--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Nov 17 19:14:55 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/262/Gr28b-PE/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3196.22 -3206.12 2 -3195.98 -3205.30 -------------------------------------- TOTAL -3196.09 -3205.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363040 0.001527 0.285603 0.436985 0.361368 1288.31 1394.66 1.000 r(A<->C){all} 0.074744 0.000388 0.037570 0.113770 0.073424 999.61 1099.29 1.000 r(A<->G){all} 0.296595 0.001595 0.218618 0.374994 0.295289 871.73 883.83 1.000 r(A<->T){all} 0.077269 0.000326 0.044113 0.113914 0.075875 866.33 1029.92 1.000 r(C<->G){all} 0.125752 0.000634 0.079668 0.177852 0.124475 973.09 1047.22 1.001 r(C<->T){all} 0.386649 0.002133 0.300756 0.479625 0.386949 755.72 809.49 1.001 r(G<->T){all} 0.038991 0.000230 0.012184 0.069326 0.037528 1159.31 1192.89 1.000 pi(A){all} 0.264446 0.000125 0.243300 0.286124 0.264267 1009.13 1058.78 1.000 pi(C){all} 0.241908 0.000120 0.220113 0.262853 0.241950 1194.79 1214.22 1.000 pi(G){all} 0.227232 0.000123 0.205417 0.248965 0.227282 1104.68 1192.07 1.000 pi(T){all} 0.266414 0.000140 0.243327 0.289176 0.266307 1035.93 1119.62 1.000 alpha{1,2} 0.063566 0.001910 0.000277 0.148511 0.057354 1366.54 1433.77 1.000 alpha{3} 2.523163 0.784647 0.984573 4.207629 2.377121 1501.00 1501.00 1.000 pinvar{all} 0.314717 0.006133 0.160949 0.469993 0.318885 1125.16 1166.05 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3040.68366 Model 2: PositiveSelection -3040.68366 Model 0: one-ratio -3048.721689 Model 3: discrete -3039.649928 Model 7: beta -3039.935164 Model 8: beta&w>1 -3039.867416 Model 0 vs 1 16.076057999999648 Model 2 vs 1 0.0 Model 8 vs 7 0.1354959999998755
>C1 MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C2 MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C3 MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C4 MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C5 MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=447 C1 MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT C2 MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT C3 MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT C4 MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT C5 MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA * ** * * **********:***** :*** ****** *::*: *** *: C1 SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN C2 SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN C3 SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN C4 SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN C5 SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN ***:**:**::***:** ******::*.:********.******.***** C1 GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM C2 GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM C3 GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM C4 GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM C5 GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM ***** ****:***:*::**:*** ** *************:****::** C1 NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF C2 NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF C3 NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF C4 NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF C5 NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF **** :*****.**********.***::*****:***:**** ****:** C1 LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM C2 LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM C3 LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM C4 LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM C5 LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM *.**:********.****************:**** *********:**** C1 YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF C2 YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF C3 YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF C4 YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF C5 YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF ************************************************** C1 DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI C2 DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI C3 DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI C4 DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI C5 DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI ************************************************** C1 KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR C2 KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR C3 KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR C4 KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR C5 KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR ************************************************** C1 TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL C2 TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL C3 TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL C4 TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL C5 TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL ***************************************.******* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 447 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 447 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8940] Library Relaxation: Multi_proc [72] Relaxation Summary: [8940]--->[8940] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/262/Gr28b-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.326 Mb, Max= 30.733 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C2 MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C3 MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C4 MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C5 MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL FORMAT of file /tmp/tmp9153292024149614170aln Not Supported[FATAL:T-COFFEE] >C1 MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C2 MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C3 MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C4 MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C5 MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:447 S:100 BS:447 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 96.64 C1 C2 96.64 TOP 1 0 96.64 C2 C1 96.64 BOT 0 2 96.87 C1 C3 96.87 TOP 2 0 96.87 C3 C1 96.87 BOT 0 3 92.62 C1 C4 92.62 TOP 3 0 92.62 C4 C1 92.62 BOT 0 4 91.28 C1 C5 91.28 TOP 4 0 91.28 C5 C1 91.28 BOT 1 2 99.33 C2 C3 99.33 TOP 2 1 99.33 C3 C2 99.33 BOT 1 3 92.84 C2 C4 92.84 TOP 3 1 92.84 C4 C2 92.84 BOT 1 4 91.95 C2 C5 91.95 TOP 4 1 91.95 C5 C2 91.95 BOT 2 3 93.06 C3 C4 93.06 TOP 3 2 93.06 C4 C3 93.06 BOT 2 4 92.17 C3 C5 92.17 TOP 4 2 92.17 C5 C3 92.17 BOT 3 4 92.84 C4 C5 92.84 TOP 4 3 92.84 C5 C4 92.84 AVG 0 C1 * 94.35 AVG 1 C2 * 95.19 AVG 2 C3 * 95.36 AVG 3 C4 * 92.84 AVG 4 C5 * 92.06 TOT TOT * 93.96 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTGGCTCCTTAGGCGATCGGTTGGAAAATCGGGCAACCGACCACACGA C2 ATGTGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCTCACGA C3 ATGGGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCACACGA C4 ATGTGGCTCCTTGGACGATTGGTCAGGAAATCGGGTAACCGACCACACGA C5 ATGTGGCTCCTTGGGCGATTGGTTAGGAAGTCGGGTAACCGACCACACGA *** ********.*.***: *** .*.**.***** ********:***** C1 CGTATACACCTGCTATCGATTGACTATATTCATGGCACTTTGTCTCGGAA C2 CGTATACACCTGCTATCGGCTGACAACATTCATGGCACTTTGCCTCGGAA C3 CGTATACACCTGCTATCGACTGACCATATTCATGGCACTTTGCCTCGGAA C4 CGTATACACCTGCTATCGCCTGACCATATTCATGGCCCTCTGCCTTGGGA C5 CGTGTACAGCTGCTATCGATTGACCATACTCATGGCCCTTTGGCTCGGGA ***.**** ********* **** * * *******.** ** ** **.* C1 TTGTGCCTTACTACGTATCCATATCTTCGGAAGGCAGAGGAAAACTAACA C2 TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA C3 TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA C4 TTGTGCCCTACAACGTGACCATATCTTCAGAAGGCAGAGGAGTACTAACA C5 TTGTGCCCTACTACGTAACCGTATCTGCAGGAGGCCGAGGAAAACTGGCA ******* ** :****.:**.***** *.*.****.*****.:***..** C1 TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT C2 TCCTCCTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT C3 TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT C4 TCCTCCTACTTGGGCTACATCAACATCCTCATACGAATGGCCATCTATAT C5 TCTTCGTACATCGGCTACGTCAACATCCTCATGCGAATGGCCGTTTATAT ** ** ***:* ******.********.****.*********.* ***** C1 GGTCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT C2 GGGCAACTCATTCTACGGTGCCGTCAATCGGGATACGTTGATGTCCAACT C3 GGGCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT C4 GGGCAACTCATTCTACGGCGCCGTCCATCGGGATGCCTTGATGTCCAACT C5 GGGCAACTCGTTCTACGGCGCCATCAATCGGAGCTCGCTAATGTCCAACT ** ******.******** ***.**.*****.. * *.********** C1 TTTTCCTTACAGACATATCCAATGTGATAGATGCTTTGCAAAAGATCAAT C2 TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC C3 TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC C4 TTTTCCTTACGGGCATATCCAATGTGATCGATGGACTGCAGAAGATCAAC C5 TCTTCCTGACGGACATATCCAACGTGATAGATGGACTGCAAAAGATCAAC * ***** **.*.****** ** *****.**** : ****.******** C1 GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTATTGAACCGAAA C2 GGAATGCTGGGAATATTTGCCATTTTACTTATATCGCTGCTGAACCGGAA C3 GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTGCTGAACCGGAA C4 GGAATGCTGGGCATCTCTGCCATATTGCTTCTATCGCTGCTGCATCGCAG C5 GGAATGCTGGGTATCTCCGCCATACTGCTCATATCGCTGCTGAATCGGAG *********** **.* *****: *.** .*******. **.* ** *. C1 AGAATTGCTAAAACTGCTGGCCACATTCGATAGACTTGAGACGGAGGCGT C2 GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT C3 GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT C4 GGAATTGCTGCAACTGCTGGCCATTTTCGATGCACTCGAGACGGAGGCGT C5 GGATTTGCTGCAACTGCTGGCCATCTTCGATGGACTCGAGACGGAGGCGT .**:*****..***********. ******. *** ************* C1 TTCCACGGGTGGGCGTGGCAATGCACCAGGTTGCAGCTAATAAGAAAATG C2 TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG C3 TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG C4 TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCGGCTAAGAAGAAAATG C5 TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCAGCTAACAGGAAAATG ******* ***************** ***** **.***** *.******* C1 AATCGATTGGTTATAATCCTTGTTGGCAGTATGGTGGCATATATAACCTG C2 AATCGATTGGTTATGATCCTGGTTGGCAGTATGGTGGCATATATAACCTG C3 AATCGATTGGTTATGATCCTGGTGGGCAGTATGGTGGCATATATAACCTG C4 AATCGATTGGTGGCATTGCTGGTGGGCAGTATGGCGGCTTATATAACGTG C5 AATCGCTTGGTTGGGATCCTGGTGGGCAGCATGGCGGCATATATTACCTG *****.***** . .:* ** ** ***** **** ***:*****:** ** C1 TAGTTTTCTGATGATCAGTTTGAGAGACACGACCACATTTTCTATCTCAG C2 TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG C3 TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG C4 CAGTTTTCTGATGATCGGCCTGAGAGACGCGACCACATTTTCCATCTCAT C5 CAGTTTTCTGATGATCGGCCTAAGAGACGCGGCCACATTTTCCATCTCAT ***************.* *.******.**.********** ****** C1 CAGTGATTAGTTTTTTTTCACCACATTTTATCGTGTGCGCGGTTTCTTTT C2 CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT C3 CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT C4 CGGTGATTAGTTACTTTTCACCACATTGTATCGTGTGCGCGGTTTCTTTT C5 CGGTGATTAGTTATTTCTCACCACATTTTATCGTGTGCGCGGTTTCCTTT *.**********: ** ********** *************.**** *** C1 CTGGCTGGAAATGTAATGATTAAGTTACGCATATATCTGAGTGCACTTAA C2 CTGGCTGGAAATGTAATGATAAAATTACGCATATATCTGGGTGCTCTTAA C3 CTGGCTGGAAATGTAATGATCAAATTACGCATATATCTGGGTGCTCTTAA C4 CTGGTCGGAAATGTAATGATCAAGTTACGCATTTACCTGGGTGCTCTTAA C5 CTGGCTGGAAACATAATGATCAAATTACGCATATATCTGGGTGCTCTTAA **** ***** .******* **.********:** ***.****:***** C1 CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG C2 CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG C3 CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG C4 CGAGGTGTTGAAAAACCTAGCCCATCAATGGGACACCCGTACTCTGAAGG C5 CGAGGTGCTGAAAAACCTAGCCCATCAATGGGACACCCGCACCCTCAAGG ******* ****.************************** * ** **** C1 CAGTGAATCAAAAACAGCGCTCTCTACAATGTCTCGATTCATTTTCCATG C2 CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGAACTCATTTTCCATG C3 CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGGACTCATTTTCCATG C4 CAGTGACTCAGAAACAGCGCTCTCTGCAGTGTCTGGATTCATTCTCCATG C5 CAGTGGCTCAAAAACAGCGCTCCCTACAATGCCTGGATTCGTTCTCCATG *****..