521] (-3201.908) (-3196.364) (-3206.336) -- 0:02:38
      368500 -- (-3197.624) (-3202.835) (-3198.077) [-3196.046] * (-3203.811) [-3198.865] (-3197.326) (-3201.624) -- 0:02:37
      369000 -- [-3196.166] (-3198.374) (-3198.368) (-3204.370) * (-3198.067) (-3199.910) (-3199.310) [-3200.467] -- 0:02:37
      369500 -- [-3199.729] (-3196.133) (-3202.462) (-3202.888) * (-3204.098) (-3199.357) (-3194.856) [-3208.581] -- 0:02:36
      370000 -- (-3197.384) (-3195.774) (-3201.222) [-3196.331] * (-3200.688) [-3201.074] (-3195.457) (-3198.497) -- 0:02:36

      Average standard deviation of split frequencies: 0.000636

      370500 -- (-3195.010) (-3197.151) [-3195.053] (-3200.212) * [-3199.921] (-3197.293) (-3199.303) (-3199.609) -- 0:02:36
      371000 -- (-3198.450) (-3195.436) (-3195.583) [-3198.768] * [-3196.140] (-3199.292) (-3203.007) (-3198.608) -- 0:02:35
      371500 -- (-3210.008) (-3204.130) (-3197.101) [-3200.157] * (-3197.151) (-3204.052) [-3200.350] (-3201.999) -- 0:02:37
      372000 -- [-3201.061] (-3197.710) (-3200.168) (-3205.934) * (-3201.305) [-3204.476] (-3201.527) (-3210.543) -- 0:02:37
      372500 -- (-3195.710) (-3198.859) [-3204.704] (-3199.243) * (-3202.458) (-3201.860) [-3198.096] (-3200.963) -- 0:02:36
      373000 -- (-3198.642) (-3203.560) (-3197.697) [-3197.623] * (-3194.113) [-3198.958] (-3202.004) (-3201.994) -- 0:02:36
      373500 -- (-3206.942) (-3205.618) [-3194.897] (-3208.676) * (-3194.803) (-3205.192) [-3191.676] (-3207.948) -- 0:02:35
      374000 -- (-3195.285) (-3203.437) (-3198.703) [-3198.108] * (-3201.309) (-3203.317) (-3200.312) [-3201.991] -- 0:02:35
      374500 -- [-3204.796] (-3200.441) (-3205.176) (-3198.758) * (-3201.246) (-3195.299) [-3198.531] (-3197.398) -- 0:02:35
      375000 -- (-3210.005) (-3196.031) (-3201.467) [-3200.009] * [-3196.481] (-3200.208) (-3200.046) (-3203.614) -- 0:02:35

      Average standard deviation of split frequencies: 0.000627

      375500 -- (-3202.440) (-3198.883) (-3195.431) [-3202.119] * (-3197.065) (-3198.647) (-3202.305) [-3200.452] -- 0:02:36
      376000 -- (-3204.055) [-3205.118] (-3195.998) (-3203.229) * (-3199.838) (-3195.169) (-3195.193) [-3197.550] -- 0:02:36
      376500 -- (-3194.406) (-3201.774) (-3200.723) [-3198.744] * (-3198.447) (-3196.055) (-3203.166) [-3197.056] -- 0:02:35
      377000 -- [-3202.061] (-3199.018) (-3201.201) (-3202.493) * (-3196.099) (-3204.684) [-3202.812] (-3196.890) -- 0:02:35
      377500 -- [-3200.273] (-3205.945) (-3199.377) (-3197.370) * (-3204.843) (-3202.394) (-3197.494) [-3201.252] -- 0:02:35
      378000 -- (-3205.593) (-3197.130) [-3199.296] (-3201.094) * (-3201.714) (-3202.105) [-3198.772] (-3202.072) -- 0:02:34
      378500 -- (-3198.674) (-3197.576) (-3203.824) [-3198.829] * (-3200.227) (-3203.306) (-3203.466) [-3202.861] -- 0:02:34
      379000 -- (-3209.196) (-3202.802) [-3198.634] (-3210.224) * (-3204.930) (-3207.957) (-3201.123) [-3203.578] -- 0:02:34
      379500 -- (-3193.310) (-3201.160) [-3198.516] (-3204.483) * [-3199.046] (-3207.466) (-3196.211) (-3196.480) -- 0:02:33
      380000 -- (-3197.154) (-3202.886) [-3196.093] (-3198.845) * (-3201.390) (-3203.998) (-3199.881) [-3198.974] -- 0:02:35

      Average standard deviation of split frequencies: 0.000619

      380500 -- (-3198.385) (-3204.861) [-3196.500] (-3204.265) * [-3200.476] (-3205.561) (-3197.915) (-3203.972) -- 0:02:34
      381000 -- [-3197.579] (-3196.761) (-3197.159) (-3201.258) * (-3197.580) (-3201.054) [-3199.792] (-3201.426) -- 0:02:34
      381500 -- [-3203.743] (-3196.317) (-3197.479) (-3198.505) * (-3205.899) (-3203.755) [-3197.811] (-3197.869) -- 0:02:34
      382000 -- (-3205.089) (-3194.481) (-3201.146) [-3204.806] * (-3202.317) (-3198.419) [-3196.176] (-3200.265) -- 0:02:33
      382500 -- (-3195.633) [-3197.473] (-3203.867) (-3201.067) * (-3202.860) (-3205.068) [-3202.541] (-3198.733) -- 0:02:33
      383000 -- [-3198.194] (-3200.606) (-3198.756) (-3196.786) * (-3205.008) [-3199.152] (-3210.056) (-3197.717) -- 0:02:33
      383500 -- (-3196.774) (-3201.567) [-3203.108] (-3197.419) * (-3204.285) (-3196.149) [-3200.988] (-3198.420) -- 0:02:32
      384000 -- (-3200.040) (-3195.110) (-3203.846) [-3202.203] * (-3201.754) (-3197.266) [-3196.981] (-3204.769) -- 0:02:34
      384500 -- (-3196.903) [-3199.560] (-3204.847) (-3202.578) * [-3196.339] (-3211.540) (-3204.165) (-3204.860) -- 0:02:33
      385000 -- (-3200.020) [-3197.851] (-3202.468) (-3202.708) * [-3199.705] (-3199.479) (-3206.530) (-3201.225) -- 0:02:33

      Average standard deviation of split frequencies: 0.000611

      385500 -- (-3204.011) (-3204.375) [-3199.467] (-3199.618) * (-3196.433) (-3204.673) [-3203.907] (-3199.267) -- 0:02:33
      386000 -- [-3199.367] (-3204.742) (-3198.427) (-3198.218) * (-3195.405) (-3195.359) (-3208.538) [-3203.794] -- 0:02:32
      386500 -- (-3193.881) [-3199.218] (-3196.414) (-3199.636) * (-3206.108) (-3199.726) [-3200.038] (-3195.130) -- 0:02:32
      387000 -- (-3198.737) [-3202.742] (-3209.945) (-3195.747) * [-3207.132] (-3202.182) (-3195.466) (-3204.536) -- 0:02:32
      387500 -- [-3194.775] (-3200.340) (-3200.120) (-3202.525) * (-3197.968) (-3204.062) (-3204.315) [-3201.413] -- 0:02:31
      388000 -- (-3202.287) [-3202.594] (-3204.348) (-3205.745) * (-3194.920) (-3198.135) (-3205.820) [-3202.158] -- 0:02:33
      388500 -- (-3201.119) (-3212.804) (-3203.076) [-3197.514] * (-3196.896) (-3203.167) (-3200.491) [-3202.493] -- 0:02:32
      389000 -- (-3211.679) (-3203.109) [-3197.942] (-3199.428) * [-3206.837] (-3206.301) (-3198.794) (-3199.640) -- 0:02:32
      389500 -- (-3195.930) (-3198.978) [-3200.029] (-3208.376) * (-3198.841) (-3198.964) (-3202.215) [-3198.905] -- 0:02:32
      390000 -- (-3200.868) (-3198.189) (-3200.119) [-3198.209] * (-3202.625) (-3199.574) (-3197.799) [-3199.709] -- 0:02:31

      Average standard deviation of split frequencies: 0.000603

      390500 -- (-3196.131) [-3198.903] (-3207.058) (-3205.457) * [-3204.165] (-3197.355) (-3197.440) (-3197.316) -- 0:02:31
      391000 -- [-3198.748] (-3201.411) (-3205.770) (-3208.340) * (-3196.489) (-3201.273) [-3204.460] (-3201.356) -- 0:02:31
      391500 -- [-3196.051] (-3201.975) (-3206.262) (-3198.209) * (-3204.571) [-3200.617] (-3197.468) (-3195.784) -- 0:02:30
      392000 -- (-3213.580) (-3199.810) (-3202.846) [-3198.883] * (-3202.653) [-3195.089] (-3197.453) (-3196.876) -- 0:02:32
      392500 -- (-3206.032) (-3199.955) [-3206.683] (-3204.722) * (-3206.403) [-3201.102] (-3201.526) (-3199.091) -- 0:02:31
      393000 -- [-3201.812] (-3201.343) (-3196.238) (-3202.533) * (-3207.820) (-3205.710) [-3199.934] (-3204.300) -- 0:02:31
      393500 -- (-3209.465) [-3206.196] (-3199.009) (-3199.974) * (-3204.580) [-3197.600] (-3205.026) (-3198.203) -- 0:02:31
      394000 -- (-3198.103) [-3210.172] (-3204.257) (-3202.578) * (-3203.783) (-3201.869) (-3203.849) [-3197.849] -- 0:02:30
      394500 -- (-3198.083) (-3195.792) (-3201.597) [-3198.692] * (-3203.792) (-3200.203) (-3201.765) [-3201.381] -- 0:02:30
      395000 -- (-3202.702) (-3208.258) (-3198.049) [-3205.332] * (-3202.250) (-3200.798) (-3196.075) [-3196.345] -- 0:02:30

      Average standard deviation of split frequencies: 0.000595

      395500 -- (-3198.955) (-3199.561) (-3209.499) [-3199.422] * (-3203.157) (-3198.918) [-3194.201] (-3198.004) -- 0:02:29
      396000 -- (-3197.152) [-3197.409] (-3210.588) (-3208.762) * (-3209.029) (-3196.542) (-3197.235) [-3199.766] -- 0:02:29
      396500 -- [-3198.697] (-3203.687) (-3199.728) (-3198.492) * (-3209.727) (-3199.967) (-3199.450) [-3199.706] -- 0:02:30
      397000 -- (-3205.527) (-3203.062) [-3201.887] (-3199.261) * [-3205.358] (-3199.108) (-3201.195) (-3196.792) -- 0:02:30
      397500 -- (-3201.786) (-3201.146) [-3202.611] (-3200.338) * (-3200.481) (-3199.949) [-3198.067] (-3198.752) -- 0:02:30
      398000 -- (-3202.644) (-3202.664) (-3202.119) [-3196.766] * (-3200.023) [-3197.962] (-3201.798) (-3198.392) -- 0:02:29
      398500 -- (-3195.765) (-3200.965) (-3198.738) [-3198.454] * [-3199.028] (-3202.058) (-3200.948) (-3201.297) -- 0:02:29
      399000 -- (-3197.934) (-3205.254) (-3197.245) [-3197.299] * (-3208.678) [-3197.038] (-3204.301) (-3202.295) -- 0:02:29
      399500 -- (-3205.849) [-3203.468] (-3196.314) (-3200.149) * (-3202.315) (-3194.482) [-3198.110] (-3197.612) -- 0:02:28
      400000 -- (-3201.508) [-3202.007] (-3199.612) (-3197.689) * (-3197.052) [-3196.519] (-3198.476) (-3196.337) -- 0:02:28

      Average standard deviation of split frequencies: 0.000588

      400500 -- (-3200.898) [-3198.264] (-3197.432) (-3197.811) * (-3200.651) (-3210.561) (-3202.040) [-3197.559] -- 0:02:29
      401000 -- [-3199.262] (-3199.721) (-3201.536) (-3195.225) * (-3192.586) (-3202.703) [-3195.840] (-3200.663) -- 0:02:29
      401500 -- (-3198.124) (-3195.812) [-3196.007] (-3198.716) * (-3197.090) (-3201.372) [-3194.047] (-3199.902) -- 0:02:29
      402000 -- (-3199.243) (-3206.913) (-3199.326) [-3201.227] * [-3201.818] (-3200.708) (-3201.301) (-3211.541) -- 0:02:28
      402500 -- [-3193.191] (-3204.506) (-3199.868) (-3199.586) * [-3197.162] (-3193.621) (-3202.806) (-3193.772) -- 0:02:28
      403000 -- [-3193.663] (-3197.550) (-3219.014) (-3208.170) * [-3199.249] (-3197.273) (-3199.276) (-3194.295) -- 0:02:28
      403500 -- (-3202.665) (-3200.576) (-3201.111) [-3202.687] * (-3200.233) [-3196.919] (-3199.184) (-3203.247) -- 0:02:27
      404000 -- [-3200.343] (-3206.566) (-3199.008) (-3201.145) * [-3197.209] (-3198.416) (-3200.828) (-3201.310) -- 0:02:27
      404500 -- (-3196.082) (-3205.546) (-3204.813) [-3196.968] * (-3194.948) (-3198.529) [-3203.304] (-3195.321) -- 0:02:28
      405000 -- [-3202.142] (-3197.776) (-3199.841) (-3197.719) * [-3195.232] (-3200.509) (-3205.923) (-3201.175) -- 0:02:28