***.******** ** **.**.** ** .* **.** ****** C1 TACACCATTGTAACCAAGGATCCTGCGGAGATTATACAGGAGTCCATGGA C2 TACACCATTGTAACAAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA C3 TACACCATTGTAACCAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA C4 TACACCATTGTAACCAAGGATCCTGCCGAGATCATACAGGAGTCCATGGA C5 TACACCATCGTAACCAAGGATCCTGCCGAGATTATACAGGAGTCCATGGA ******** *****.*********** ***** ***************** C1 GATACATCATCTCATTTGCGAGGCAGCTGCCACGGCTAACAAATATTTTA C2 GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA C3 GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA C4 GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTCA C5 GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTTA ************ ***********.** ******** *********** * C1 CCTACCAATTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC C2 CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC C3 CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC C4 CCTACCAACTGCTGACCATTATTTCCATAGCATTTCTGATCATCGTTTTC C5 CCTACCAGCTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC *******. *************:*************************** C1 GATGCATACTATGTTCTGGAGACGCTACTGGGAAAATCGAAGCGCGAAAG C2 GATGCGTACTATGTCCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG C3 GATGCGTACTATGTTCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG C4 GATGCGTACTATGTACTGGAAACGCTGCTGGGCAAATCGAAGCGTGAAAG C5 GATGCGTACTATGTTCTGGAGACCCTGCTGGGGAAATCGAAGCGTGAAAG *****.******** *****.** **.***** *********** ***** C1 CAAATTCAAAACTGTGGAATTTGTGACATTTTTCTCGTGTCAAATGATTT C2 CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC C3 CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC C4 CAAATTCAAAACTGTGGAATTCGTCACGTTTTTCTCCTGCCAAATGATCC C5 CAAATTCAAAACTGTCGAGTTCGTGACGTTTTTCTCCTGTCAAATGATCC ***.*********** **.** ** **.******** ** ******** C1 TGTATCTGATCGCCATAATTTCCATTGTCGAGGGAAGTAATCGAGCCATC C2 TGTATCTAATCGCCATTATTTCGATTGTCGAGGGAAGTAATCGCGCCATC C3 TGTATTTGATCGCCATAATTTCCATTGTCGAGGGCAGTAATCGCGCCATC C4 TGTATCTGATTGCCATCATTTCGATTGTCGAAGGAAGCAATCGGGCTATT C5 TGTATCTGATCGCCATCATTTCGATTGTCGAGGGTAGCAATCGCGCCATC ***** *.** ***** ***** ********.** ** ***** ** ** C1 AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC C2 AAGAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC C3 AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC C4 AAAAAGAGCGAGAAAACGGGTGGAATAGTGCACTCACTACTCAATAAAAC C5 AAGAAGAGCGAGAAGACGGGAGGAATAGTGCACTCCCTACTCAACAAGAC **.***********.** **:**.***********.******** **.** C1 CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA C2 CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA C3 CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA C4 CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGCTGA C5 CAAAAGTGCAGAGGTCAAGGAGAAACTGCAGCAGTTCTCCATGCAGTTGA *********:***********************.************ *** C1 TGCATCTGAAAATTAATTTTACTGCAGCTGGTCTGTTCAACATCGACCGC C2 TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC C3 TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC C4 TGCATCTGAAAATTAACTTCACCGCAGCTGGACTGTTCAACATCGACCGC C5 TGCATCTCAAAATAAATTTCACTGCAGCTGGGCTGTTTAACATCGACCGC ******* *****:** ** ** **:** ** ***** ************ C1 ACATTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT C2 ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT C3 ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT C4 ACTTTGTACTTCACAATCAGCGGCGCCCTGACCACTTATCTCATCATCTT C5 ACCCTGTACTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT ** **** *****.******** *** ********************** C1 GCTGCAGTTCACATCCAATTCCCCGAACAATGGTTATGGGAATGGCAGCT C2 GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT C3 GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT C4 GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGAAATGGCAGCT C5 GCTGCAGTTCACGTCCAATTCCCCCAACAATGGTTATGGGAATGGCAGCT ************.*********** ******** *****.********** C1 CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT C2 CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT C3 CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT C4 CCTGCTGCGAGACCTTCAATAATATGACGAATCATACGCTT C5 CTTGCTGTGAGACCTTCAGTAACATGACGAATCATACGCTT * ***** **********.*** ****************** >C1 ATGTGGCTCCTTAGGCGATCGGTTGGAAAATCGGGCAACCGACCACACGA CGTATACACCTGCTATCGATTGACTATATTCATGGCACTTTGTCTCGGAA TTGTGCCTTACTACGTATCCATATCTTCGGAAGGCAGAGGAAAACTAACA TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT GGTCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT TTTTCCTTACAGACATATCCAATGTGATAGATGCTTTGCAAAAGATCAAT GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTATTGAACCGAAA AGAATTGCTAAAACTGCTGGCCACATTCGATAGACTTGAGACGGAGGCGT TTCCACGGGTGGGCGTGGCAATGCACCAGGTTGCAGCTAATAAGAAAATG AATCGATTGGTTATAATCCTTGTTGGCAGTATGGTGGCATATATAACCTG TAGTTTTCTGATGATCAGTTTGAGAGACACGACCACATTTTCTATCTCAG CAGTGATTAGTTTTTTTTCACCACATTTTATCGTGTGCGCGGTTTCTTTT CTGGCTGGAAATGTAATGATTAAGTTACGCATATATCTGAGTGCACTTAA CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG CAGTGAATCAAAAACAGCGCTCTCTACAATGTCTCGATTCATTTTCCATG TACACCATTGTAACCAAGGATCCTGCGGAGATTATACAGGAGTCCATGGA GATACATCATCTCATTTGCGAGGCAGCTGCCACGGCTAACAAATATTTTA CCTACCAATTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCATACTATGTTCTGGAGACGCTACTGGGAAAATCGAAGCGCGAAAG CAAATTCAAAACTGTGGAATTTGTGACATTTTTCTCGTGTCAAATGATTT TGTATCTGATCGCCATAATTTCCATTGTCGAGGGAAGTAATCGAGCCATC AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA TGCATCTGAAAATTAATTTTACTGCAGCTGGTCTGTTCAACATCGACCGC ACATTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCGAACAATGGTTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT >C2 ATGTGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCTCACGA CGTATACACCTGCTATCGGCTGACAACATTCATGGCACTTTGCCTCGGAA TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA TCCTCCTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT GGGCAACTCATTCTACGGTGCCGTCAATCGGGATACGTTGATGTCCAACT TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC GGAATGCTGGGAATATTTGCCATTTTACTTATATCGCTGCTGAACCGGAA GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG AATCGATTGGTTATGATCCTGGTTGGCAGTATGGTGGCATATATAACCTG TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT CTGGCTGGAAATGTAATGATAAAATTACGCATATATCTGGGTGCTCTTAA CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGAACTCATTTTCCATG TACACCATTGTAACAAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTCCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC TGTATCTAATCGCCATTATTTCGATTGTCGAGGGAAGTAATCGCGCCATC AAGAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT >C3 ATGGGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCACACGA CGTATACACCTGCTATCGACTGACCATATTCATGGCACTTTGCCTCGGAA TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT GGGCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTGCTGAACCGGAA GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG AATCGATTGGTTATGATCCTGGTGGGCAGTATGGTGGCATATATAACCTG TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT CTGGCTGGAAATGTAATGATCAAATTACGCATATATCTGGGTGCTCTTAA CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGGACTCATTTTCCATG TACACCATTGTAACCAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTTCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC TGTATTTGATCGCCATAATTTCCATTGTCGAGGGCAGTAATCGCGCCATC AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT >C4 ATGTGGCTCCTTGGACGATTGGTCAGGAAATCGGGTAACCGACCACACGA CGTATACACCTGCTATCGCCTGACCATATTCATGGCCCTCTGCCTTGGGA TTGTGCCCTACAACGTGACCATATCTTCAGAAGGCAGAGGAGTACTAACA TCCTCCTACTTGGGCTACATCAACATCCTCATACGAATGGCCATCTATAT GGGCAACTCATTCTACGGCGCCGTCCATCGGGATGCCTTGATGTCCAACT TTTTCCTTACGGGCATATCCAATGTGATCGATGGACTGCAGAAGATCAAC GGAATGCTGGGCATCTCTGCCATATTGCTTCTATCGCTGCTGCATCGCAG GGAATTGCTGCAACTGCTGGCCATTTTCGATGCACTCGAGACGGAGGCGT TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCGGCTAAGAAGAAAATG AATCGATTGGTGGCATTGCTGGTGGGCAGTATGGCGGCTTATATAACGTG CAGTTTTCTGATGATCGGCCTGAGAGACGCGACCACATTTTCCATCTCAT CGGTGATTAGTTACTTTTCACCACATTGTATCGTGTGCGCGGTTTCTTTT CTGGTCGGAAATGTAATGATCAAGTTACGCATTTACCTGGGTGCTCTTAA CGAGGTGTTGAAAAACCTAGCCCATCAATGGGACACCCGTACTCTGAAGG CAGTGACTCAGAAACAGCGCTCTCTGCAGTGTCTGGATTCATTCTCCATG TACACCATTGTAACCAAGGATCCTGCCGAGATCATACAGGAGTCCATGGA GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTCA CCTACCAACTGCTGACCATTATTTCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTACTGGAAACGCTGCTGGGCAAATCGAAGCGTGAAAG CAAATTCAAAACTGTGGAATTCGTCACGTTTTTCTCCTGCCAAATGATCC TGTATCTGATTGCCATCATTTCGATTGTCGAAGGAAGCAATCGGGCTATT AAAAAGAGCGAGAAAACGGGTGGAATAGTGCACTCACTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGCTGA TGCATCTGAAAATTAACTTCACCGCAGCTGGACTGTTCAACATCGACCGC ACTTTGTACTTCACAATCAGCGGCGCCCTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGAAATGGCAGCT CCTGCTGCGAGACCTTCAATAATATGACGAATCATACGCTT >C5 ATGTGGCTCCTTGGGCGATTGGTTAGGAAGTCGGGTAACCGACCACACGA CGTGTACAGCTGCTATCGATTGACCATACTCATGGCCCTTTGGCTCGGGA TTGTGCCCTACTACGTAACCGTATCTGCAGGAGGCCGAGGAAAACTGGCA TCTTCGTACATCGGCTACGTCAACATCCTCATGCGAATGGCCGTTTATAT GGGCAACTCGTTCTACGGCGCCATCAATCGGAGCTCGCTAATGTCCAACT TCTTCCTGACGGACATATCCAACGTGATAGATGGACTGCAAAAGATCAAC GGAATGCTGGGTATCTCCGCCATACTGCTCATATCGCTGCTGAATCGGAG GGATTTGCTGCAACTGCTGGCCATCTTCGATGGACTCGAGACGGAGGCGT TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCAGCTAACAGGAAAATG AATCGCTTGGTTGGGATCCTGGTGGGCAGCATGGCGGCATATATTACCTG CAGTTTTCTGATGATCGGCCTAAGAGACGCGGCCACATTTTCCATCTCAT CGGTGATTAGTTATTTCTCACCACATTTTATCGTGTGCGCGGTTTCCTTT CTGGCTGGAAACATAATGATCAAATTACGCATATATCTGGGTGCTCTTAA CGAGGTGCTGAAAAACCTAGCCCATCAATGGGACACCCGCACCCTCAAGG CAGTGGCTCAAAAACAGCGCTCCCTACAATGCCTGGATTCGTTCTCCATG TACACCATCGTAACCAAGGATCCTGCCGAGATTATACAGGAGTCCATGGA GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTTA CCTACCAGCTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTTCTGGAGACCCTGCTGGGGAAATCGAAGCGTGAAAG CAAATTCAAAACTGTCGAGTTCGTGACGTTTTTCTCCTGTCAAATGATCC TGTATCTGATCGCCATCATTTCGATTGTCGAGGGTAGCAATCGCGCCATC AAGAAGAGCGAGAAGACGGGAGGAATAGTGCACTCCCTACTCAACAAGAC CAAAAGTGCAGAGGTCAAGGAGAAACTGCAGCAGTTCTCCATGCAGTTGA TGCATCTCAAAATAAATTTCACTGCAGCTGGGCTGTTTAACATCGACCGC ACCCTGTACTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACGTCCAATTCCCCCAACAATGGTTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAGTAACATGACGAATCATACGCTT >C1 MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C2 MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C3 MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C4 MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >C5 MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1341 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479409763 Setting output file names to "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1037292650 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4969495876 Seed = 1876618103 Swapseed = 1479409763 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 31 unique site patterns Division 2 has 21 unique site patterns Division 3 has 77 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3809.066545 -- -25.624409 Chain 2 -- -3793.156629 -- -25.624409 Chain 3 -- -3672.573272 -- -25.624409 Chain 4 -- -3735.941661 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3784.790812 -- -25.624409 Chain 2 -- -3672.141718 -- -25.624409 Chain 3 -- -3791.963973 -- -25.624409 Chain 4 -- -3788.709725 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3809.067] (-3793.157) (-3672.573) (-3735.942) * [-3784.791] (-3672.142) (-3791.964) (-3788.710) 500 -- (-3263.010) (-3269.976) (-3255.388) [-3269.168] * (-3267.818) [-3256.463] (-3259.813) (-3262.815) -- 0:33:19 1000 -- [-3240.511] (-3245.772) (-3243.356) (-3257.294) * (-3247.089) (-3247.683) [-3246.755] (-3241.869) -- 0:16:39 1500 -- (-3221.891) [-3222.046] (-3230.031) (-3236.956) * (-3231.046) (-3239.147) [-3228.817] (-3236.598) -- 0:11:05 2000 -- (-3215.491) [-3203.170] (-3218.330) (-3226.853) * (-3213.319) (-3241.803) (-3226.069) [-3215.110] -- 0:08:19 2500 -- (-3213.267) [-3205.780] (-3215.318) (-3229.302) * (-3207.440) (-3228.642) (-3227.456) [-3204.867] -- 0:06:39 3000 -- (-3213.205) (-3204.110) (-3200.952) [-3212.879] * (-3206.819) (-3206.633) (-3215.074) [-3205.284] -- 