      Average standard deviation of split frequencies: 0.000581

      405500 -- (-3196.060) (-3207.919) (-3200.300) [-3197.229] * [-3196.735] (-3199.216) (-3197.444) (-3199.376) -- 0:02:28
      406000 -- [-3195.320] (-3201.798) (-3200.431) (-3201.401) * (-3196.669) (-3198.394) [-3195.479] (-3202.109) -- 0:02:27
      406500 -- (-3197.927) [-3204.574] (-3195.673) (-3197.492) * (-3199.344) (-3204.566) [-3197.439] (-3206.315) -- 0:02:27
      407000 -- (-3198.621) (-3201.117) [-3201.313] (-3196.665) * [-3197.564] (-3197.456) (-3203.656) (-3206.158) -- 0:02:27
      407500 -- (-3199.753) (-3200.799) [-3202.702] (-3202.547) * [-3206.424] (-3209.128) (-3198.997) (-3197.989) -- 0:02:26
      408000 -- (-3198.502) [-3197.210] (-3199.478) (-3201.893) * (-3202.965) [-3201.393] (-3198.241) (-3209.836) -- 0:02:26
      408500 -- (-3208.451) [-3196.061] (-3209.196) (-3204.482) * (-3195.370) (-3195.420) [-3196.371] (-3220.411) -- 0:02:27
      409000 -- (-3203.248) [-3198.138] (-3208.746) (-3204.214) * (-3199.588) (-3201.163) [-3197.389] (-3207.170) -- 0:02:27
      409500 -- [-3197.198] (-3198.956) (-3199.692) (-3208.178) * (-3207.672) (-3202.170) (-3196.758) [-3200.057] -- 0:02:27
      410000 -- (-3200.339) [-3200.882] (-3203.812) (-3207.356) * [-3201.934] (-3204.876) (-3200.830) (-3201.076) -- 0:02:26

      Average standard deviation of split frequencies: 0.000574

      410500 -- (-3203.535) (-3206.704) (-3209.009) [-3203.310] * [-3199.889] (-3201.344) (-3199.148) (-3203.124) -- 0:02:26
      411000 -- (-3199.167) [-3204.130] (-3204.678) (-3211.512) * (-3208.240) (-3205.394) [-3197.097] (-3204.829) -- 0:02:26
      411500 -- (-3195.119) (-3200.548) [-3194.145] (-3205.863) * (-3206.722) [-3199.425] (-3200.490) (-3200.396) -- 0:02:25
      412000 -- (-3194.047) (-3201.550) [-3197.659] (-3202.004) * [-3199.651] (-3205.677) (-3202.070) (-3199.361) -- 0:02:25
      412500 -- [-3196.802] (-3200.026) (-3202.827) (-3201.424) * (-3204.693) (-3200.181) [-3195.885] (-3196.879) -- 0:02:25
      413000 -- (-3198.885) (-3197.482) [-3199.815] (-3196.931) * (-3200.625) [-3193.822] (-3197.988) (-3203.753) -- 0:02:26
      413500 -- (-3195.701) [-3196.288] (-3201.292) (-3203.196) * (-3202.050) (-3201.496) [-3202.097] (-3199.618) -- 0:02:26
      414000 -- (-3195.219) (-3201.203) [-3203.589] (-3197.110) * (-3198.792) [-3202.054] (-3205.270) (-3199.353) -- 0:02:25
      414500 -- (-3195.439) (-3196.117) [-3197.955] (-3199.827) * [-3199.734] (-3200.799) (-3210.667) (-3201.223) -- 0:02:25
      415000 -- (-3199.553) (-3197.570) [-3201.704] (-3207.052) * (-3214.080) [-3200.980] (-3203.602) (-3202.084) -- 0:02:25

      Average standard deviation of split frequencies: 0.000567

      415500 -- (-3200.563) (-3200.210) [-3196.474] (-3200.724) * (-3201.169) (-3196.519) (-3203.405) [-3207.360] -- 0:02:24
      416000 -- [-3198.500] (-3205.622) (-3199.669) (-3199.416) * (-3197.821) [-3195.375] (-3201.389) (-3199.039) -- 0:02:24
      416500 -- (-3196.558) [-3199.165] (-3202.606) (-3198.180) * (-3203.107) [-3193.350] (-3198.470) (-3195.867) -- 0:02:24
      417000 -- (-3198.728) (-3196.230) [-3198.312] (-3201.844) * [-3198.580] (-3196.990) (-3200.321) (-3196.044) -- 0:02:25
      417500 -- (-3194.760) (-3198.228) [-3196.654] (-3201.960) * (-3197.906) [-3194.198] (-3203.121) (-3197.712) -- 0:02:25
      418000 -- (-3196.734) (-3198.533) [-3199.941] (-3201.926) * [-3197.138] (-3203.974) (-3198.509) (-3196.833) -- 0:02:24
      418500 -- (-3196.579) (-3202.715) [-3197.520] (-3204.873) * (-3201.490) [-3197.951] (-3200.518) (-3197.295) -- 0:02:24
      419000 -- (-3194.652) (-3203.496) [-3198.501] (-3196.619) * (-3202.444) (-3200.691) [-3198.540] (-3201.735) -- 0:02:24
      419500 -- [-3196.433] (-3196.803) (-3198.730) (-3201.798) * (-3201.264) (-3199.943) [-3200.507] (-3200.795) -- 0:02:23
      420000 -- (-3195.450) (-3208.560) (-3196.816) [-3198.298] * [-3199.827] (-3199.371) (-3196.904) (-3202.447) -- 0:02:23

      Average standard deviation of split frequencies: 0.000560

      420500 -- (-3200.340) (-3204.768) (-3193.237) [-3202.233] * [-3206.025] (-3199.708) (-3200.189) (-3201.786) -- 0:02:23
      421000 -- (-3201.198) (-3201.110) [-3204.219] (-3197.334) * (-3204.177) (-3200.951) [-3198.821] (-3209.394) -- 0:02:24
      421500 -- (-3199.913) [-3199.455] (-3196.886) (-3202.582) * (-3212.077) [-3198.941] (-3198.576) (-3200.735) -- 0:02:24
      422000 -- (-3206.156) [-3203.366] (-3195.022) (-3198.138) * [-3207.325] (-3195.540) (-3198.073) (-3202.505) -- 0:02:23
      422500 -- (-3200.906) (-3196.230) (-3200.560) [-3194.278] * (-3209.531) [-3195.307] (-3201.258) (-3198.225) -- 0:02:23
      423000 -- (-3212.214) [-3196.389] (-3200.904) (-3198.707) * (-3198.963) [-3200.980] (-3199.303) (-3202.951) -- 0:02:23
      423500 -- (-3199.959) (-3208.196) [-3202.625] (-3201.911) * (-3198.104) (-3206.481) [-3206.882] (-3200.240) -- 0:02:22
      424000 -- (-3199.399) (-3199.059) [-3195.647] (-3199.067) * (-3205.300) (-3213.036) (-3202.113) [-3198.159] -- 0:02:22
      424500 -- (-3212.004) [-3199.678] (-3205.093) (-3197.937) * [-3201.398] (-3213.330) (-3195.955) (-3199.332) -- 0:02:22
      425000 -- [-3203.503] (-3196.427) (-3204.134) (-3195.446) * [-3208.096] (-3201.771) (-3201.446) (-3199.106) -- 0:02:23

      Average standard deviation of split frequencies: 0.000553

      425500 -- (-3200.656) [-3194.093] (-3208.462) (-3199.784) * [-3196.657] (-3200.140) (-3197.283) (-3195.271) -- 0:02:23
      426000 -- (-3198.395) (-3201.158) [-3198.091] (-3217.061) * [-3193.431] (-3203.335) (-3195.629) (-3198.437) -- 0:02:22
      426500 -- [-3200.159] (-3212.992) (-3204.001) (-3208.994) * [-3197.841] (-3203.110) (-3199.473) (-3202.088) -- 0:02:22
      427000 -- [-3195.510] (-3198.066) (-3204.803) (-3199.844) * (-3201.503) (-3199.950) [-3197.705] (-3199.518) -- 0:02:22
      427500 -- (-3199.132) [-3196.508] (-3201.995) (-3205.377) * (-3198.294) [-3191.048] (-3199.095) (-3203.333) -- 0:02:21
      428000 -- (-3203.462) (-3199.289) (-3193.033) [-3198.947] * (-3201.263) (-3196.449) (-3201.740) [-3199.170] -- 0:02:21
      428500 -- (-3205.947) (-3206.007) (-3196.768) [-3201.535] * (-3195.572) (-3202.611) [-3196.384] (-3202.777) -- 0:02:21
      429000 -- (-3206.668) (-3201.067) (-3208.309) [-3197.505] * [-3199.461] (-3200.234) (-3197.375) (-3206.709) -- 0:02:21
      429500 -- (-3197.007) (-3206.530) [-3197.122] (-3201.133) * (-3211.513) (-3198.850) (-3203.861) [-3198.669] -- 0:02:22
      430000 -- [-3200.441] (-3203.911) (-3195.150) (-3204.688) * [-3199.702] (-3197.935) (-3197.868) (-3195.532) -- 0:02:21

      Average standard deviation of split frequencies: 0.000547

      430500 -- (-3199.333) (-3210.098) (-3197.264) [-3204.317] * (-3206.678) [-3203.326] (-3202.657) (-3201.426) -- 0:02:21
      431000 -- [-3202.568] (-3195.230) (-3203.744) (-3204.221) * (-3195.941) (-3195.998) (-3200.540) [-3201.823] -- 0:02:21
      431500 -- (-3201.603) [-3196.292] (-3200.686) (-3196.076) * (-3197.179) (-3193.994) (-3208.027) [-3195.991] -- 0:02:20
      432000 -- (-3202.712) (-3203.817) (-3201.732) [-3197.174] * (-3197.829) (-3199.171) (-3211.957) [-3199.554] -- 0:02:20
      432500 -- (-3201.085) (-3203.200) [-3201.726] (-3197.141) * (-3202.344) (-3203.594) (-3202.605) [-3202.217] -- 0:02:20
      433000 -- (-3198.932) (-3200.324) (-3196.783) [-3200.292] * [-3198.475] (-3195.839) (-3203.354) (-3203.925) -- 0:02:20
      433500 -- (-3210.593) (-3199.113) (-3200.909) [-3200.504] * (-3199.458) [-3199.269] (-3207.347) (-3196.881) -- 0:02:21
      434000 -- (-3213.678) (-3201.476) [-3196.513] (-3194.175) * (-3200.743) (-3201.027) (-3197.083) [-3201.153] -- 0:02:20
      434500 -- (-3209.082) (-3196.700) [-3196.554] (-3199.122) * (-3203.142) [-3197.083] (-3198.122) (-3200.278) -- 0:02:20
      435000 -- (-3203.070) (-3202.084) (-3197.004) [-3211.734] * (-3205.303) (-3200.114) [-3199.302] (-3199.085) -- 0:02:20

      Average standard deviation of split frequencies: 0.001081

      435500 -- (-3202.046) [-3199.211] (-3200.268) (-3207.625) * (-3197.581) (-3202.122) [-3194.834] (-3198.200) -- 0:02:19
      436000 -- [-3198.320] (-3199.466) (-3200.802) (-3203.981) * (-3198.554) (-3199.479) [-3196.297] (-3199.035) -- 0:02:19
      436500 -- (-3202.288) (-3196.959) [-3201.727] (-3199.372) * (-3198.678) (-3205.863) [-3205.034] (-3198.167) -- 0:02:19
      437000 -- [-3200.520] (-3201.051) (-3206.172) (-3202.994) * (-3195.050) (-3199.279) (-3211.520) [-3194.768] -- 0:02:19
      437500 -- (-3203.639) (-3201.727) (-3214.405) [-3203.212] * (-3200.691) (-3202.912) (-3201.327) [-3202.415] -- 0:02:20
      438000 -- [-3204.251] (-3200.355) (-3196.692) (-3201.826) * (-3217.207) [-3195.287] (-3207.132) (-3200.817) -- 0:02:19
      438500 -- (-3201.898) (-3201.657) [-3193.330] (-3201.008) * (-3202.349) (-3198.314) [-3199.645] (-3198.677) -- 0:02:19
      439000 -- (-3199.930) [-3203.513] (-3201.091) (-3195.065) * (-3202.563) [-3200.674] (-3200.499) (-3196.502) -- 0:02:19
      439500 -- [-3198.583] (-3203.231) (-3196.354) (-3197.175) * (-3201.080) (-3199.047) [-3197.584] (-3200.890) -- 0:02:19
      440000 -- [-3199.020] (-3198.661) (-3203.548) (-3207.112) * (-3197.803) [-3204.908] (-3198.486) (-3200.447) -- 0:02:18