0:05:32 3500 -- (-3210.096) [-3202.353] (-3202.193) (-3204.978) * [-3205.935] (-3201.319) (-3205.564) (-3202.140) -- 0:04:44 4000 -- [-3196.870] (-3202.487) (-3203.148) (-3200.287) * (-3198.307) [-3200.653] (-3207.731) (-3201.455) -- 0:04:09 4500 -- [-3200.701] (-3195.660) (-3202.613) (-3202.483) * [-3199.113] (-3202.855) (-3214.675) (-3200.246) -- 0:07:22 5000 -- (-3204.591) (-3198.751) [-3203.160] (-3201.186) * (-3205.860) [-3196.840] (-3214.009) (-3202.653) -- 0:06:38 Average standard deviation of split frequencies: 0.000000 5500 -- [-3198.590] (-3194.995) (-3196.857) (-3195.449) * (-3204.607) (-3201.356) (-3208.431) [-3197.135] -- 0:06:01 6000 -- (-3202.975) (-3195.231) [-3196.482] (-3201.273) * [-3202.374] (-3201.160) (-3204.320) (-3203.219) -- 0:05:31 6500 -- (-3197.498) (-3197.573) (-3202.218) [-3204.502] * (-3200.524) (-3199.165) [-3199.292] (-3216.058) -- 0:05:05 7000 -- (-3197.039) [-3198.709] (-3201.030) (-3212.258) * (-3199.213) [-3194.694] (-3194.530) (-3208.100) -- 0:04:43 7500 -- (-3197.806) (-3197.142) (-3202.547) [-3199.637] * [-3203.471] (-3196.310) (-3197.226) (-3207.600) -- 0:04:24 8000 -- (-3199.703) (-3208.389) (-3204.298) [-3202.590] * (-3197.079) (-3196.866) [-3193.950] (-3206.357) -- 0:04:08 8500 -- (-3199.650) (-3209.433) [-3201.456] (-3200.959) * (-3200.389) (-3199.561) (-3194.154) [-3206.285] -- 0:05:49 9000 -- (-3202.065) [-3206.464] (-3198.709) (-3201.973) * (-3195.283) (-3200.503) (-3198.237) [-3197.702] -- 0:05:30 9500 -- (-3197.813) [-3200.385] (-3200.017) (-3203.347) * (-3199.420) (-3198.983) (-3201.226) [-3200.439] -- 0:05:12 10000 -- (-3198.264) (-3204.208) [-3200.176] (-3203.646) * (-3201.451) (-3200.263) (-3202.499) [-3197.923] -- 0:04:57 Average standard deviation of split frequencies: 0.000000 10500 -- [-3194.711] (-3198.410) (-3201.545) (-3200.222) * (-3194.603) (-3198.250) (-3206.227) [-3200.643] -- 0:04:42 11000 -- (-3199.202) [-3203.152] (-3199.724) (-3196.940) * (-3200.357) (-3203.628) (-3203.374) [-3198.553] -- 0:04:29 11500 -- (-3202.529) (-3207.267) (-3202.083) [-3197.967] * (-3202.867) (-3199.973) [-3200.520] (-3202.625) -- 0:04:17 12000 -- (-3199.070) [-3198.289] (-3202.888) (-3196.103) * (-3198.484) (-3207.096) (-3207.762) [-3204.542] -- 0:04:07 12500 -- [-3196.205] (-3200.883) (-3198.815) (-3201.336) * (-3199.060) (-3200.985) [-3200.465] (-3202.017) -- 0:05:16 13000 -- (-3199.581) (-3195.199) (-3202.429) [-3200.641] * (-3199.284) (-3200.331) (-3197.817) [-3196.996] -- 0:05:03 13500 -- (-3200.840) [-3195.798] (-3202.217) (-3212.534) * [-3202.732] (-3200.982) (-3193.747) (-3198.934) -- 0:04:52 14000 -- (-3199.755) [-3200.192] (-3204.796) (-3202.911) * (-3203.783) (-3198.797) (-3197.906) [-3197.610] -- 0:04:41 14500 -- (-3208.473) (-3206.255) (-3205.002) [-3197.852] * [-3198.734] (-3197.332) (-3194.721) (-3201.330) -- 0:04:31 15000 -- (-3202.599) (-3204.689) (-3202.663) [-3197.285] * [-3199.961] (-3196.504) (-3205.012) (-3199.132) -- 0:04:22 Average standard deviation of split frequencies: 0.000000 15500 -- (-3203.460) (-3204.367) (-3202.420) [-3197.518] * (-3204.658) [-3199.370] (-3197.730) (-3198.589) -- 0:04:14 16000 -- (-3198.331) [-3205.223] (-3206.861) (-3193.200) * (-3207.247) [-3197.141] (-3196.753) (-3199.189) -- 0:04:06 16500 -- (-3200.599) [-3196.143] (-3199.688) (-3197.399) * (-3199.005) [-3199.110] (-3197.075) (-3208.031) -- 0:04:58 17000 -- (-3204.832) [-3196.644] (-3196.647) (-3194.446) * [-3202.688] (-3197.657) (-3197.045) (-3203.363) -- 0:04:49 17500 -- [-3196.381] (-3206.808) (-3203.518) (-3200.859) * (-3202.587) (-3200.295) (-3199.730) [-3199.001] -- 0:04:40 18000 -- (-3198.559) (-3205.904) [-3195.144] (-3201.529) * (-3199.515) (-3198.598) (-3208.986) [-3202.811] -- 0:04:32 18500 -- (-3203.507) [-3198.517] (-3201.107) (-3206.641) * (-3198.252) (-3194.581) [-3198.964] (-3197.897) -- 0:04:25 19000 -- (-3198.188) [-3198.719] (-3202.509) (-3197.944) * [-3198.062] (-3199.322) (-3196.201) (-3198.094) -- 0:04:18 19500 -- (-3204.883) (-3196.846) (-3202.515) [-3196.125] * [-3200.794] (-3198.297) (-3209.389) (-3198.385) -- 0:04:11 20000 -- (-3198.006) (-3194.429) [-3196.332] (-3197.294) * (-3202.138) [-3202.222] (-3205.495) (-3201.347) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 20500 -- [-3203.337] (-3202.417) (-3199.209) (-3200.344) * (-3212.770) (-3204.252) (-3201.759) [-3195.002] -- 0:04:46 21000 -- (-3206.192) [-3197.148] (-3195.043) (-3200.738) * (-3198.455) [-3195.966] (-3204.432) (-3203.337) -- 0:04:39 21500 -- (-3202.935) [-3196.580] (-3196.090) (-3200.440) * (-3199.443) [-3200.652] (-3205.410) (-3196.861) -- 0:04:33 22000 -- (-3199.519) (-3202.613) (-3199.671) [-3198.353] * [-3199.646] (-3198.305) (-3200.881) (-3206.913) -- 0:04:26 22500 -- (-3197.573) (-3201.604) (-3194.074) [-3199.840] * (-3197.869) (-3199.947) (-3201.806) [-3197.372] -- 0:04:20 23000 -- (-3203.470) (-3202.640) [-3200.995] (-3197.752) * (-3200.681) [-3199.827] (-3200.696) (-3203.272) -- 0:04:14 23500 -- (-3206.310) (-3200.474) (-3203.074) [-3193.685] * (-3202.766) (-3199.020) (-3203.143) [-3197.548] -- 0:04:09 24000 -- (-3203.419) [-3198.043] (-3202.308) (-3200.468) * (-3202.735) (-3195.909) (-3202.557) [-3192.368] -- 0:04:04 24500 -- (-3196.092) [-3200.530] (-3197.717) (-3205.761) * (-3206.947) (-3202.640) (-3199.404) [-3198.130] -- 0:04:38 25000 -- (-3202.183) (-3201.833) [-3197.342] (-3208.391) * [-3202.331] (-3203.370) (-3204.281) (-3205.570) -- 0:04:33 Average standard deviation of split frequencies: 0.000000 25500 -- (-3201.698) (-3203.702) [-3199.295] (-3198.910) * (-3203.614) (-3198.382) (-3202.557) [-3199.959] -- 0:04:27 26000 -- [-3199.591] (-3198.177) (-3202.101) (-3202.213) * (-3212.194) (-3201.506) (-3209.829) [-3199.471] -- 0:04:22 26500 -- (-3201.464) (-3198.539) [-3199.440] (-3203.727) * (-3201.302) (-3201.859) (-3199.763) [-3198.962] -- 0:04:17 27000 -- (-3205.576) (-3199.498) [-3198.740] (-3198.148) * [-3196.923] (-3194.795) (-3200.678) (-3202.759) -- 0:04:12 27500 -- (-3202.358) (-3205.698) (-3197.435) [-3197.592] * (-3202.303) (-3200.608) [-3199.228] (-3200.821) -- 0:04:07 28000 -- (-3198.391) (-3203.249) [-3198.633] (-3202.141) * (-3201.357) [-3199.837] (-3202.476) (-3206.135) -- 0:04:03 28500 -- (-3201.747) (-3209.200) [-3200.149] (-3203.087) * (-3200.410) (-3197.274) [-3199.077] (-3207.279) -- 0:04:32 29000 -- (-3208.323) (-3201.812) [-3199.805] (-3200.698) * (-3194.607) (-3204.415) [-3197.806] (-3206.821) -- 0:04:27 29500 -- (-3198.732) (-3196.233) (-3197.087) [-3195.538] * [-3199.085] (-3201.443) (-3205.378) (-3199.411) -- 0:04:23 30000 -- (-3200.716) [-3194.236] (-3198.806) (-3195.201) * (-3198.951) [-3199.233] (-3200.377) (-3199.681) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 30500 -- (-3209.646) [-3196.555] (-3194.073) (-3195.623) * [-3193.743] (-3197.239) (-3204.698) (-3204.858) -- 0:04:14 31000 -- (-3205.692) (-3198.283) [-3201.133] (-3197.247) * (-3200.813) (-3200.305) (-3202.083) [-3197.568] -- 0:04:10 31500 -- (-3201.033) [-3195.593] (-3196.859) (-3197.795) * (-3208.590) [-3199.523] (-3205.013) (-3197.287) -- 0:04:05 32000 -- (-3207.820) [-3201.188] (-3194.106) (-3198.153) * (-3208.169) [-3202.230] (-3201.474) (-3198.604) -- 0:04:02 32500 -- (-3203.254) [-3197.068] (-3202.629) (-3193.710) * (-3206.570) (-3196.449) [-3200.186] (-3201.095) -- 0:03:58 33000 -- (-3200.607) (-3204.638) [-3198.916] (-3196.120) * (-3200.611) [-3201.331] (-3196.114) (-3194.064) -- 0:04:23 33500 -- (-3205.737) [-3201.075] (-3200.595) (-3200.801) * (-3208.837) (-3198.274) (-3202.756) [-3197.422] -- 0:04:19 34000 -- (-3203.976) (-3202.933) [-3195.079] (-3201.542) * (-3202.125) [-3194.728] (-3202.933) (-3201.226) -- 0:04:15 34500 -- (-3200.771) (-3201.425) (-3205.683) [-3201.040] * (-3200.163) [-3199.055] (-3199.366) (-3198.411) -- 0:04:11 35000 -- (-3203.579) (-3198.778) (-3195.751) [-3198.942] * (-3198.803) (-3195.928) [-3198.983] (-3199.051) -- 0:04:08 Average standard deviation of split frequencies: 0.000000 35500 -- (-3200.463) (-3200.627) [-3197.903] (-3199.911) * (-3202.601) [-3195.640] (-3197.585) (-3195.022) -- 0:04:04 36000 -- (-3199.216) [-3195.020] (-3197.450) (-3199.677) * (-3197.938) (-3203.965) [-3207.877] (-3199.220) -- 0:04:01 36500 -- (-3198.572) (-3197.702) [-3200.086] (-3201.935) * [-3196.355] (-3200.991) (-3203.820) (-3196.783) -- 0:03:57 37000 -- (-3201.363) (-3200.822) [-3194.784] (-3199.218) * [-3196.006] (-3196.752) (-3198.100) (-3196.837) -- 0:04:20 37500 -- (-3206.385) [-3198.842] (-3200.484) (-3205.779) * (-3198.644) (-3198.734) (-3204.820) [-3198.126] -- 0:04:16 38000 -- (-3206.569) [-3198.361] (-3199.918) (-3203.680) * (-3205.041) (-3205.976) (-3200.663) [-3199.553] -- 0:04:13 38500 -- [-3205.241] (-3193.367) (-3202.414) (-3202.048) * (-3198.915) (-3202.564) (-3210.012) [-3199.091] -- 0:04:09 39000 -- (-3193.397) [-3195.848] (-3199.606) (-3204.390) * (-3200.124) (-3205.983) [-3199.506] (-3201.344) -- 0:04:06 39500 -- [-3193.723] (-3199.310) (-3197.754) (-3198.948) * [-3201.810] (-3204.220) (-3196.309) (-3200.133) -- 0:04:03 40000 -- (-3198.520) (-3203.575) (-3196.961) [-3197.818] * [-3196.125] (-3197.652) (-3197.051) (-3200.485) -- 0:04:00 Average standard deviation of split frequencies: 0.000000 40500 -- (-3199.116) (-3205.777) (-3200.958) [-3199.506] * [-3199.307] (-3200.678) (-3198.902) (-3199.291) -- 0:03:56 41000 -- [-3197.102] (-3199.456) (-3201.417) (-3202.707) * (-3205.720) (-3203.385) (-3193.332) [-3203.627] -- 0:04:17 41500 -- (-3196.966) (-3205.583) [-3203.634] (-3201.442) * (-3205.598) (-3204.180) [-3204.261] (-3203.151) -- 0:04:14 42000 -- (-3194.742) (-3212.253) (-3203.192) [-3204.066] * [-3198.696] (-3195.583) (-3199.669) (-3200.494) -- 0:04:10 42500 -- [-3196.595] (-3209.917) (-3199.364) (-3197.868) * [-3201.638] (-3202.660) (-3199.577) (-3210.011) -- 0:04:07 43000 -- [-3198.931] (-3209.394) (-3199.766) (-3194.609) * [-3206.842] (-3205.225) (-3201.108) (-3195.500) -- 0:04:04 43500 -- (-3197.306) (-3209.248) (-3200.680) [-3196.771] * [-3200.060] (-3203.462) (-3195.505) (-3203.483) -- 0:04:01 44000 -- (-3199.971) (-3197.391) (-3196.264) [-3195.508] * [-3197.317] (-3197.499) (-3198.484) (-3199.413) -- 0:03:59 44500 -- (-3202.880) [-3201.454] (-3196.473) (-3199.861) * (-3198.444) [-3197.851] (-3207.418) (-3197.806) -- 0:03:56 45000 -- (-3198.348) (-3203.834) [-3201.445] (-3200.028) * [-3195.263] (-3199.970) (-3199.066) (-3197.690) -- 0:03:53 Average standard deviation of split frequencies: 0.000000 45500 -- (-3196.398) (-3206.428) (-3202.030) [-3196.735] * (-3202.597) (-3204.027) [-3202.937] (-3212.726) -- 0:04:11 46000 -- (-3201.270) (-3199.912) (-3202.770) [-3198.943] * (-3202.239) [-3197.974] (-3203.408) (-3212.310) -- 0:04:08 46500 -- [-3201.264] (-3198.479) (-3205.490) (-3201.534) * (-3196.795) (-3195.892) [-3206.104] (-3210.677) -- 0:04:06 47000 -- (-3197.941) [-3196.355] (-3204.970) (-3201.865) * (-3196.612) [-3199.897] (-3201.279) (-3200.765) -- 0:04:03 47500 -- [-3198.739] (-3198.346) (-3199.401) (-3204.780) * (-3198.764) (-3199.863) [-3199.212] (-3203.021) -- 0:04:00 48000 -- (-3198.577) (-3199.434) [-3197.216] (-3199.593) * (-3202.566) (-3206.138) [-3196.972] (-3203.220) -- 0:03:58 48500 -- [-3201.174] (-3198.182) (-3198.645) (-3200.977) * [-3205.732] (-3211.529) (-3203.017) (-3204.641) -- 0:03:55 49000 -- [-3194.764] (-3199.033) (-3199.301) (-3202.242) * (-3200.776) (-3212.495) [-3204.389] (-3204.025) -- 0:03:52 49500 -- (-3196.119) [-3197.892] (-3197.778) (-3200.248) * (-3199.042) (-3208.171) [-3198.173] (-3202.562) -- 0:04:09 50000 -- (-3200.723) (-3202.166) [-3201.291] (-3204.330) * (-3199.204) [-3197.414] (-3197.509) (-3198.582) -- 0:04:06 Average standard deviation of split frequencies: 0.000000 50500 -- (-3203.206) (-3212.791) (-3205.069) [-3198.550] * [-3203.641] (-3197.068) (-3203.088) (-3204.185) -- 0:04:04 51000 -- (-3202.977) (-3198.844) [-3198.202] (-3196.662) * [-3201.488] (-3195.747) (-3204.566) (-3199.003) -- 0:04:01 51500 -- (-3198.468) [-3203.856] (-3196.949) (-3196.715) * (-3197.497) [-3201.857] (-3197.569) (-3200.837) -- 0:03:59 52000 -- (-3206.970) [-3202.681] (-3203.422) (-3201.533) * (-3202.472) (-3200.311) (-3205.462) [-3196.806] -- 0:03:57 52500 -- [-3199.878] (-3204.346) (-3201.481) (-3196.135) * [-3200.716] (-3197.849) (-3214.509) (-3200.894) -- 0:03:54 53000 -- [-3197.922] (-3205.619) (-3197.407) (-3197.229) * (-3207.308) (-3202.278) [-3200.064] (-3199.064) -- 0:03:52 53500 -- (-3199.114) [-3201.165] (-3199.328) (-3201.658) * [-3202.926] (-3207.128) (-3198.211) (-3195.768) -- 0:03:49 54000 -- (-3207.542) (-3199.773) (-3201.811) [-3194.454] * [-3202.659] (-3204.980) (-3199.812) (-3197.467) -- 0:04:05 54500 -- (-3201.008) (-3205.445) [-3202.830] (-3195.635) * (-3202.729) [-3203.277] (-3199.773) (-3201.150) -- 0:04:02 55000 -- (-3210.849) [-3204.014] (-3198.088) (-3199.289) * (-3202.071) (-3208.540) [-3201.728] (-3202.105) -- 0:04:00 Average standard deviation of split frequencies: 0.000000 55500 -- [-3200.583] (-3207.254) (-3203.146) (-3199.460) * [-3204.110] (-3199.884) (-3197.431) (-3205.459) -- 0:03:58 56000 -- (-3203.193) [-3198.500] (-3204.849) (-3198.670) * (-3196.178) (-3202.834) [-3196.489] (-3196.608) -- 0:03:56 56500 -- [-3196.947] (-3199.565) (-3198.082) (-3198.909) * [-3212.411] (-3202.295) (-3197.446) (-3199.043) -- 0:03:53 57000 -- (-3200.287) (-3198.839) (-3200.850) [-3201.822] * (-3205.281) (-3200.690) (-3198.475) [-3200.034] -- 0:03:51 57500 -- (-3199.007) (-3202.254) [-3201.437] (-3200.758) * (-3198.617) (-3202.405) [-3195.931] (-3198.776) -- 0:03:49 58000 -- (-3200.291) (-3194.393) (-3198.564) [-3200.069] * (-3206.308) (-3201.752) [-3198.322] (-3205.273) -- 0:04:03 58500 -- (-3205.916) (-3206.822) (-3207.320) [-3199.523] * (-3198.306) (-3199.485) (-3198.048) [-3201.307] -- 0:04:01 59000 -- (-3204.029) (-3209.595) (-3206.706) [-3199.067] * (-3202.838) (-3206.557) (-3195.583) [-3198.912] -- 0:03:59 59500 -- (-3206.832) [-3194.306] (-3199.425) (-3206.115) * (-3206.164) (-3203.197) [-3196.599] (-3201.021) -- 0:03:57 60000 -- (-3204.426) (-3202.257) [-3194.042] (-3195.532) * (-3202.582) (-3206.041) [-3197.006] (-3206.378) -- 0:03:55 Average standard deviation of split frequencies: 0.000000 60500 -- (-3199.908) (-3200.377) (-3199.275) [-3193.306] * (-3206.762) [-3200.046] (-3199.341) (-3196.620) -- 0:03:52 61000 -- (-3201.303) (-3199.385) [-3201.469] (-3200.859) * (-3197.085) (-3196.009) [-3197.325] (-3196.260) -- 0:03:50 61500 -- (-3204.129) (-3197.667) (-3195.987) [-3200.007] * (-3201.597) (-3202.262) (-3197.663) [-3196.932] -- 0:03:48 62000 -- [-3201.946] (-3199.219) (-3197.410) (-3195.891) * (-3202.710) [-3199.698] (-3199.229) (-3200.010) -- 0:04:02 62500 -- (-3202.107) [-3198.878] (-3199.905) (-3199.922) * (-3201.772) (-3206.745) (-3204.365) [-3195.791] -- 0:04:00 63000 -- (-3202.066) (-3196.207) [-3198.017] (-3206.742) * (-3202.243) (-3207.621) [-3198.925] (-3202.206) -- 0:03:57 63500 -- [-3195.425] (-3196.302) (-3199.468) (-3202.215) * (-3204.084) [-3200.783] (-3196.276) (-3203.922) -- 0:03:55 64000 -- [-3196.399] (-3202.825) (-3195.241) (-3201.432) * (-3200.792) (-3201.737) [-3203.913] (-3204.537) -- 0:03:54 64500 -- [-3196.784] (-3192.423) (-3198.705) (-3203.979) * (-3201.884) [-3201.051] (-3196.168) (-3200.579) -- 0:03:52 65000 -- (-3193.005) (-3198.295) [-3201.293] (-3205.053) * (-3199.458) [-3199.384] (-3201.301) (-3200.746) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 65500 -- (-3200.862) (-3202.275) (-3197.042) [-3205.794] * [-3207.791] (-3203.490) (-3199.009) (-3196.470) -- 0:03:48 66000 -- [-3195.519] (-3203.401) (-3203.359) (-3202.699) * (-3205.847) (-3207.211) [-3195.662] (-3201.679) -- 0:03:46 66500 -- (-3198.137) (-3197.270) [-3198.484] (-3202.913) * (-3208.840) [-3202.067] (-3195.616) (-3203.682) -- 0:03:58 67000 -- (-3202.384) [-3204.824] (-3199.912) (-3199.234) * (-3209.017) [-3204.600] (-3197.178) (-3196.369) -- 0:03:56 67500 -- (-3201.183) [-3201.245] (-3203.922) (-3201.998) * (-3203.515) (-3197.870) [-3192.938] (-3198.175) -- 0:03:54 68000 -- (-3206.214) [-3199.073] (-3198.202) (-3200.247) * (-3210.777) (-3198.272) (-3196.009) [-3201.070] -- 0:03:53 68500 -- (-3204.988) [-3203.689] (-3199.560) (-3197.056) * (-3208.988) (-3202.598) [-3197.672] (-3199.105) -- 0:03:51 69000 -- (-3204.851) (-3205.046) [-3197.005] (-3199.741) * (-3204.995) (-3200.931) (-3200.852) [-3206.746] -- 0:03:49 69500 -- [-3200.850] (-3200.262) (-3199.686) (-3198.681) * (-3202.279) (-3207.080) (-3199.213) [-3209.269] -- 0:03:47 70000 -- (-3203.704) (-3199.302) [-3200.848] (-3197.453) * (-3203.113) [-3198.041] (-3197.720) (-3202.229) -- 0:03:45 Average standard deviation of split frequencies: 0.000000 70500 -- (-3196.436) (-3203.385) [-3200.295] (-3203.724) * [-3197.538] (-3202.553) (-3198.992) (-3198.157) -- 0:03:57 71000 -- (-3202.176) [-3195.239] (-3199.000) (-3199.420) * (-3194.891) (-3205.513) [-3196.060] (-3205.764) -- 0:03:55 71500 -- (-3198.787) (-3199.604) (-3201.356) [-3204.125] * [-3201.073] (-3204.810) (-3198.362) (-3200.894) -- 0:03:53 72000 -- (-3202.761) [-3197.981] (-3204.851) (-3197.806) * (-3205.427) (-3205.158) (-3204.711) [-3200.814] -- 0:03:52 72500 -- [-3200.323] (-3194.832) (-3202.210) (-3207.615) * (-3204.731) (-3200.946) [-3194.662] (-3198.384) -- 0:03:50 73000 -- (-3198.371) (-3197.396) [-3200.014] (-3201.304) * (-3197.862) (-3207.359) (-3197.539) [-3200.824] -- 0:03:48 73500 -- (-3198.351) (-3199.014) (-3207.162) [-3195.326] * (-3198.609) (-3204.035) (-3204.898) [-3201.700] -- 0:03:46 74000 -- (-3201.197) (-3200.689) [-3203.881] (-3196.423) * [-3198.574] (-3203.344) (-3198.498) (-3206.084) -- 0:03:45 74500 -- [-3194.728] (-3198.990) (-3202.426) (-3203.586) * (-3196.306) (-3196.772) (-3203.472) [-3194.530] -- 0:03:56 75000 -- [-3197.963] (-3200.712) (-3207.755) (-3194.313) * (-3204.099) [-3207.457] (-3196.117) (-3201.233) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 75500 -- (-3203.920) (-3202.747) [-3200.120] (-3197.973) * (-3199.840) [-3200.717] (-3200.698) (-3197.161) -- 0:03:52 76000 -- [-3203.353] (-3197.064) (-3205.985) (-3194.241) * (-3195.411) (-3200.174) (-3210.178) [-3201.327] -- 0:03:51 76500 -- (-3199.674) [-3201.691] (-3203.263) (-3196.067) * (-3196.018) [-3204.848] (-3196.651) (-3209.896) -- 0:03:49 77000 -- (-3202.544) (-3210.066) (-3203.306) [-3196.930] * (-3197.119) (-3201.804) [-3194.398] (-3199.741) -- 0:03:47 77500 -- [-3195.008] (-3203.050) (-3199.054) (-3195.663) * (-3198.642) (-3203.666) [-3197.754] (-3202.696) -- 0:03:46 78000 -- (-3203.543) (-3206.519) (-3202.389) [-3199.479] * (-3197.352) (-3204.383) (-3196.503) [-3196.300] -- 0:03:44 78500 -- [-3203.593] (-3205.397) (-3203.046) (-3201.062) * (-3200.482) (-3198.980) (-3213.708) [-3204.168] -- 0:03:43 79000 -- (-3206.262) (-3208.379) [-3198.985] (-3202.367) * [-3200.277] (-3203.414) (-3196.981) (-3199.679) -- 0:03:53 79500 -- (-3196.260) [-3204.999] (-3201.242) (-3200.775) * (-3206.726) (-3199.416) [-3199.974] (-3197.978) -- 0:03:51 80000 -- (-3200.014) (-3205.420) [-3199.887] (-3204.164) * (-3197.750) [-3197.729] (-3197.097) (-3198.894) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 80500 -- (-3196.060) [-3202.605] (-3208.703) (-3206.322) * (-3195.747) (-3201.711) (-3202.360) [-3202.558] -- 0:03:48 81000 -- (-3201.293) (-3202.761) (-3200.379) [-3197.241] * (-3196.678) [-3205.167] (-3197.406) (-3198.375) -- 0:03:46 81500 -- (-3198.792) [-3197.100] (-3200.343) (-3198.659) * [-3203.593] (-3199.750) (-3200.965) (-3199.639) -- 0:03:45 82000 -- [-3203.783] (-3196.356) (-3205.676) (-3210.548) * [-3202.819] (-3203.044) (-3202.884) (-3203.933) -- 0:03:43 82500 -- (-3200.916) [-3204.792] (-3200.632) (-3199.147) * [-3206.586] (-3198.967) (-3197.323) (-3199.681) -- 0:03:42 83000 -- (-3199.813) (-3201.524) [-3200.614] (-3206.608) * (-3203.776) (-3205.889) (-3196.090) [-3202.436] -- 0:03:52 83500 -- [-3195.186] (-3201.688) (-3203.064) (-3200.241) * (-3200.941) (-3211.377) (-3200.104) [-3197.676] -- 0:03:50 84000 -- (-3197.319) [-3198.543] (-3198.200) (-3201.955) * (-3198.587) (-3197.068) (-3203.562) [-3193.471] -- 0:03:49 84500 -- [-3204.423] (-3198.140) (-3202.401) (-3209.788) * (-3196.693) (-3195.951) [-3198.207] (-3201.716) -- 0:03:47 85000 -- [-3201.461] (-3196.668) (-3196.105) (-3215.665) * (-3199.056) (-3198.861) [-3192.398] (-3200.141) -- 0:03:46 Average standard deviation of split frequencies: 0.000000 85500 -- (-3198.461) (-3200.287) [-3199.911] (-3210.668) * [-3197.705] (-3195.362) (-3196.642) (-3211.194) -- 0:03:44 86000 -- (-3204.972) [-3196.510] (-3199.779) (-3199.924) * [-3202.353] (-3197.221) (-3196.219) (-3199.745) -- 0:03:43 86500 -- (-3202.899) (-3201.052) [-3199.258] (-3208.909) * (-3199.578) (-3196.089) (-3203.531) [-3198.107] -- 0:03:41 87000 -- (-3199.424) [-3197.887] (-3206.402) (-3204.168) * (-3199.299) [-3199.678] (-3196.604) (-3199.810) -- 0:03:50 87500 -- (-3199.536) (-3199.405) [-3197.608] (-3203.715) * [-3197.879] (-3198.508) (-3201.784) (-3204.655) -- 0:03:49 88000 -- [-3202.707] (-3198.210) (-3200.509) (-3195.413) * (-3205.697) [-3200.910] (-3204.030) (-3203.680) -- 0:03:48 88500 -- (-3198.709) (-3201.309) (-3200.419) [-3197.955] * [-3202.134] (-3200.368) (-3203.738) (-3197.296) -- 0:03:46 89000 -- (-3204.042) (-3198.019) [-3203.995] (-3199.491) * (-3196.917) [-3203.271] (-3198.289) (-3204.605) -- 0:03:45 89500 -- (-3201.366) [-3195.363] (-3197.383) (-3199.613) * [-3200.520] (-3198.468) (-3200.223) (-3199.878) -- 0:03:43 90000 -- [-3206.533] (-3200.080) (-3196.155) (-3198.744) * (-3196.742) (-3194.320) (-3203.358) [-3199.849] -- 0:03:42 Average standard deviation of split frequencies: 0.000000 90500 -- [-3197.033] (-3206.491) (-3197.120) (-3198.693) * [-3199.530] (-3195.718) (-3206.556) (-3200.583) -- 0:03:41 91000 -- (-3198.940) (-3206.659) (-3202.052) [-3196.165] * (-3196.999) (-3197.030) (-3214.221) [-3197.302] -- 0:03:39 91500 -- (-3200.932) [-3196.711] (-3195.690) (-3201.540) * (-3201.079) (-3195.975) [-3207.350] (-3202.204) -- 0:03:48 92000 -- (-3200.776) (-3198.206) (-3195.549) [-3201.668] * [-3201.118] (-3197.129) (-3202.296) (-3201.509) -- 0:03:47 92500 -- (-3201.329) [-3194.786] (-3216.395) (-3198.629) * (-3207.591) (-3199.668) (-3201.045) [-3194.411] -- 0:03:45 93000 -- (-3203.009) [-3206.816] (-3199.910) (-3196.902) * [-3200.963] (-3198.485) (-3205.069) (-3209.920) -- 0:03:44 93500 -- (-3200.429) [-3196.103] (-3201.179) (-3197.227) * (-3202.272) (-3200.688) (-3201.624) [-3203.883] -- 0:03:42 94000 -- (-3207.534) [-3204.718] (-3198.225) (-3196.910) * [-3197.143] (-3198.642) (-3205.652) (-3211.468) -- 0:03:41 94500 -- (-3209.686) (-3197.636) (-3200.276) [-3196.067] * (-3202.209) [-3200.677] (-3197.763) (-3201.104) -- 0:03:40 95000 -- (-3212.224) [-3202.904] (-3207.843) (-3212.950) * (-3198.995) (-3196.326) (-3203.632) [-3201.529] -- 0:03:39 Average standard deviation of split frequencies: 0.000000 95500 -- (-3205.192) (-3201.607) [-3201.330] (-3203.805) * (-3203.687) (-3195.901) (-3198.020) [-3196.782] -- 0:03:47 96000 -- [-3202.844] (-3198.800) (-3197.483) (-3203.870) * (-3199.992) (-3203.037) (-3206.447) [-3195.411] -- 0:03:46 96500 -- (-3206.838) (-3207.582) (-3193.782) [-3201.877] * (-3199.233) (-3208.691) (-3204.080) [-3196.848] -- 0:03:44 97000 -- (-3202.469) (-3204.924) (-3201.931) [-3202.190] * (-3200.494) (-3202.066) [-3198.720] (-3202.934) -- 0:03:43 97500 -- (-3198.062) (-3212.293) [-3199.594] (-3195.374) * (-3201.073) (-3200.368) [-3202.692] (-3199.503) -- 0:03:42 98000 -- [-3201.770] (-3200.038) (-3202.951) (-3197.768) * (-3201.581) (-3200.200) (-3200.040) [-3198.212] -- 0:03:40 98500 -- (-3199.239) (-3197.351) [-3198.273] (-3201.927) * [-3201.391] (-3200.123) (-3196.894) (-3207.888) -- 0:03:39 99000 -- (-3197.484) (-3194.299) (-3200.358) [-3199.824] * (-3196.213) (-3202.365) [-3200.664] (-3198.313) -- 0:03:38 99500 -- (-3200.299) (-3203.172) (-3200.809) [-3195.793] * (-3201.482) (-3202.829) [-3199.260] (-3200.189) -- 0:03:46 