      Average standard deviation of split frequencies: 0.001070

      440500 -- (-3200.367) (-3199.654) (-3199.622) [-3204.097] * (-3198.991) (-3203.407) (-3195.883) [-3206.697] -- 0:02:18
      441000 -- (-3199.018) [-3196.374] (-3207.455) (-3198.056) * (-3205.414) (-3199.776) (-3197.596) [-3200.957] -- 0:02:18
      441500 -- (-3201.839) (-3199.560) (-3198.592) [-3194.872] * [-3197.695] (-3204.129) (-3203.761) (-3203.536) -- 0:02:19
      442000 -- (-3196.997) (-3196.672) (-3199.600) [-3199.015] * (-3204.490) (-3201.764) (-3196.219) [-3203.221] -- 0:02:18
      442500 -- [-3198.169] (-3200.305) (-3200.023) (-3199.103) * (-3198.863) (-3197.082) [-3196.584] (-3198.577) -- 0:02:18
      443000 -- (-3198.392) (-3194.355) (-3202.505) [-3194.496] * (-3196.361) (-3198.289) (-3198.463) [-3207.176] -- 0:02:18
      443500 -- (-3201.910) (-3204.971) [-3198.542] (-3199.160) * (-3201.411) (-3202.482) [-3200.906] (-3204.333) -- 0:02:18
      444000 -- [-3197.058] (-3201.707) (-3194.199) (-3198.699) * (-3197.016) [-3201.418] (-3201.453) (-3209.755) -- 0:02:17
      444500 -- (-3200.961) (-3205.041) (-3196.809) [-3199.353] * (-3203.070) (-3196.048) [-3198.349] (-3209.003) -- 0:02:17
      445000 -- [-3197.783] (-3204.180) (-3196.821) (-3201.461) * (-3203.825) (-3195.865) [-3196.579] (-3209.338) -- 0:02:17

      Average standard deviation of split frequencies: 0.001057

      445500 -- (-3205.141) [-3200.675] (-3199.210) (-3205.371) * (-3195.792) (-3196.986) [-3199.959] (-3206.325) -- 0:02:16
      446000 -- (-3209.239) (-3195.379) [-3202.829] (-3206.637) * (-3200.091) [-3200.614] (-3199.306) (-3206.532) -- 0:02:17
      446500 -- [-3199.605] (-3196.896) (-3201.657) (-3197.758) * (-3207.252) (-3201.965) [-3207.254] (-3198.731) -- 0:02:17
      447000 -- (-3205.434) (-3199.962) (-3199.624) [-3198.786] * [-3196.274] (-3193.882) (-3205.322) (-3202.574) -- 0:02:17
      447500 -- (-3199.048) (-3197.534) [-3198.808] (-3199.608) * (-3197.347) [-3205.661] (-3200.151) (-3202.523) -- 0:02:17
      448000 -- (-3201.566) (-3203.573) [-3200.330] (-3200.201) * (-3207.520) (-3197.341) (-3197.749) [-3202.396] -- 0:02:16
      448500 -- (-3200.653) (-3201.087) (-3202.260) [-3200.673] * (-3198.131) (-3194.687) (-3195.851) [-3202.454] -- 0:02:16
      449000 -- [-3200.842] (-3202.935) (-3205.865) (-3201.967) * (-3202.877) [-3195.988] (-3199.714) (-3200.535) -- 0:02:16
      449500 -- (-3198.199) (-3204.220) (-3199.792) [-3197.696] * (-3199.457) (-3197.059) (-3196.733) [-3201.115] -- 0:02:15
      450000 -- (-3200.365) [-3205.479] (-3196.676) (-3200.827) * [-3195.585] (-3207.277) (-3205.372) (-3197.897) -- 0:02:16

      Average standard deviation of split frequencies: 0.001046

      450500 -- (-3207.945) (-3199.436) [-3200.478] (-3199.628) * (-3199.482) (-3191.350) [-3201.480] (-3205.350) -- 0:02:16
      451000 -- [-3199.985] (-3198.708) (-3199.149) (-3203.714) * (-3205.670) (-3194.760) [-3200.056] (-3200.051) -- 0:02:16
      451500 -- (-3199.211) [-3200.250] (-3202.908) (-3198.277) * (-3207.397) (-3195.710) (-3199.112) [-3197.302] -- 0:02:16
      452000 -- (-3198.469) [-3197.571] (-3207.524) (-3197.272) * (-3208.363) (-3200.644) [-3203.090] (-3200.999) -- 0:02:15
      452500 -- (-3201.813) [-3196.931] (-3199.242) (-3198.334) * [-3201.367] (-3208.084) (-3195.001) (-3197.563) -- 0:02:15
      453000 -- [-3199.990] (-3196.612) (-3202.042) (-3194.075) * (-3206.097) (-3200.723) [-3204.038] (-3199.172) -- 0:02:15
      453500 -- (-3202.291) [-3195.964] (-3211.653) (-3196.835) * (-3207.127) [-3200.816] (-3201.113) (-3200.416) -- 0:02:14
      454000 -- (-3201.762) (-3199.011) [-3199.491] (-3202.036) * (-3197.910) [-3197.145] (-3199.780) (-3197.079) -- 0:02:15
      454500 -- (-3200.122) (-3197.665) [-3196.951] (-3197.858) * (-3198.292) [-3201.336] (-3199.108) (-3196.965) -- 0:02:15
      455000 -- (-3202.317) (-3203.467) [-3201.099] (-3197.849) * (-3202.455) [-3202.220] (-3208.059) (-3198.579) -- 0:02:15

      Average standard deviation of split frequencies: 0.001034

      455500 -- [-3199.720] (-3199.778) (-3199.954) (-3201.782) * (-3199.253) (-3202.281) (-3198.159) [-3205.700] -- 0:02:15
      456000 -- [-3200.019] (-3203.116) (-3201.111) (-3204.390) * [-3200.177] (-3202.191) (-3202.272) (-3200.733) -- 0:02:14
      456500 -- [-3199.129] (-3196.054) (-3200.694) (-3198.582) * (-3200.582) [-3197.330] (-3198.639) (-3198.624) -- 0:02:14
      457000 -- (-3198.528) (-3203.454) [-3198.438] (-3198.356) * (-3197.512) (-3200.589) [-3198.712] (-3205.604) -- 0:02:14
      457500 -- (-3203.099) [-3198.552] (-3193.969) (-3204.443) * [-3195.212] (-3202.071) (-3196.229) (-3202.373) -- 0:02:13
      458000 -- (-3201.732) (-3202.299) [-3202.136] (-3202.876) * (-3201.970) [-3201.127] (-3194.017) (-3201.145) -- 0:02:14
      458500 -- (-3200.437) (-3200.389) [-3200.068] (-3205.881) * (-3202.312) (-3201.146) [-3197.630] (-3205.988) -- 0:02:14
      459000 -- (-3200.147) [-3194.132] (-3199.856) (-3199.657) * [-3195.602] (-3200.249) (-3205.682) (-3197.811) -- 0:02:14
      459500 -- [-3199.474] (-3205.401) (-3203.991) (-3200.973) * (-3195.871) (-3202.308) [-3197.941] (-3196.835) -- 0:02:14
      460000 -- [-3193.075] (-3201.251) (-3199.784) (-3200.413) * [-3194.843] (-3196.999) (-3196.049) (-3199.258) -- 0:02:13

      Average standard deviation of split frequencies: 0.001023

      460500 -- (-3197.736) (-3203.555) (-3196.387) [-3197.261] * (-3198.041) [-3197.068] (-3195.245) (-3197.046) -- 0:02:13
      461000 -- (-3203.183) (-3199.471) (-3197.592) [-3198.023] * (-3201.349) [-3199.422] (-3197.830) (-3195.673) -- 0:02:13
      461500 -- (-3211.106) (-3200.735) (-3203.789) [-3197.647] * [-3196.267] (-3198.113) (-3195.683) (-3198.746) -- 0:02:13
      462000 -- (-3204.937) (-3203.249) [-3200.691] (-3200.422) * (-3199.381) (-3206.366) [-3202.627] (-3200.381) -- 0:02:12
      462500 -- (-3206.406) (-3206.672) (-3202.418) [-3198.379] * (-3199.351) (-3200.261) [-3197.562] (-3200.745) -- 0:02:13
      463000 -- (-3201.320) [-3200.394] (-3201.299) (-3196.612) * (-3194.860) (-3198.250) [-3195.140] (-3200.139) -- 0:02:13
      463500 -- (-3194.502) (-3196.709) (-3206.906) [-3198.881] * [-3193.200] (-3211.163) (-3200.916) (-3196.212) -- 0:02:13
      464000 -- [-3197.726] (-3202.891) (-3206.702) (-3194.530) * (-3201.644) (-3200.083) (-3209.192) [-3196.715] -- 0:02:12
      464500 -- (-3202.208) (-3203.477) (-3206.779) [-3198.267] * [-3203.490] (-3196.950) (-3197.859) (-3200.279) -- 0:02:12
      465000 -- (-3201.179) (-3194.685) (-3197.052) [-3193.225] * (-3199.605) (-3199.129) [-3196.719] (-3197.785) -- 0:02:12

      Average standard deviation of split frequencies: 0.001012

      465500 -- (-3203.210) (-3199.022) (-3201.171) [-3199.028] * [-3198.198] (-3205.757) (-3203.843) (-3205.021) -- 0:02:12
      466000 -- (-3204.668) (-3205.488) (-3199.271) [-3198.166] * (-3194.271) [-3194.597] (-3203.040) (-3212.072) -- 0:02:11
      466500 -- (-3198.390) (-3198.408) (-3204.306) [-3195.932] * [-3199.304] (-3200.274) (-3198.564) (-3198.331) -- 0:02:12
      467000 -- (-3202.529) [-3200.366] (-3199.865) (-3203.203) * (-3198.976) [-3199.800] (-3206.319) (-3199.120) -- 0:02:12
      467500 -- [-3201.253] (-3196.460) (-3198.592) (-3199.389) * (-3198.497) [-3200.755] (-3198.800) (-3201.418) -- 0:02:12
      468000 -- (-3195.165) (-3198.187) [-3195.767] (-3200.453) * [-3196.495] (-3194.865) (-3200.756) (-3199.757) -- 0:02:11
      468500 -- [-3196.417] (-3195.105) (-3200.676) (-3197.371) * (-3201.846) [-3203.989] (-3204.836) (-3198.769) -- 0:02:11
      469000 -- (-3196.564) (-3199.972) (-3202.525) [-3197.552] * (-3197.563) (-3197.169) (-3197.950) [-3201.178] -- 0:02:11
      469500 -- (-3197.841) (-3199.113) (-3207.607) [-3200.840] * (-3195.219) [-3206.739] (-3202.833) (-3201.568) -- 0:02:11
      470000 -- (-3202.951) [-3199.026] (-3210.175) (-3199.332) * (-3205.828) (-3203.478) [-3199.995] (-3197.588) -- 0:02:10

      Average standard deviation of split frequencies: 0.001002

      470500 -- (-3209.803) [-3197.793] (-3206.601) (-3205.304) * (-3205.755) [-3197.805] (-3197.588) (-3199.420) -- 0:02:11
      471000 -- [-3204.156] (-3201.721) (-3201.518) (-3196.583) * [-3202.155] (-3200.612) (-3198.769) (-3203.748) -- 0:02:11
      471500 -- (-3197.486) (-3200.675) [-3196.897] (-3196.394) * (-3200.811) (-3199.228) [-3194.277] (-3201.280) -- 0:02:11
      472000 -- (-3194.618) [-3200.524] (-3205.794) (-3199.527) * (-3198.131) (-3199.971) [-3195.544] (-3201.876) -- 0:02:10
      472500 -- [-3197.986] (-3200.875) (-3195.599) (-3199.631) * [-3202.636] (-3198.848) (-3194.561) (-3204.762) -- 0:02:10
      473000 -- [-3199.296] (-3203.332) (-3199.873) (-3195.098) * (-3197.963) [-3199.326] (-3198.888) (-3198.605) -- 0:02:10
      473500 -- (-3204.914) (-3199.257) (-3196.278) [-3197.225] * [-3197.795] (-3201.982) (-3197.965) (-3199.846) -- 0:02:10
      474000 -- (-3200.562) (-3206.729) [-3193.936] (-3202.130) * (-3198.254) [-3207.285] (-3201.254) (-3200.794) -- 0:02:09
      474500 -- [-3201.006] (-3207.497) (-3199.153) (-3200.108) * (-3198.677) [-3203.436] (-3202.416) (-3202.812) -- 0:02:10
      475000 -- (-3209.848) [-3197.822] (-3200.293) (-3199.570) * (-3199.743) [-3203.171] (-3195.218) (-3201.704) -- 0:02:10