100000 -- (-3208.321) (-3201.002) [-3196.030] (-3199.124) * (-3204.962) (-3198.767) (-3201.082) [-3202.740] -- 0:03:45 Average standard deviation of split frequencies: 0.000000 100500 -- (-3201.888) [-3200.552] (-3195.510) (-3196.536) * (-3206.006) (-3199.875) (-3208.634) [-3201.754] -- 0:03:43 101000 -- (-3207.697) (-3200.244) (-3199.489) [-3203.660] * (-3203.074) (-3202.352) [-3198.326] (-3199.039) -- 0:03:42 101500 -- [-3202.485] (-3196.620) (-3196.359) (-3203.441) * (-3207.936) (-3202.927) (-3199.247) [-3202.078] -- 0:03:41 102000 -- [-3200.500] (-3198.740) (-3208.856) (-3202.721) * (-3205.951) (-3205.821) (-3203.258) [-3201.835] -- 0:03:40 102500 -- (-3203.593) [-3197.825] (-3196.290) (-3200.193) * (-3204.670) [-3198.797] (-3201.033) (-3202.588) -- 0:03:38 103000 -- (-3202.602) (-3198.239) (-3209.401) [-3202.250] * (-3199.397) (-3200.423) (-3196.599) [-3207.916] -- 0:03:37 103500 -- [-3198.475] (-3201.115) (-3200.608) (-3195.238) * [-3199.496] (-3204.124) (-3200.329) (-3200.505) -- 0:03:36 104000 -- (-3199.071) [-3194.589] (-3203.665) (-3202.729) * (-3197.514) [-3206.505] (-3202.307) (-3207.740) -- 0:03:44 104500 -- (-3205.189) [-3195.908] (-3203.440) (-3204.923) * (-3199.914) (-3200.216) [-3198.008] (-3204.349) -- 0:03:42 105000 -- (-3204.074) [-3199.960] (-3202.131) (-3201.569) * (-3206.542) (-3200.584) [-3192.921] (-3202.692) -- 0:03:41 Average standard deviation of split frequencies: 0.000000 105500 -- [-3196.999] (-3198.737) (-3201.516) (-3213.845) * (-3203.060) (-3207.084) [-3195.367] (-3205.661) -- 0:03:40 106000 -- [-3198.726] (-3200.103) (-3202.959) (-3200.823) * (-3197.944) (-3202.274) [-3197.062] (-3197.614) -- 0:03:39 106500 -- (-3203.685) (-3204.884) [-3198.806] (-3203.144) * (-3203.330) (-3201.770) (-3198.683) [-3194.385] -- 0:03:38 107000 -- [-3201.396] (-3204.044) (-3204.178) (-3196.853) * (-3201.385) (-3208.684) (-3199.233) [-3196.404] -- 0:03:36 107500 -- (-3210.470) [-3193.775] (-3202.262) (-3192.674) * (-3197.274) [-3196.720] (-3201.031) (-3201.321) -- 0:03:35 108000 -- [-3201.547] (-3199.993) (-3203.862) (-3196.821) * (-3200.715) (-3202.059) [-3200.631] (-3203.981) -- 0:03:43 108500 -- (-3199.952) (-3205.770) (-3206.632) [-3197.494] * (-3206.774) (-3200.063) (-3205.091) [-3194.186] -- 0:03:41 109000 -- [-3201.085] (-3201.415) (-3203.034) (-3202.794) * (-3197.821) (-3204.194) [-3202.407] (-3198.918) -- 0:03:40 109500 -- [-3199.416] (-3211.210) (-3201.091) (-3209.404) * [-3193.984] (-3200.491) (-3199.556) (-3195.588) -- 0:03:39 110000 -- (-3205.198) [-3199.198] (-3197.663) (-3196.867) * [-3196.882] (-3200.974) (-3202.754) (-3200.273) -- 0:03:38 Average standard deviation of split frequencies: 0.000000 110500 -- (-3199.908) (-3205.676) [-3201.629] (-3198.782) * [-3196.006] (-3201.248) (-3196.777) (-3200.596) -- 0:03:37 111000 -- [-3194.540] (-3205.362) (-3195.269) (-3197.240) * (-3202.674) (-3199.925) (-3199.613) [-3205.908] -- 0:03:36 111500 -- (-3195.342) (-3202.051) (-3196.982) [-3193.634] * (-3198.223) (-3198.926) [-3196.537] (-3207.229) -- 0:03:35 112000 -- (-3199.978) (-3200.085) [-3203.369] (-3202.593) * (-3201.671) (-3202.619) (-3196.994) [-3200.538] -- 0:03:42 112500 -- (-3202.508) (-3201.783) (-3200.356) [-3197.336] * (-3199.754) [-3199.187] (-3201.042) (-3198.145) -- 0:03:40 113000 -- (-3203.574) [-3201.941] (-3204.711) (-3197.947) * (-3196.813) (-3202.057) [-3201.209] (-3201.101) -- 0:03:39 113500 -- (-3197.799) (-3209.131) [-3201.019] (-3202.124) * [-3200.603] (-3203.304) (-3203.620) (-3197.567) -- 0:03:38 114000 -- (-3201.146) (-3202.382) [-3202.422] (-3200.837) * (-3201.353) (-3200.823) [-3200.333] (-3194.697) -- 0:03:37 114500 -- [-3200.146] (-3205.360) (-3199.332) (-3205.713) * (-3197.600) (-3200.675) [-3193.547] (-3200.974) -- 0:03:36 115000 -- (-3202.928) (-3202.599) (-3203.942) [-3200.740] * [-3199.124] (-3197.581) (-3196.625) (-3198.949) -- 0:03:35 Average standard deviation of split frequencies: 0.000000 115500 -- (-3194.395) (-3201.157) (-3199.643) [-3200.251] * (-3202.342) (-3202.516) (-3203.781) [-3200.849] -- 0:03:34 116000 -- (-3197.782) (-3209.629) [-3204.072] (-3199.821) * (-3200.257) [-3197.721] (-3203.588) (-3211.101) -- 0:03:33 116500 -- (-3207.518) [-3202.856] (-3202.042) (-3201.683) * [-3198.578] (-3207.717) (-3197.904) (-3219.860) -- 0:03:39 117000 -- (-3201.086) (-3197.822) [-3197.881] (-3209.283) * [-3203.398] (-3198.385) (-3199.947) (-3203.779) -- 0:03:38 117500 -- (-3211.859) (-3196.779) [-3202.238] (-3210.052) * (-3203.322) [-3202.762] (-3197.733) (-3208.984) -- 0:03:37 118000 -- (-3203.547) (-3195.781) (-3201.829) [-3205.390] * (-3203.679) (-3201.743) [-3195.499] (-3206.240) -- 0:03:36 118500 -- (-3200.067) [-3202.736] (-3202.502) (-3202.066) * [-3202.993] (-3196.550) (-3199.457) (-3200.656) -- 0:03:35 119000 -- (-3204.689) [-3199.526] (-3204.115) (-3206.022) * (-3197.550) (-3198.619) [-3195.362] (-3195.737) -- 0:03:34 119500 -- (-3205.128) [-3195.619] (-3206.704) (-3196.814) * (-3198.287) (-3205.286) (-3201.213) [-3198.901] -- 0:03:33 120000 -- (-3202.975) (-3197.477) (-3202.236) [-3199.702] * (-3201.065) [-3196.834] (-3203.354) (-3202.371) -- 0:03:32 Average standard deviation of split frequencies: 0.000000 120500 -- (-3204.013) (-3203.056) (-3199.904) [-3196.001] * [-3200.994] (-3201.305) (-3194.893) (-3202.001) -- 0:03:38 121000 -- [-3198.020] (-3200.857) (-3203.960) (-3199.845) * (-3200.864) (-3205.561) [-3197.773] (-3200.998) -- 0:03:37 121500 -- (-3197.329) (-3196.764) (-3195.313) [-3197.516] * (-3201.150) (-3200.367) [-3198.791] (-3202.894) -- 0:03:36 122000 -- [-3198.888] (-3195.862) (-3197.540) (-3199.348) * [-3197.093] (-3200.488) (-3201.852) (-3202.104) -- 0:03:35 122500 -- (-3202.073) [-3198.502] (-3197.821) (-3199.370) * (-3199.838) (-3198.316) [-3202.250] (-3196.761) -- 0:03:34 123000 -- (-3199.978) [-3201.080] (-3201.765) (-3201.163) * (-3205.460) (-3199.123) [-3198.010] (-3194.856) -- 0:03:33 123500 -- (-3193.446) [-3199.477] (-3201.246) (-3200.046) * [-3208.135] (-3197.317) (-3199.251) (-3195.977) -- 0:03:32 124000 -- (-3195.273) (-3202.440) [-3196.840] (-3196.915) * (-3199.285) (-3196.611) [-3202.091] (-3203.202) -- 0:03:31 124500 -- (-3200.291) [-3198.468] (-3198.033) (-3205.877) * (-3198.193) (-3196.101) [-3194.225] (-3196.477) -- 0:03:37 125000 -- (-3206.239) (-3201.143) [-3197.114] (-3203.448) * [-3198.230] (-3197.365) (-3201.467) (-3200.790) -- 0:03:37 Average standard deviation of split frequencies: 0.000000 125500 -- (-3200.680) [-3201.049] (-3201.899) (-3201.853) * [-3199.312] (-3202.386) (-3203.426) (-3195.077) -- 0:03:36 126000 -- (-3200.563) [-3200.539] (-3196.768) (-3208.671) * [-3207.325] (-3199.797) (-3199.875) (-3200.557) -- 0:03:35 126500 -- (-3197.963) (-3204.348) (-3195.094) [-3203.806] * [-3203.943] (-3204.223) (-3197.159) (-3200.485) -- 0:03:34 127000 -- [-3201.175] (-3200.814) (-3200.001) (-3201.374) * (-3198.826) [-3202.078] (-3200.205) (-3200.563) -- 0:03:33 127500 -- (-3195.377) (-3200.643) (-3199.281) [-3196.530] * [-3198.236] (-3196.845) (-3196.002) (-3200.405) -- 0:03:32 128000 -- (-3198.022) [-3200.424] (-3196.904) (-3199.021) * (-3197.078) (-3204.444) (-3201.125) [-3196.973] -- 0:03:31 128500 -- (-3202.373) (-3202.618) (-3196.284) [-3200.067] * (-3203.100) (-3203.059) [-3197.332] (-3205.303) -- 0:03:37 129000 -- (-3208.488) (-3196.719) [-3193.757] (-3202.814) * [-3196.359] (-3204.247) (-3201.062) (-3200.144) -- 0:03:36 129500 -- (-3205.479) (-3198.873) [-3197.545] (-3202.620) * (-3204.506) (-3201.248) [-3205.496] (-3200.350) -- 0:03:35 130000 -- (-3197.027) [-3198.148] (-3211.251) (-3198.979) * [-3199.278] (-3204.799) (-3207.139) (-3195.494) -- 0:03:34 Average standard deviation of split frequencies: 0.000000 130500 -- [-3204.273] (-3196.276) (-3197.636) (-3196.638) * [-3195.603] (-3204.615) (-3203.354) (-3194.594) -- 0:03:33 131000 -- (-3203.862) (-3201.233) [-3203.428] (-3208.929) * (-3200.855) (-3204.630) [-3197.642] (-3200.344) -- 0:03:32 131500 -- (-3193.996) [-3208.697] (-3205.942) (-3199.641) * (-3198.252) [-3200.016] (-3207.673) (-3199.190) -- 0:03:31 132000 -- [-3195.931] (-3196.138) (-3204.772) (-3208.355) * (-3195.782) (-3203.036) [-3199.071] (-3199.823) -- 0:03:30 132500 -- [-3193.584] (-3195.662) (-3202.908) (-3200.770) * (-3196.456) (-3198.489) (-3202.632) [-3198.120] -- 0:03:29 133000 -- (-3193.884) (-3197.049) (-3209.861) [-3198.272] * [-3200.450] (-3196.958) (-3208.498) (-3195.177) -- 0:03:35 133500 -- (-3200.904) [-3199.909] (-3199.828) (-3195.313) * (-3194.035) [-3194.705] (-3204.685) (-3199.586) -- 0:03:34 134000 -- (-3206.767) (-3203.472) [-3195.294] (-3198.232) * [-3191.409] (-3204.446) (-3209.414) (-3201.319) -- 0:03:33 134500 -- [-3198.944] (-3204.734) (-3195.380) (-3197.289) * (-3198.149) (-3205.648) (-3215.833) [-3200.152] -- 0:03:32 135000 -- (-3195.934) (-3204.045) (-3201.199) [-3193.548] * (-3200.097) (-3206.942) (-3198.053) [-3196.663] -- 0:03:31 Average standard deviation of split frequencies: 0.000000 135500 -- (-3200.314) (-3204.970) (-3201.406) [-3200.108] * [-3198.016] (-3202.699) (-3196.972) (-3198.438) -- 0:03:30 136000 -- (-3198.813) [-3200.252] (-3201.463) (-3204.693) * [-3196.214] (-3200.610) (-3201.549) (-3200.393) -- 0:03:29 136500 -- (-3202.207) (-3196.660) (-3203.220) [-3195.647] * [-3197.163] (-3200.138) (-3203.224) (-3198.611) -- 0:03:28 137000 -- (-3203.479) (-3203.818) [-3196.716] (-3193.589) * (-3202.454) [-3197.279] (-3199.683) (-3196.071) -- 0:03:34 137500 -- (-3210.193) (-3202.051) (-3200.964) [-3197.535] * [-3194.741] (-3200.933) (-3204.418) (-3200.313) -- 0:03:33 138000 -- (-3207.551) (-3196.629) (-3195.816) [-3193.891] * (-3196.562) [-3199.686] (-3209.722) (-3196.020) -- 0:03:32 138500 -- (-3215.512) (-3200.729) (-3200.587) [-3199.346] * (-3195.704) (-3205.110) [-3203.777] (-3196.533) -- 0:03:31 139000 -- (-3203.349) (-3210.091) (-3202.075) [-3199.524] * (-3199.278) [-3200.279] (-3204.606) (-3198.156) -- 0:03:30 139500 -- (-3199.232) [-3201.856] (-3207.497) (-3195.978) * (-3198.481) (-3196.909) (-3200.840) [-3201.753] -- 0:03:29 140000 -- (-3201.316) (-3198.929) [-3202.338] (-3201.013) * (-3197.005) [-3198.032] (-3204.798) (-3199.890) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 140500 -- (-3200.265) [-3199.994] (-3205.041) (-3196.835) * (-3198.276) (-3197.781) [-3202.258] (-3197.893) -- 0:03:27 141000 -- (-3202.191) [-3197.603] (-3206.437) (-3196.431) * (-3197.419) [-3200.465] (-3204.514) (-3205.627) -- 0:03:33 141500 -- [-3201.911] (-3201.723) (-3208.203) (-3200.319) * (-3200.163) (-3196.823) (-3203.050) [-3205.264] -- 0:03:32 142000 -- (-3196.913) [-3206.449] (-3198.643) (-3201.974) * (-3197.064) (-3199.009) (-3200.376) [-3196.666] -- 0:03:31 142500 -- [-3195.423] (-3203.109) (-3195.203) (-3197.994) * (-3201.460) (-3199.766) [-3204.557] (-3199.289) -- 0:03:30 143000 -- (-3199.546) (-3193.964) (-3194.660) [-3199.067] * (-3203.668) (-3202.978) [-3195.347] (-3196.862) -- 0:03:29 143500 -- (-3198.355) (-3205.019) (-3196.802) [-3196.715] * (-3197.522) [-3199.716] (-3196.485) (-3200.245) -- 0:03:28 144000 -- (-3200.008) (-3200.390) (-3199.487) [-3199.869] * [-3195.076] (-3202.528) (-3197.601) (-3207.928) -- 0:03:28 144500 -- (-3197.618) (-3202.144) (-3200.894) [-3196.405] * (-3202.650) [-3201.196] (-3199.251) (-3204.393) -- 0:03:27 145000 -- (-3207.486) (-3198.308) (-3208.176) [-3205.746] * (-3202.100) [-3205.114] (-3195.719) (-3198.144) -- 0:03:26 Average standard deviation of split frequencies: 0.000000 145500 -- (-3201.772) (-3197.906) (-3205.881) [-3197.661] * (-3202.222) (-3208.062) (-3194.725) [-3205.297] -- 0:03:31 146000 -- (-3197.405) (-3196.013) (-3205.491) [-3206.161] * [-3197.105] (-3200.388) (-3201.826) (-3198.468) -- 0:03:30 146500 -- (-3200.238) [-3199.397] (-3201.874) (-3200.165) * (-3192.833) (-3202.651) [-3198.889] (-3201.345) -- 0:03:29 147000 -- (-3194.114) (-3199.319) (-3195.296) [-3203.075] * (-3199.039) [-3198.065] (-3207.833) (-3200.024) -- 0:03:28 147500 -- (-3201.320) [-3196.253] (-3203.886) (-3202.929) * [-3196.033] (-3196.565) (-3202.043) (-3197.167) -- 0:03:28 148000 -- (-3196.306) (-3199.867) [-3198.250] (-3196.837) * [-3201.606] (-3204.640) (-3197.024) (-3198.894) -- 0:03:27 148500 -- [-3200.065] (-3201.741) (-3203.484) (-3201.510) * (-3199.780) (-3195.954) [-3197.547] (-3203.571) -- 0:03:26 149000 -- (-3208.316) (-3197.973) [-3197.432] (-3194.470) * [-3198.478] (-3197.433) (-3203.116) (-3197.659) -- 0:03:25 149500 -- (-3206.465) [-3196.734] (-3199.644) (-3203.126) * (-3202.548) [-3201.508] (-3204.110) (-3198.991) -- 0:03:30 150000 -- [-3197.913] (-3197.398) (-3207.507) (-3197.697) * [-3203.366] (-3202.420) (-3199.362) (-3199.885) -- 0:03:29 Average standard deviation of split frequencies: 0.000000 150500 -- [-3198.495] (-3195.819) (-3200.135) (-3208.736) * [-3199.684] (-3202.432) (-3204.548) (-3207.536) -- 0:03:28 151000 -- (-3201.041) [-3200.078] (-3206.729) (-3199.294) * (-3201.336) (-3201.966) (-3208.459) [-3199.291] -- 0:03:28 151500 -- [-3196.763] (-3204.666) (-3200.224) (-3199.123) * (-3199.427) (-3202.967) [-3200.258] (-3203.358) -- 0:03:27 152000 -- (-3199.517) [-3201.594] (-3197.471) (-3200.334) * (-3197.194) (-3198.392) (-3196.823) [-3199.510] -- 0:03:26 152500 -- (-3199.710) (-3206.442) [-3201.538] (-3204.914) * (-3201.677) (-3202.732) [-3200.517] (-3207.278) -- 0:03:25 153000 -- (-3197.681) (-3199.126) (-3199.735) [-3199.882] * [-3198.005] (-3204.635) (-3208.159) (-3202.004) -- 0:03:24 153500 -- (-3202.840) (-3195.383) [-3193.406] (-3216.178) * [-3197.645] (-3197.786) (-3205.805) (-3201.571) -- 0:03:29 154000 -- (-3210.544) [-3199.131] (-3210.566) (-3203.663) * (-3201.957) (-3203.579) (-3198.525) [-3196.987] -- 0:03:28 154500 -- (-3201.682) (-3201.638) [-3197.745] (-3198.322) * (-3200.409) (-3198.617) (-3208.446) [-3200.780] -- 0:03:27 155000 -- [-3200.062] (-3199.030) (-3195.508) (-3197.302) * (-3196.098) (-3197.489) (-3202.424) [-3203.200] -- 0:03:27 Average standard deviation of split frequencies: 0.000000 155500 -- (-3198.210) [-3196.735] (-3199.550) (-3197.669) * (-3201.454) (-3205.310) (-3203.058) [-3202.042] -- 0:03:26 156000 -- (-3205.651) (-3208.568) [-3198.968] (-3207.296) * (-3206.512) (-3202.242) (-3202.038) [-3203.707] -- 0:03:25 156500 -- (-3199.818) (-3200.468) [-3200.365] (-3199.330) * (-3202.687) (-3202.357) (-3206.052) [-3196.324] -- 0:03:24 157000 -- [-3197.816] (-3199.322) (-3204.272) (-3195.411) * (-3209.732) (-3195.162) [-3198.601] (-3207.312) -- 0:03:24 157500 -- (-3199.986) (-3197.297) (-3202.561) [-3194.468] * (-3204.832) (-3195.153) [-3201.860] (-3205.875) -- 0:03:28 158000 -- (-3204.698) [-3207.121] (-3206.001) (-3200.815) * (-3198.007) [-3200.328] (-3200.779) (-3194.745) -- 0:03:27 158500 -- (-3203.638) [-3201.402] (-3195.932) (-3196.302) * (-3195.510) [-3193.465] (-3198.218) (-3194.285) -- 0:03:27 159000 -- (-3199.207) (-3202.616) (-3202.868) [-3194.939] * (-3199.316) (-3197.344) [-3194.881] (-3203.541) -- 0:03:26 159500 -- (-3198.056) [-3196.459] (-3197.245) (-3194.895) * (-3197.920) (-3200.917) [-3196.702] (-3206.837) -- 0:03:25 160000 -- (-3196.174) (-3203.305) [-3195.756] (-3197.477) * [-3198.991] (-3202.260) (-3201.650) (-3202.868) -- 0:03:24 Average standard deviation of split frequencies: 0.000000 160500 -- (-3199.824) [-3197.674] (-3195.653) (-3194.815) * (-3200.285) [-3205.388] (-3196.621) (-3210.992) -- 0:03:23 161000 -- (-3206.027) [-3194.643] (-3202.045) (-3202.361) * (-3202.379) (-3202.204) [-3199.895] (-3206.087) -- 0:03:23 161500 -- (-3203.109) (-3199.359) (-3205.908) [-3197.259] * (-3199.138) [-3202.794] (-3199.504) (-3201.942) -- 0:03:22 162000 -- [-3196.046] (-3197.979) (-3199.915) (-3199.107) * (-3201.448) [-3195.534] (-3202.766) (-3202.539) -- 0:03:26 162500 -- (-3199.428) [-3198.365] (-3194.104) (-3200.093) * (-3205.174) (-3200.735) (-3196.743) [-3198.380] -- 0:03:26 163000 -- [-3195.070] (-3201.954) (-3199.870) (-3203.581) * (-3198.995) [-3197.288] (-3195.599) (-3194.968) -- 0:03:25 163500 -- (-3198.348) (-3205.592) [-3196.131] (-3198.753) * (-3202.171) (-3199.015) (-3197.881) [-3196.916] -- 0:03:24 164000 -- (-3200.885) (-3205.080) [-3197.248] (-3202.027) * (-3202.819) [-3201.639] (-3202.078) (-3195.013) -- 0:03:23 164500 -- (-3197.254) (-3207.693) [-3196.483] (-3206.335) * [-3197.741] (-3203.206) (-3200.459) (-3202.332) -- 0:03:23 165000 -- (-3196.290) [-3205.938] (-3195.917) (-3210.200) * [-3197.569] (-3198.538) (-3198.965) (-3200.065) -- 0:03:22 Average standard deviation of split frequencies: 0.000000 165500 -- (-3201.725) (-3201.452) [-3197.586] (-3200.384) * [-3199.519] (-3202.750) (-3203.289) (-3196.385) -- 0:03:21 166000 -- (-3195.835) (-3207.628) (-3199.253) [-3204.488] * (-3196.914) (-3206.167) [-3197.023] (-3196.072) -- 0:03:25 166500 -- (-3198.313) (-3200.781) [-3200.281] (-3196.459) * (-3197.750) [-3198.060] (-3200.798) (-3197.659) -- 0:03:25 167000 -- (-3204.752) (-3202.000) [-3196.036] (-3198.246) * (-3197.386) (-3200.027) (-3198.305) [-3198.661] -- 0:03:24 167500 -- (-3196.214) (-3205.482) [-3196.992] (-3202.681) * [-3197.824] (-3199.492) (-3199.474) (-3202.510) -- 0:03:23 168000 -- [-3197.948] (-3208.885) (-3204.582) (-3199.459) * (-3200.150) [-3197.448] (-3204.175) (-3204.759) -- 0:03:23 168500 -- (-3201.770) (-3205.183) (-3203.222) [-3197.960] * (-3201.609) (-3205.117) [-3204.298] (-3196.763) -- 0:03:22 169000 -- [-3195.909] (-3202.473) (-3201.602) (-3203.620) * (-3206.688) (-3198.223) [-3197.999] (-3198.968) -- 0:03:21 169500 -- (-3198.558) (-3198.597) [-3196.343] (-3199.364) * (-3202.292) (-3200.704) [-3196.644] (-3200.137) -- 0:03:20 170000 -- (-3201.776) [-3196.594] (-3211.135) (-3196.496) * (-3200.309) (-3202.951) (-3202.284) [-3196.591] -- 0:03:25 Average standard deviation of split frequencies: 0.000000 170500 -- (-3195.927) (-3202.986) (-3208.158) [-3196.086] * (-3198.629) (-3201.180) (-3200.788) [-3196.251] -- 0:03:24 171000 -- (-3200.766) (-3198.725) (-3197.703) [-3197.188] * [-3195.861] (-3203.151) (-3198.673) (-3201.388) -- 0:03:23 171500 -- [-3197.510] (-3199.145) (-3199.876) (-3194.749) * (-3207.131) (-3202.077) (-3200.714) [-3201.272] -- 0:03:22 172000 -- (-3194.434) [-3196.127] (-3200.315) (-3199.424) * (-3202.358) [-3199.528] (-3195.798) (-3198.263) -- 0:03:22 172500 -- [-3198.114] (-3203.848) (-3205.172) (-3196.172) * (-3202.778) (-3208.840) [-3196.734] (-3200.771) -- 0:03:21 173000 -- (-3199.138) [-3201.256] (-3200.633) (-3198.647) * (-3198.418) [-3206.703] (-3199.713) (-3198.148) -- 0:03:20 173500 -- [-3201.504] (-3200.124) (-3196.798) (-3194.300) * (-3201.579) (-3199.829) (-3194.475) [-3200.083] -- 0:03:20 174000 -- (-3200.053) (-3200.774) [-3197.141] (-3198.212) * [-3195.447] (-3204.553) (-3203.965) (-3200.021) -- 0:03:24 174500 -- (-3203.676) [-3198.409] (-3198.914) (-3196.523) * (-3197.005) (-3209.151) [-3195.240] (-3201.428) -- 0:03:23 175000 -- [-3200.396] (-3197.591) (-3200.770) (-3196.053) * [-3200.769] (-3204.363) (-3201.838) (-3208.083) -- 0:03:22 Average standard deviation of split frequencies: 0.000000 175500 -- (-3206.643) (-3204.168) (-3198.283) [-3200.564] * (-3197.337) (-3199.681) [-3195.773] (-3212.534) -- 0:03:22 176000 -- [-3201.799] (-3202.217) (-3206.773) (-3200.941) * [-3194.894] (-3201.018) (-3198.671) (-3199.882) -- 0:03:21 176500 -- (-3200.451) (-3202.075) (-3203.592) [-3195.269] * [-3195.387] (-3197.436) (-3207.814) (-3215.031) -- 0:03:20 177000 -- (-3204.269) (-3202.541) (-3210.518) [-3196.631] * (-3200.225) (-3197.594) (-3208.530) [-3202.524] -- 0:03:19 177500 -- (-3199.631) (-3211.002) [-3202.285] (-3205.200) * (-3199.711) (-3200.394) (-3200.041) [-3199.162] -- 0:03:19 178000 -- [-3197.132] (-3211.869) (-3203.221) (-3205.097) * (-3204.371) [-3194.858] (-3197.482) (-3199.523) -- 0:03:18 178500 -- (-3198.371) (-3205.877) [-3199.256] (-3206.674) * (-3199.197) [-3197.828] (-3198.145) (-3203.434) -- 0:03:22 179000 -- [-3198.910] (-3205.558) (-3198.075) (-3201.184) * (-3197.372) (-3200.224) (-3199.210) [-3199.093] -- 0:03:21 179500 -- (-3201.094) (-3207.655) (-3195.198) [-3197.900] * (-3200.767) (-3201.180) (-3199.328) [-3206.068] -- 0:03:21 180000 -- (-3202.799) (-3195.994) [-3196.357] (-3202.884) * [-3199.425] (-3196.924) (-3194.390) (-3207.911) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 180500 -- [-3194.974] (-3204.534) (-3198.481) (-3200.874) * (-3198.610) [-3201.054] (-3197.600) (-3201.111) -- 0:03:19 181000 -- (-3197.318) (-3208.236) [-3198.784] (-3200.643) * (-3200.426) [-3202.429] (-3198.700) (-3201.974) -- 0:03:19 181500 -- (-3201.946) (-3199.886) [-3199.014] (-3203.701) * (-3200.194) (-3195.855) [-3200.899] (-3206.743) -- 0:03:18 182000 -- (-3197.376) [-3196.925] (-3203.282) (-3206.411) * (-3196.055) [-3198.640] (-3202.802) (-3208.399) -- 0:03:17 182500 -- (-3203.720) (-3194.401) [-3204.785] (-3198.746) * (-3199.548) (-3198.942) [-3197.159] (-3197.558) -- 0:03:21 183000 -- (-3201.243) (-3201.359) (-3202.384) [-3194.253] * (-3201.270) (-3204.200) (-3201.123) [-3195.337] -- 0:03:20 183500 -- [-3198.817] (-3201.175) (-3199.115) (-3195.444) * (-3196.783) (-3201.026) (-3200.310) [-3196.077] -- 0:03:20 184000 -- (-3202.412) (-3200.185) (-3195.550) [-3199.472] * (-3199.485) (-3197.707) [-3201.232] (-3197.603) -- 0:03:19 184500 -- (-3202.470) (-3201.302) [-3202.590] (-3203.133) * (-3201.334) (-3200.111) (-3198.692) [-3196.323] -- 0:03:18 185000 -- (-3202.353) (-3196.584) (-3197.361) [-3196.659] * (-3202.303) [-3194.457] (-3198.283) (-3202.667) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 185500 -- (-3200.310) (-3194.946) (-3204.647) [-3204.163] * (-3196.354) (-3204.573) (-3199.291) [-3202.281] -- 0:03:17 186000 -- (-3198.057) (-3200.849) (-3201.216) [-3205.468] * (-3196.991) (-3205.526) [-3196.108] (-3198.413) -- 0:03:21 186500 -- [-3195.478] (-3195.888) (-3200.316) (-3196.551) * [-3196.634] (-3202.229) (-3204.573) (-3205.524) -- 0:03:20 187000 -- (-3194.973) (-3196.291) [-3197.491] (-3202.044) * [-3196.237] (-3209.993) (-3207.191) (-3198.183) -- 0:03:19 187500 -- (-3204.088) (-3202.158) (-3202.497) [-3196.965] * (-3200.184) [-3198.747] (-3203.191) (-3203.854) -- 0:03:19 188000 -- (-3201.716) (-3199.740) (-3204.954) [-3202.955] * (-3195.781) [-3196.525] (-3201.277) (-3207.155) -- 0:03:18 188500 -- (-3198.918) (-3205.267) (-3205.448) [-3196.910] * [-3199.556] (-3197.106) (-3199.595) (-3201.070) -- 0:03:18 189000 -- (-3195.117) (-3200.237) [-3199.137] (-3199.097) * (-3201.867) (-3205.494) (-3199.382) [-3195.779] -- 0:03:17 189500 -- [-3195.803] (-3201.654) (-3206.663) (-3208.768) * (-3201.977) (-3198.336) (-3196.729) [-3195.249] -- 0:03:21 190000 -- [-3200.474] (-3200.887) (-3201.203) (-3201.695) * (-3204.050) (-3196.003) [-3199.613] (-3194.604) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 190500 -- (-3201.232) [-3203.739] (-3200.869) (-3205.271) * (-3196.491) [-3199.520] (-3199.579) (-3203.237) -- 0:03:19 191000 -- (-3204.273) [-3199.092] (-3199.369) (-3200.133) * [-3200.563] (-3198.504) (-3205.492) (-3197.744) -- 0:03:19 191500 -- [-3199.229] (-3204.114) (-3198.081) (-3204.306) * (-3198.447) (-3201.668) (-3200.474) [-3196.315] -- 0:03:18 192000 -- (-3198.176) (-3196.840) [-3197.957] (-3192.372) * (-3198.339) (-3208.215) (-3200.780) [-3201.254] -- 0:03:17 192500 -- (-3200.838) [-3202.180] (-3194.280) (-3200.924) * [-3197.158] (-3201.930) (-3195.759) (-3196.435) -- 0:03:17 193000 -- (-3200.871) (-3204.468) [-3196.387] (-3197.356) * [-3195.509] (-3200.672) (-3198.973) (-3193.373) -- 0:03:20 193500 -- [-3203.330] (-3198.189) (-3194.904) (-3202.755) * (-3197.120) [-3197.004] (-3202.693) (-3197.034) -- 0:03:20 194000 -- (-3202.507) [-3200.873] (-3195.718) (-3202.900) * [-3201.598] (-3197.217) (-3209.622) (-3196.505) -- 0:03:19 194500 -- [-3198.942] (-3198.785) (-3200.829) (-3195.739) * (-3194.272) (-3207.910) (-3209.859) [-3198.921] -- 0:03:18 195000 -- (-3202.470) (-3199.129) [-3206.889] (-3196.718) * (-3200.040) [-3207.909] (-3204.789) (-3202.314) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 