      Average standard deviation of split frequencies: 0.000990

      475500 -- [-3205.624] (-3201.663) (-3200.468) (-3205.188) * [-3196.727] (-3203.396) (-3196.677) (-3200.511) -- 0:02:10
      476000 -- [-3202.726] (-3202.143) (-3206.175) (-3200.875) * (-3198.157) (-3206.003) (-3201.428) [-3198.641] -- 0:02:09
      476500 -- (-3202.881) (-3211.012) (-3197.670) [-3201.862] * (-3197.791) (-3198.350) [-3200.151] (-3199.263) -- 0:02:09
      477000 -- (-3202.308) (-3198.932) (-3204.885) [-3197.957] * [-3200.101] (-3203.185) (-3199.709) (-3201.283) -- 0:02:09
      477500 -- [-3201.187] (-3198.432) (-3197.819) (-3194.140) * (-3200.157) (-3196.302) [-3198.093] (-3202.965) -- 0:02:09
      478000 -- [-3202.313] (-3201.136) (-3198.396) (-3201.781) * (-3201.803) (-3197.703) [-3197.655] (-3197.318) -- 0:02:08
      478500 -- (-3207.239) (-3195.365) (-3195.501) [-3199.688] * (-3196.275) (-3198.452) [-3196.053] (-3197.731) -- 0:02:09
      479000 -- (-3202.620) [-3198.287] (-3197.663) (-3204.261) * (-3196.208) (-3211.310) (-3200.634) [-3202.622] -- 0:02:09
      479500 -- [-3202.586] (-3196.229) (-3212.036) (-3199.256) * (-3196.938) (-3206.677) [-3197.984] (-3200.702) -- 0:02:09
      480000 -- [-3195.747] (-3197.609) (-3200.755) (-3199.151) * (-3197.957) (-3199.624) [-3200.146] (-3204.151) -- 0:02:08

      Average standard deviation of split frequencies: 0.000981

      480500 -- (-3201.315) (-3198.724) [-3203.174] (-3197.992) * (-3199.873) [-3199.810] (-3204.048) (-3202.302) -- 0:02:08
      481000 -- [-3204.732] (-3198.724) (-3200.710) (-3195.162) * (-3199.129) (-3198.825) [-3197.952] (-3204.725) -- 0:02:08
      481500 -- [-3199.905] (-3206.645) (-3193.335) (-3197.738) * [-3200.741] (-3203.771) (-3200.060) (-3204.478) -- 0:02:08
      482000 -- (-3201.373) (-3200.290) [-3198.868] (-3194.798) * [-3198.394] (-3200.993) (-3204.123) (-3204.423) -- 0:02:07
      482500 -- (-3194.818) (-3197.777) [-3201.161] (-3197.906) * (-3198.251) (-3201.162) [-3201.357] (-3201.901) -- 0:02:08
      483000 -- (-3192.783) [-3201.172] (-3194.818) (-3198.504) * (-3196.019) (-3210.317) (-3199.563) [-3198.028] -- 0:02:08
      483500 -- [-3192.414] (-3200.906) (-3196.778) (-3201.955) * (-3199.673) (-3200.503) [-3201.756] (-3197.319) -- 0:02:08
      484000 -- (-3195.636) [-3198.656] (-3204.453) (-3197.716) * (-3197.003) [-3195.978] (-3202.491) (-3198.727) -- 0:02:07
      484500 -- (-3198.609) (-3198.323) [-3197.161] (-3205.142) * (-3199.630) [-3198.063] (-3208.073) (-3194.852) -- 0:02:07
      485000 -- (-3206.263) [-3198.019] (-3202.735) (-3195.493) * (-3201.686) [-3201.839] (-3218.718) (-3205.018) -- 0:02:07

      Average standard deviation of split frequencies: 0.000970

      485500 -- (-3198.743) (-3201.520) [-3201.645] (-3199.596) * (-3199.763) (-3202.513) (-3207.689) [-3197.263] -- 0:02:07
      486000 -- (-3198.280) (-3197.426) (-3200.345) [-3198.310] * (-3203.612) [-3198.475] (-3213.320) (-3196.746) -- 0:02:06
      486500 -- (-3203.036) (-3204.066) (-3201.734) [-3194.843] * (-3202.251) [-3198.947] (-3214.359) (-3197.296) -- 0:02:06
      487000 -- (-3199.216) [-3202.455] (-3195.186) (-3204.439) * (-3204.901) (-3199.642) (-3202.386) [-3202.384] -- 0:02:07
      487500 -- [-3198.131] (-3198.781) (-3200.606) (-3200.235) * (-3196.614) [-3195.782] (-3198.898) (-3206.349) -- 0:02:07
      488000 -- [-3197.951] (-3202.511) (-3198.569) (-3201.705) * (-3203.864) (-3200.401) [-3198.152] (-3199.215) -- 0:02:06
      488500 -- [-3206.955] (-3206.533) (-3198.485) (-3197.462) * [-3203.927] (-3198.545) (-3202.185) (-3198.818) -- 0:02:06
      489000 -- [-3206.103] (-3203.019) (-3198.101) (-3204.004) * (-3197.857) (-3198.635) (-3203.250) [-3195.106] -- 0:02:06
      489500 -- [-3200.058] (-3199.256) (-3206.200) (-3209.234) * [-3198.143] (-3203.898) (-3206.609) (-3195.637) -- 0:02:06
      490000 -- (-3198.780) [-3196.437] (-3200.495) (-3200.943) * (-3202.067) [-3201.261] (-3199.331) (-3209.777) -- 0:02:05

      Average standard deviation of split frequencies: 0.000961

      490500 -- [-3202.629] (-3201.045) (-3199.737) (-3200.305) * [-3200.023] (-3201.019) (-3200.473) (-3200.449) -- 0:02:05
      491000 -- [-3198.694] (-3197.120) (-3198.174) (-3204.212) * (-3197.440) (-3203.294) [-3197.283] (-3207.676) -- 0:02:06
      491500 -- [-3197.349] (-3199.456) (-3205.944) (-3203.395) * (-3195.204) [-3196.494] (-3200.722) (-3196.937) -- 0:02:06
      492000 -- [-3198.812] (-3200.319) (-3216.020) (-3198.397) * (-3198.831) (-3204.759) (-3205.032) [-3195.559] -- 0:02:05
      492500 -- (-3200.915) [-3202.413] (-3207.699) (-3198.280) * (-3200.204) (-3195.230) (-3196.187) [-3192.348] -- 0:02:05
      493000 -- (-3201.511) [-3197.023] (-3201.210) (-3202.048) * (-3200.927) (-3198.551) (-3201.433) [-3195.944] -- 0:02:05
      493500 -- (-3197.434) [-3194.536] (-3200.452) (-3198.693) * (-3202.636) (-3199.674) (-3201.313) [-3199.112] -- 0:02:05
      494000 -- (-3200.339) [-3197.757] (-3200.287) (-3203.795) * (-3199.188) [-3194.903] (-3200.259) (-3202.530) -- 0:02:04
      494500 -- [-3208.563] (-3202.372) (-3195.016) (-3201.112) * (-3198.661) [-3200.421] (-3198.404) (-3198.012) -- 0:02:04
      495000 -- (-3207.027) [-3206.730] (-3205.992) (-3202.427) * (-3193.665) [-3198.710] (-3195.889) (-3195.962) -- 0:02:05

      Average standard deviation of split frequencies: 0.000950

      495500 -- (-3208.905) (-3200.898) [-3211.040] (-3198.484) * (-3195.960) (-3202.876) [-3193.942] (-3200.681) -- 0:02:05
      496000 -- (-3206.018) (-3199.546) (-3201.457) [-3196.428] * [-3198.579] (-3197.339) (-3208.081) (-3199.885) -- 0:02:04
      496500 -- (-3207.328) [-3199.355] (-3199.806) (-3205.716) * (-3201.958) [-3193.852] (-3209.447) (-3205.693) -- 0:02:04
      497000 -- [-3198.933] (-3201.417) (-3201.855) (-3193.975) * (-3202.162) [-3203.658] (-3206.713) (-3204.318) -- 0:02:04
      497500 -- (-3205.515) (-3202.626) (-3198.226) [-3197.777] * (-3196.973) [-3202.243] (-3208.520) (-3204.160) -- 0:02:04
      498000 -- [-3197.323] (-3212.594) (-3193.786) (-3204.273) * (-3202.723) (-3196.114) (-3206.355) [-3201.436] -- 0:02:03
      498500 -- [-3205.005] (-3203.377) (-3204.044) (-3200.895) * (-3198.394) (-3202.195) (-3213.802) [-3193.968] -- 0:02:03
      499000 -- (-3199.459) (-3202.219) [-3201.599] (-3211.311) * (-3205.864) (-3194.610) (-3201.440) [-3202.539] -- 0:02:03
      499500 -- (-3200.472) (-3210.456) [-3195.415] (-3212.052) * (-3201.762) [-3198.681] (-3194.547) (-3201.729) -- 0:02:04
      500000 -- (-3206.227) (-3200.339) [-3198.621] (-3204.614) * (-3196.840) (-3200.506) (-3199.934) [-3204.714] -- 0:02:04

      Average standard deviation of split frequencies: 0.000942

      500500 -- [-3204.647] (-3200.328) (-3202.590) (-3201.851) * (-3202.945) (-3202.491) (-3200.131) [-3195.491] -- 0:02:03
      501000 -- (-3202.951) (-3199.115) [-3197.061] (-3204.837) * (-3198.709) (-3202.825) [-3197.925] (-3205.846) -- 0:02:03
      501500 -- (-3196.759) (-3206.260) [-3201.276] (-3205.660) * [-3196.807] (-3199.078) (-3205.605) (-3201.918) -- 0:02:03
      502000 -- (-3197.580) (-3203.146) (-3197.316) [-3207.024] * (-3197.944) (-3202.172) (-3204.779) [-3199.326] -- 0:02:03
      502500 -- [-3194.436] (-3201.209) (-3199.142) (-3205.879) * (-3199.909) (-3201.214) (-3212.720) [-3201.096] -- 0:02:02
      503000 -- (-3198.714) (-3204.313) [-3202.606] (-3199.865) * (-3205.063) (-3199.891) (-3202.246) [-3202.533] -- 0:02:02
      503500 -- (-3199.009) [-3204.311] (-3200.989) (-3199.878) * (-3200.960) (-3195.947) (-3200.138) [-3194.584] -- 0:02:03
      504000 -- (-3206.290) (-3196.301) [-3201.621] (-3201.255) * (-3204.839) (-3201.522) (-3202.260) [-3196.427] -- 0:02:03
      504500 -- (-3206.796) [-3204.232] (-3198.163) (-3202.302) * (-3196.165) [-3195.718] (-3200.285) (-3202.197) -- 0:02:02
      505000 -- (-3198.524) [-3193.648] (-3201.703) (-3196.847) * (-3201.733) (-3203.151) (-3197.507) [-3198.005] -- 0:02:02

      Average standard deviation of split frequencies: 0.000932

      505500 -- (-3195.083) (-3203.070) [-3194.655] (-3203.013) * (-3199.796) (-3197.347) [-3195.834] (-3196.189) -- 0:02:02
      506000 -- (-3199.629) (-3201.794) (-3203.467) [-3196.506] * (-3199.276) [-3195.773] (-3195.773) (-3196.245) -- 0:02:02
      506500 -- (-3195.224) (-3196.143) (-3205.476) [-3195.396] * (-3208.694) (-3202.414) [-3206.063] (-3201.008) -- 0:02:01
      507000 -- (-3206.808) [-3204.764] (-3203.381) (-3195.308) * (-3205.804) [-3203.651] (-3200.274) (-3199.546) -- 0:02:01
      507500 -- (-3197.923) (-3205.426) [-3196.669] (-3203.101) * (-3196.804) (-3203.928) [-3202.082] (-3204.355) -- 0:02:02
      508000 -- (-3199.992) [-3198.961] (-3200.035) (-3200.684) * (-3199.663) [-3198.187] (-3209.923) (-3201.811) -- 0:02:02
      508500 -- [-3204.936] (-3201.722) (-3197.685) (-3196.817) * [-3195.932] (-3197.495) (-3200.372) (-3202.963) -- 0:02:01
      509000 -- (-3204.380) (-3202.102) (-3200.821) [-3204.095] * (-3196.848) (-3197.672) [-3211.367] (-3198.539) -- 0:02:01
      509500 -- (-3201.364) [-3195.640] (-3206.439) (-3209.806) * (-3201.687) (-3197.105) (-3204.675) [-3199.937] -- 0:02:01
      510000 -- (-3205.410) (-3201.680) (-3201.542) [-3204.207] * (-3197.460) (-3201.124) (-3207.662) [-3196.994] -- 0:02:01

      Average standard deviation of split frequencies: 0.000923

      510500 -- (-3204.734) (-3199.207) (-3202.353) [-3198.893] * [-3202.482] (-3195.964) (-3201.795) (-3195.794) -- 0:02:00
      511000 -- (-3196.207) (-3210.465) (-3202.784) [-3200.213] * [-3198.324] (-3198.659) (-3204.112) (-3196.227) -- 0:02:00
      511500 --