195500 -- (-3206.694) (-3197.152) (-3203.211) [-3198.851] * (-3196.201) (-3197.697) [-3203.997] (-3200.973) -- 0:03:17 196000 -- (-3200.391) (-3205.899) [-3194.602] (-3196.900) * (-3205.454) (-3201.584) [-3200.804] (-3202.639) -- 0:03:16 196500 -- (-3198.188) (-3210.543) (-3196.001) [-3196.407] * (-3202.052) (-3196.531) [-3199.421] (-3202.250) -- 0:03:16 197000 -- [-3195.034] (-3201.326) (-3199.943) (-3197.385) * (-3199.439) (-3202.022) (-3200.120) [-3197.529] -- 0:03:19 197500 -- (-3196.871) [-3197.444] (-3198.060) (-3204.600) * (-3204.332) (-3204.711) (-3198.273) [-3196.698] -- 0:03:19 198000 -- (-3194.968) (-3200.486) (-3199.910) [-3196.479] * (-3201.196) [-3205.892] (-3202.243) (-3198.817) -- 0:03:18 198500 -- (-3200.187) (-3199.729) [-3199.466] (-3206.016) * (-3211.528) (-3206.524) [-3199.042] (-3198.787) -- 0:03:17 199000 -- (-3198.299) (-3206.220) (-3201.168) [-3199.485] * (-3208.631) [-3206.187] (-3196.319) (-3198.929) -- 0:03:17 199500 -- [-3195.895] (-3203.812) (-3199.035) (-3206.664) * (-3201.072) [-3202.792] (-3201.521) (-3198.959) -- 0:03:16 200000 -- (-3198.958) [-3198.735] (-3203.301) (-3203.393) * (-3197.644) [-3205.103] (-3204.961) (-3203.263) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 200500 -- (-3206.125) (-3199.376) [-3198.881] (-3198.475) * (-3196.365) (-3201.893) [-3197.036] (-3200.013) -- 0:03:19 201000 -- (-3199.628) (-3200.962) (-3203.193) [-3197.487] * (-3200.551) (-3196.103) (-3202.638) [-3199.120] -- 0:03:18 201500 -- (-3199.595) [-3196.679] (-3202.247) (-3198.511) * (-3194.985) (-3199.747) [-3202.332] (-3199.731) -- 0:03:18 202000 -- [-3199.225] (-3198.940) (-3201.932) (-3206.237) * (-3202.546) (-3198.940) (-3203.093) [-3202.062] -- 0:03:17 202500 -- (-3196.055) (-3196.903) [-3201.868] (-3208.344) * (-3204.046) [-3196.248] (-3196.335) (-3196.262) -- 0:03:16 203000 -- (-3198.869) [-3199.828] (-3215.375) (-3201.626) * [-3201.331] (-3200.111) (-3200.802) (-3201.405) -- 0:03:16 203500 -- (-3196.626) (-3193.858) [-3204.544] (-3203.225) * (-3198.952) (-3199.183) (-3202.267) [-3201.914] -- 0:03:15 204000 -- (-3200.354) (-3197.020) (-3196.044) [-3202.450] * (-3202.311) [-3198.437] (-3200.317) (-3197.378) -- 0:03:15 204500 -- [-3194.764] (-3208.121) (-3196.490) (-3200.675) * [-3198.121] (-3200.612) (-3198.989) (-3198.174) -- 0:03:14 205000 -- [-3202.180] (-3197.894) (-3203.130) (-3196.998) * (-3196.682) (-3199.052) [-3208.168] (-3199.477) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 205500 -- [-3202.815] (-3199.145) (-3198.799) (-3202.172) * [-3197.766] (-3201.723) (-3204.031) (-3205.452) -- 0:03:17 206000 -- [-3200.391] (-3199.490) (-3204.211) (-3194.452) * (-3199.219) (-3202.563) (-3203.072) [-3201.028] -- 0:03:16 206500 -- (-3201.037) (-3198.746) (-3198.410) [-3199.314] * [-3194.928] (-3199.081) (-3207.151) (-3210.148) -- 0:03:15 207000 -- (-3206.210) (-3197.893) [-3205.952] (-3197.590) * [-3200.553] (-3196.301) (-3198.010) (-3202.182) -- 0:03:15 207500 -- (-3204.201) (-3200.865) [-3199.905] (-3198.473) * (-3196.134) [-3194.702] (-3199.643) (-3201.510) -- 0:03:14 208000 -- [-3200.812] (-3204.434) (-3207.388) (-3200.187) * [-3199.441] (-3200.854) (-3208.695) (-3196.831) -- 0:03:14 208500 -- (-3208.504) [-3196.766] (-3204.032) (-3196.804) * (-3200.570) [-3207.865] (-3206.736) (-3200.703) -- 0:03:13 209000 -- (-3204.742) (-3197.205) [-3202.810] (-3193.380) * (-3201.166) [-3200.886] (-3200.047) (-3195.923) -- 0:03:16 209500 -- [-3194.891] (-3196.212) (-3198.394) (-3199.110) * [-3198.749] (-3199.671) (-3201.787) (-3199.398) -- 0:03:16 210000 -- (-3202.401) (-3209.093) (-3200.056) [-3197.955] * (-3197.545) (-3199.195) [-3201.787] (-3210.400) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 210500 -- (-3200.963) (-3204.912) [-3196.591] (-3195.872) * (-3195.872) [-3203.349] (-3200.884) (-3202.199) -- 0:03:15 211000 -- [-3196.613] (-3206.032) (-3201.793) (-3192.520) * (-3197.874) (-3205.049) [-3202.972] (-3203.709) -- 0:03:14 211500 -- (-3209.105) (-3203.605) (-3197.313) [-3196.193] * (-3205.509) (-3197.394) (-3202.196) [-3197.686] -- 0:03:13 212000 -- (-3198.678) [-3205.233] (-3198.028) (-3203.907) * (-3204.401) (-3201.978) [-3201.490] (-3197.414) -- 0:03:13 212500 -- (-3206.229) (-3197.780) (-3200.988) [-3200.666] * (-3195.155) [-3196.989] (-3197.764) (-3203.361) -- 0:03:12 213000 -- [-3198.093] (-3199.873) (-3199.637) (-3206.460) * (-3197.185) (-3202.598) (-3203.166) [-3210.001] -- 0:03:15 213500 -- (-3201.299) (-3197.885) [-3202.885] (-3202.014) * [-3195.859] (-3196.870) (-3200.355) (-3201.526) -- 0:03:15 214000 -- (-3196.130) (-3196.554) [-3202.012] (-3202.030) * (-3195.111) (-3200.772) [-3198.064] (-3205.111) -- 0:03:14 214500 -- (-3202.171) [-3197.550] (-3196.693) (-3200.416) * (-3213.860) (-3203.043) [-3198.366] (-3207.406) -- 0:03:14 215000 -- (-3198.454) (-3200.175) (-3203.963) [-3198.037] * (-3202.161) (-3208.863) [-3200.055] (-3198.064) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 215500 -- (-3201.023) (-3194.233) [-3203.418] (-3200.204) * [-3194.717] (-3202.990) (-3196.287) (-3195.627) -- 0:03:12 216000 -- (-3202.664) (-3197.402) [-3196.590] (-3199.235) * (-3200.823) [-3203.197] (-3195.072) (-3202.890) -- 0:03:12 216500 -- (-3198.731) (-3203.338) [-3198.908] (-3201.354) * (-3205.890) (-3209.466) [-3195.552] (-3202.717) -- 0:03:11 217000 -- (-3198.630) (-3204.512) [-3196.995] (-3195.935) * (-3200.460) [-3200.009] (-3201.877) (-3198.313) -- 0:03:14 217500 -- (-3197.623) [-3195.650] (-3195.492) (-3205.084) * (-3198.622) (-3196.477) [-3192.199] (-3201.780) -- 0:03:14 218000 -- (-3205.892) (-3198.181) [-3197.005] (-3204.660) * (-3207.221) [-3203.383] (-3202.452) (-3200.923) -- 0:03:13 218500 -- (-3205.310) (-3197.913) [-3201.480] (-3201.724) * (-3201.378) (-3199.973) [-3196.679] (-3204.038) -- 0:03:13 219000 -- [-3198.243] (-3196.438) (-3200.507) (-3198.169) * (-3203.272) (-3197.362) (-3199.337) [-3202.241] -- 0:03:12 219500 -- (-3200.375) (-3196.820) [-3200.516] (-3199.815) * (-3201.930) [-3196.067] (-3201.086) (-3198.947) -- 0:03:12 220000 -- (-3199.141) (-3197.246) [-3197.192] (-3199.659) * (-3200.188) (-3194.658) (-3204.564) [-3196.759] -- 0:03:11 Average standard deviation of split frequencies: 0.000000 220500 -- [-3199.564] (-3204.013) (-3198.802) (-3206.683) * [-3200.094] (-3200.360) (-3212.046) (-3199.901) -- 0:03:10 221000 -- (-3205.426) (-3203.536) (-3198.046) [-3199.343] * (-3197.258) (-3198.540) (-3200.368) [-3200.924] -- 0:03:13 221500 -- (-3202.159) [-3200.354] (-3205.818) (-3197.497) * (-3201.312) (-3197.203) [-3196.506] (-3201.990) -- 0:03:13 222000 -- [-3205.748] (-3198.592) (-3197.221) (-3194.665) * (-3198.469) (-3199.649) [-3198.340] (-3201.025) -- 0:03:12 222500 -- (-3203.621) (-3200.582) (-3202.749) [-3202.609] * (-3199.800) (-3207.766) (-3206.289) [-3199.338] -- 0:03:12 223000 -- (-3199.122) [-3203.630] (-3196.662) (-3202.461) * [-3202.514] (-3207.424) (-3196.818) (-3205.017) -- 0:03:11 223500 -- (-3199.853) [-3204.885] (-3201.965) (-3201.963) * (-3201.117) (-3200.037) [-3196.953] (-3201.883) -- 0:03:11 224000 -- (-3198.943) (-3203.077) [-3202.145] (-3203.163) * (-3200.318) (-3200.781) (-3194.084) [-3197.851] -- 0:03:14 224500 -- (-3198.452) (-3205.735) (-3204.816) [-3195.405] * [-3202.715] (-3200.204) (-3204.299) (-3198.913) -- 0:03:13 225000 -- (-3200.722) (-3200.391) [-3198.302] (-3195.939) * [-3195.193] (-3195.007) (-3212.752) (-3200.749) -- 0:03:12 Average standard deviation of split frequencies: 0.000000 225500 -- (-3202.074) (-3203.626) [-3198.633] (-3199.374) * (-3205.122) [-3195.386] (-3208.658) (-3199.131) -- 0:03:12 226000 -- (-3198.622) (-3206.843) (-3196.786) [-3201.239] * (-3200.943) (-3207.963) (-3204.685) [-3195.807] -- 0:03:11 226500 -- (-3202.194) (-3200.357) [-3194.081] (-3202.036) * [-3197.644] (-3199.571) (-3199.582) (-3201.069) -- 0:03:11 227000 -- (-3196.045) (-3198.892) (-3207.705) [-3194.875] * [-3193.068] (-3199.779) (-3201.096) (-3205.016) -- 0:03:10 227500 -- (-3197.744) (-3199.482) (-3207.760) [-3194.730] * (-3204.745) [-3207.708] (-3206.298) (-3213.345) -- 0:03:13 228000 -- [-3197.569] (-3201.695) (-3196.566) (-3203.317) * [-3202.257] (-3200.530) (-3208.971) (-3196.994) -- 0:03:13 228500 -- (-3197.286) (-3201.392) (-3199.210) [-3194.834] * (-3194.177) [-3202.582] (-3207.604) (-3200.652) -- 0:03:12 229000 -- (-3200.033) (-3200.379) [-3194.775] (-3193.798) * (-3204.682) (-3197.310) (-3203.041) [-3198.876] -- 0:03:11 229500 -- (-3195.658) [-3199.508] (-3196.980) (-3206.361) * (-3199.821) [-3200.010] (-3201.386) (-3195.845) -- 0:03:11 230000 -- (-3198.317) [-3197.471] (-3201.821) (-3200.184) * [-3200.104] (-3211.015) (-3199.600) (-3201.020) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 230500 -- (-3211.056) (-3199.754) (-3198.026) [-3199.057] * (-3200.318) [-3198.122] (-3198.824) (-3200.229) -- 0:03:10 231000 -- (-3200.205) [-3203.144] (-3200.632) (-3198.865) * [-3205.729] (-3198.796) (-3199.974) (-3205.628) -- 0:03:09 231500 -- (-3195.949) (-3206.772) (-3205.820) [-3201.656] * (-3207.709) (-3203.442) [-3200.158] (-3205.037) -- 0:03:12 232000 -- (-3207.844) [-3206.636] (-3198.029) (-3200.116) * (-3202.292) (-3204.923) (-3197.051) [-3202.663] -- 0:03:12 232500 -- (-3194.580) [-3200.270] (-3199.305) (-3199.716) * (-3206.330) (-3200.582) (-3203.213) [-3196.284] -- 0:03:11 233000 -- (-3202.571) [-3198.951] (-3196.227) (-3198.206) * (-3199.849) (-3205.770) [-3198.818] (-3198.660) -- 0:03:10 233500 -- (-3201.349) (-3199.849) [-3197.611] (-3197.042) * (-3199.354) (-3206.850) [-3202.317] (-3198.224) -- 0:03:10 234000 -- (-3202.994) (-3198.823) (-3203.248) [-3197.360] * (-3201.398) (-3196.068) [-3198.084] (-3197.937) -- 0:03:09 234500 -- (-3198.753) (-3196.512) (-3198.688) [-3199.390] * (-3199.349) (-3199.770) [-3199.751] (-3199.065) -- 0:03:09 235000 -- [-3199.539] (-3201.949) (-3198.043) (-3200.439) * [-3192.562] (-3202.599) (-3201.697) (-3201.380) -- 0:03:08 Average standard deviation of split frequencies: 0.000999 235500 -- (-3201.430) (-3204.300) [-3196.225] (-3202.906) * [-3200.071] (-3203.137) (-3195.035) (-3196.353) -- 0:03:11 236000 -- [-3199.446] (-3201.621) (-3196.328) (-3204.257) * (-3201.159) (-3204.464) [-3196.079] (-3202.234) -- 0:03:11 236500 -- (-3202.719) [-3200.096] (-3199.683) (-3199.499) * (-3200.424) (-3204.305) [-3199.391] (-3210.533) -- 0:03:10 237000 -- (-3197.974) [-3199.491] (-3201.748) (-3211.912) * [-3198.150] (-3203.397) (-3199.212) (-3198.211) -- 0:03:09 237500 -- (-3197.257) (-3194.703) [-3196.998] (-3197.588) * (-3198.136) (-3197.991) [-3201.365] (-3200.044) -- 0:03:09 238000 -- (-3203.612) [-3197.413] (-3200.584) (-3194.973) * (-3205.275) [-3200.103] (-3196.884) (-3199.660) -- 0:03:08 238500 -- (-3197.604) (-3204.944) [-3199.927] (-3203.930) * (-3196.194) (-3200.227) [-3195.630] (-3198.497) -- 0:03:08 239000 -- (-3209.928) (-3202.204) [-3197.428] (-3199.757) * (-3198.999) (-3199.646) [-3202.185] (-3200.919) -- 0:03:07 239500 -- (-3199.417) [-3193.805] (-3198.430) (-3194.341) * [-3199.173] (-3192.044) (-3198.892) (-3202.147) -- 0:03:10 240000 -- (-3207.341) (-3197.079) (-3202.816) [-3201.428] * (-3199.681) (-3203.792) [-3197.077] (-3200.164) -- 0:03:10 Average standard deviation of split frequencies: 0.000979 240500 -- (-3196.495) [-3198.825] (-3207.044) (-3208.077) * [-3202.719] (-3204.992) (-3199.148) (-3202.674) -- 0:03:09 241000 -- [-3198.704] (-3203.975) (-3195.873) (-3200.073) * (-3199.867) (-3194.872) (-3197.980) [-3201.940] -- 0:03:08 241500 -- [-3201.935] (-3199.309) (-3200.987) (-3199.796) * [-3193.038] (-3200.197) (-3202.317) (-3204.832) -- 0:03:08 242000 -- (-3199.002) (-3196.888) (-3203.112) [-3202.290] * (-3200.019) [-3199.828] (-3203.391) (-3200.084) -- 0:03:07 242500 -- (-3200.958) (-3198.488) [-3197.579] (-3204.962) * (-3198.832) (-3203.618) [-3197.734] (-3196.707) -- 0:03:07 243000 -- [-3198.032] (-3197.208) (-3200.899) (-3197.707) * (-3200.111) [-3199.250] (-3199.158) (-3198.826) -- 0:03:06 243500 -- [-3197.270] (-3201.126) (-3202.575) (-3204.457) * (-3203.944) (-3199.945) [-3195.661] (-3196.069) -- 0:03:09 244000 -- (-3205.812) [-3204.161] (-3197.560) (-3198.664) * (-3201.418) (-3195.672) (-3199.006) [-3198.389] -- 0:03:09 244500 -- (-3197.639) (-3209.752) (-3197.245) [-3198.868] * (-3197.194) [-3198.798] (-3197.289) (-3195.625) -- 0:03:08 245000 -- [-3202.676] (-3206.396) (-3198.506) (-3197.055) * (-3195.223) [-3201.447] (-3207.553) (-3199.832) -- 0:03:07 Average standard deviation of split frequencies: 0.000958 245500 -- (-3196.014) (-3198.498) (-3205.101) [-3200.385] * [-3201.483] (-3206.020) (-3200.302) (-3200.782) -- 0:03:07 246000 -- (-3194.232) (-3198.021) [-3203.048] (-3199.096) * (-3205.420) (-3206.804) (-3203.847) [-3197.213] -- 0:03:06 246500 -- (-3203.334) [-3203.082] (-3198.883) (-3195.357) * (-3206.107) (-3203.768) [-3194.172] (-3199.671) -- 0:03:06 247000 -- (-3207.069) [-3210.603] (-3202.463) (-3195.321) * (-3200.173) (-3201.052) (-3205.546) [-3198.211] -- 0:03:05 247500 -- (-3200.533) (-3204.568) [-3199.181] (-3198.258) * (-3202.306) (-3196.507) (-3200.674) [-3197.659] -- 0:03:05 248000 -- (-3198.352) (-3198.952) [-3196.438] (-3200.694) * (-3202.908) [-3195.968] (-3203.338) (-3202.077) -- 0:03:08 248500 -- [-3196.889] (-3200.092) (-3206.676) (-3202.320) * (-3204.544) (-3199.363) (-3199.248) [-3194.735] -- 0:03:07 249000 -- [-3200.195] (-3197.379) (-3204.327) (-3194.688) * (-3193.810) (-3206.026) [-3197.542] (-3199.991) -- 0:03:06 249500 -- (-3199.338) [-3199.574] (-3212.127) (-3206.532) * (-3201.759) [-3196.839] (-3208.023) (-3201.917) -- 0:03:06 250000 -- [-3202.338] (-3200.993) (-3200.891) (-3202.681) * (-3197.776) (-3201.627) [-3201.434] (-3199.216) -- 0:03:06 Average standard deviation of split frequencies: 0.000940 250500 -- (-3200.993) [-3196.320] (-3199.651) (-3202.870) * (-3205.296) [-3202.176] (-3199.497) (-3200.823) -- 0:03:05 251000 -- (-3202.329) (-3201.646) [-3200.618] (-3194.024) * (-3199.643) [-3206.753] (-3200.878) (-3211.100) -- 0:03:05 251500 -- (-3196.754) (-3198.885) [-3202.997] (-3195.534) * [-3199.058] (-3204.754) (-3207.330) (-3199.578) -- 0:03:04 252000 -- (-3198.031) (-3201.261) (-3196.628) [-3200.571] * (-3199.830) [-3210.877] (-3203.024) (-3201.028) -- 0:03:07 252500 -- (-3196.595) (-3196.719) [-3200.814] (-3201.433) * [-3197.500] (-3200.165) (-3205.432) (-3195.783) -- 0:03:06 253000 -- (-3198.613) (-3198.650) (-3201.333) [-3199.189] * [-3201.168] (-3203.185) (-3200.928) (-3196.891) -- 0:03:06 253500 -- (-3210.037) [-3199.636] (-3203.062) (-3198.752) * (-3202.908) [-3199.952] (-3204.501) (-3197.918) -- 0:03:05 254000 -- (-3200.806) (-3198.029) [-3196.789] (-3196.172) * [-3202.120] (-3207.203) (-3197.428) (-3197.313) -- 0:03:05 254500 -- [-3194.638] (-3197.520) (-3206.026) (-3200.908) * (-3203.642) (-3203.859) [-3196.964] (-3199.838) -- 0:03:04 255000 -- (-3197.116) [-3199.000] (-3202.915) (-3198.183) * (-3199.330) (-3204.503) [-3203.791] (-3195.773) -- 0:03:04 Average standard deviation of split frequencies: 0.000921 255500 -- (-3203.673) (-3196.607) (-3195.581) [-3200.096] * [-3198.968] (-3203.980) (-3200.461) (-3199.094) -- 0:03:03 256000 -- (-3200.913) (-3193.747) (-3200.992) [-3198.844] * (-3200.379) (-3206.448) [-3200.528] (-3199.974) -- 0:03:06 256500 -- (-3200.419) (-3204.276) (-3204.152) [-3203.015] * (-3208.074) (-3207.380) [-3195.905] (-3197.959) -- 0:03:05 257000 -- (-3200.467) (-3210.628) [-3201.533] (-3204.568) * (-3202.381) (-3211.993) (-3200.306) [-3195.789] -- 0:03:05 257500 -- (-3196.751) (-3197.353) (-3203.556) [-3197.013] * (-3197.198) [-3203.426] (-3197.741) (-3204.863) -- 0:03:04 258000 -- [-3198.298] (-3213.134) (-3196.872) (-3211.674) * (-3207.681) (-3206.268) (-3198.066) [-3198.895] -- 0:03:04 258500 -- (-3195.105) (-3206.840) (-3210.714) [-3197.503] * [-3197.613] (-3203.565) (-3195.450) (-3194.650) -- 0:03:03 259000 -- (-3198.114) (-3211.085) (-3202.644) [-3197.793] * (-3200.188) (-3199.948) [-3201.606] (-3201.298) -- 0:03:03 259500 -- [-3200.584] (-3205.568) (-3207.001) (-3201.444) * (-3197.565) (-3201.101) [-3203.008] (-3200.310) -- 0:03:02 260000 -- (-3195.835) (-3200.428) [-3197.992] (-3197.916) * (-3201.045) (-3196.845) [-3193.788] (-3207.452) -- 0:03:02 Average standard deviation of split frequencies: 0.000904 260500 -- [-3193.284] (-3200.452) (-3197.315) (-3193.296) * (-3209.736) (-3201.777) [-3197.072] (-3201.863) -- 0:03:04 261000 -- (-3197.834) (-3198.213) [-3198.358] (-3200.208) * (-3203.864) (-3203.462) (-3200.765) [-3198.736] -- 0:03:04 261500 -- [-3206.451] (-3201.391) (-3207.222) (-3203.425) * [-3195.716] (-3202.628) (-3201.849) (-3196.175) -- 0:03:03 262000 -- (-3200.500) (-3199.848) (-3198.413) [-3196.835] * (-3209.002) (-3206.322) (-3195.421) [-3194.967] -- 0:03:03 262500 -- (-3201.397) [-3195.267] (-3203.797) (-3196.359) * (-3198.707) (-3203.469) [-3199.729] (-3200.484) -- 0:03:02 263000 -- (-3196.801) [-3199.960] (-3200.595) (-3194.502) * (-3200.391) (-3205.010) [-3201.545] (-3201.061) -- 0:03:02 263500 -- (-3201.864) [-3198.020] (-3203.509) (-3201.088) * (-3204.710) (-3195.143) (-3202.310) [-3201.011] -- 0:03:01 264000 -- (-3196.452) (-3201.566) [-3197.799] (-3203.197) * (-3205.822) (-3199.908) (-3194.257) [-3204.401] -- 0:03:01 264500 -- (-3199.105) (-3203.284) [-3198.697] (-3198.764) * (-3205.104) (-3197.184) [-3197.842] (-3198.895) -- 0:03:03 265000 -- (-3200.066) (-3202.640) [-3203.501] (-3196.584) * (-3197.831) [-3199.100] (-3199.097) (-3201.638) -- 0:03:03 Average standard deviation of split frequencies: 0.000886 265500 -- (-3195.588) (-3198.706) [-3200.152] (-3204.251) * [-3199.122] (-3195.701) (-3195.299) (-3208.315) -- 0:03:02 266000 -- [-3198.775] (-3202.590) (-3197.431) (-3197.244) * (-3201.792) [-3202.095] (-3206.282) (-3203.599) -- 0:03:02 266500 -- [-3194.390] (-3201.095) (-3203.606) (-3198.808) * (-3201.294) [-3198.357] (-3198.229) (-3207.622) -- 0:03:01 267000 -- (-3204.654) [-3196.522] (-3200.588) (-3203.244) * (-3203.011) (-3208.815) [-3196.262] (-3202.055) -- 0:03:01 267500 -- (-3204.810) [-3200.404] (-3200.343) (-3195.536) * (-3201.135) [-3194.977] (-3207.019) (-3200.826) -- 0:03:00 268000 -- (-3211.082) (-3203.749) (-3200.363) [-3200.367] * (-3203.720) (-3208.302) [-3208.883] (-3202.794) -- 0:03:00 268500 -- (-3197.884) (-3198.116) (-3196.169) [-3198.566] * [-3199.858] (-3200.764) (-3205.116) (-3200.177) -- 0:03:02 269000 -- [-3201.648] (-3203.844) (-3200.680) (-3199.502) * (-3199.303) [-3201.276] (-3197.480) (-3199.080) -- 0:03:02 269500 -- (-3204.117) (-3199.136) (-3196.603) [-3201.547] * (-3202.035) [-3197.690] (-3203.097) (-3201.059) -- 0:03:01 270000 -- (-3204.592) (-3204.111) (-3195.862) [-3201.812] * (-3200.333) [-3202.299] (-3195.224) (-3202.918) -- 0:03:01 Average standard deviation of split frequencies: 0.000871 270500 -- (-3208.500) (-3207.997) (-3198.864) [-3197.099] * (-3201.424) [-3195.414] (-3207.172) (-3205.018) -- 0:03:00 271000 -- (-3198.900) (-3200.041) (-3198.351) [-3205.379] * (-3199.472) [-3199.986] (-3202.785) (-3202.208) -- 0:03:00 271500 -- (-3203.404) (-3200.212) [-3199.364] (-3195.971) * (-3199.041) (-3204.014) [-3201.032] (-3198.633) -- 0:02:59 272000 -- (-3199.875) [-3196.251] (-3196.864) (-3203.548) * [-3198.881] (-3198.450) (-3202.021) (-3203.337) -- 0:02:59 272500 -- (-3201.367) [-3201.781] (-3204.946) (-3204.421) * [-3200.131] (-3197.745) (-3204.789) (-3206.374) -- 0:03:01 273000 -- (-3214.234) (-3200.746) (-3204.828) [-3197.004] * (-3199.436) [-3200.404] (-3196.492) (-3199.836) -- 0:03:01 273500 -- (-3197.254) (-3195.798) [-3200.821] (-3194.305) * (-3197.356) (-3204.906) [-3198.185] (-3198.651) -- 0:03:00 274000 -- (-3197.651) [-3198.737] (-3205.829) (-3196.609) * (-3196.498) (-3207.093) [-3201.932] (-3197.167) -- 0:03:00 274500 -- [-3195.876] (-3198.862) (-3202.083) (-3198.609) * (-3198.975) (-3206.545) [-3197.376] (-3201.332) -- 0:02:59 275000 -- (-3196.322) [-3199.024] (-3200.082) (-3206.647) * (-3197.979) (-3204.981) (-3206.054) [-3202.706] -- 0:02:59 Average standard deviation of split frequencies: 0.000854 275500 -- (-3202.380) (-3207.060) (-3199.650) [-3200.799] * (-3201.719) (-3199.997) (-3198.456) [-3204.502] -- 0:02:58 276000 -- [-3205.385] (-3202.383) (-3201.351) (-3201.269) * [-3195.192] (-3199.245) (-3199.520) (-3196.019) -- 0:02:58 276500 -- (-3199.721) [-3205.589] (-3202.920) (-3203.011) * (-3200.835) [-3201.879] (-3196.270) (-3199.094) -- 0:02:57 277000 -- [-3198.538] (-3201.400) (-3197.603) (-3200.511) * (-3195.882) (-3203.721) (-3196.614) [-3201.184] -- 0:03:00 277500 -- (-3200.252) (-3199.681) (-3206.864) [-3205.028] * (-3200.390) [-3202.328] (-3197.651) (-3200.887) -- 0:02:59 278000 -- (-3198.367) (-3194.622) (-3203.556) [-3199.135] * [-3198.445] (-3197.219) (-3207.448) (-3201.444) -- 0:02:59 278500 -- (-3199.200) (-3197.811) [-3202.533] (-3202.737) * (-3199.893) (-3196.086) (-3208.722) [-3197.072] -- 0:02:58 279000 -- (-3199.838) [-3199.745] (-3195.437) (-3204.341) * (-3197.249) [-3201.714] (-3197.028) (-3195.016) -- 0:02:58 279500 -- [-3198.175] (-3202.985) (-3195.751) (-3204.794) * [-3203.161] (-3201.862) (-3197.570) (-3199.115) -- 0:02:57 280000 -- (-3198.223) [-3196.958] (-3203.854) (-3213.297) * (-3197.454) (-3203.546) (-3198.656) [-3199.493] -- 0:03:00 Average standard deviation of split frequencies: 0.000840 280500 -- [-3198.171] (-3196.493) (-3213.042) (-3203.769) * (-3199.892) (-3197.010) (-3203.423) [-3200.124] -- 0:02:59 281000 -- (-3203.885) [-3198.423] (-3202.653) (-3193.589) * (-3206.506) (-3204.208) (-3206.309) [-3198.011] -- 0:02:59 281500 -- (-3199.731) (-3200.657) (-3202.232) [-3198.861] * (-3207.742) (-3198.957) (-3203.198) [-3199.330] -- 0:02:58 282000 -- (-3200.309) [-3200.220] (-3195.851) (-3197.234) * [-3197.144] (-3195.688) (-3198.306) (-3197.125) -- 0:02:58 282500 -- (-3195.553) [-3198.701] (-3201.828) (-3202.491) * (-3201.238) [-3202.342] (-3200.517) (-3201.288) -- 0:02:57 283000 -- (-3197.721) (-3208.428) (-3200.677) [-3200.898] * (-3198.931) (-3206.649) (-3200.733) [-3201.744] -- 0:02:57 283500 -- (-3194.083) (-3199.749) (-3206.483) [-3196.285] * (-3205.768) (-3201.173) [-3195.786] (-3196.498) -- 0:02:59 284000 -- (-3202.031) (-3200.144) (-3204.423) [-3196.950] * (-3207.038) (-3199.931) [-3198.649] (-3196.775) -- 0:02:59 284500 -- [-3193.411] (-3197.797) (-3206.200) (-3200.137) * (-3213.111) (-3200.341) [-3200.855] (-3198.345) -- 0:02:58 285000 -- (-3201.388) (-3205.372) (-3203.804) [-3194.028] * (-3202.011) [-3196.762] (-3202.936) (-3204.841) -- 0:02:58 Average standard deviation of split frequencies: 0.000824 285500 -- (-3195.545) (-3201.271) (-3203.949) [-3198.016] * [-3205.912] (-3207.879) (-3200.472) (-3201.141) -- 0:02:57 286000 -- (-3205.111) [-3197.790] (-3198.568) (-3199.044) * (-3206.812) [-3197.557] (-3202.688) (-3201.790) -- 0:02:57 286500 -- (-3197.513) [-3195.692] (-3204.375) (-3199.843) * (-3199.778) [-3199.400] (-3196.600) (-3205.911) -- 0:02:56 287000 -- [-3196.904] (-3202.444) (-3199.813) (-3211.415) * (-3201.150) (-3196.102) [-3197.968] (-3197.805) -- 0:02:56 287500 -- (-3201.450) [-3201.861] (-3199.585) (-3205.472) * (-3201.727) (-3197.856) [-3196.575] (-3200.695) -- 0:02:55 288000 -- (-3199.840) [-3196.223] (-3197.181) (-3201.180) * [-3200.268] (-3203.438) (-3200.973) (-3195.536) -- 0:02:58 288500 -- (-3199.838) (-3198.685) (-3201.814) [-3200.013] * (-3198.053) (-3206.322) [-3199.572] (-3204.512) -- 0:02:57 289000 -- (-3197.663) [-3201.337] (-3203.964) (-3195.866) * (-3195.653) [-3201.175] (-3199.008) (-3204.008) -- 0:02:57 289500 -- (-3208.945) (-3201.829) [-3200.368] (-3201.445) * (-3201.313) (-3201.421) [-3197.558] (-3199.153) -- 0:02:56 290000 -- (-3196.726) (-3198.851) (-3199.147) [-3200.111] * (-3198.354) (-3200.726) (-3200.183) [-3200.407] -- 0:02:56 Average standard deviation of split frequencies: 0.000811 290500 -- (-3198.344) (-3201.214) (-3197.645) [-3202.707] * [-3204.255] (-3200.200) (-3209.022) (-3199.800) -- 0:02:55 291000 -- (-3194.692) [-3203.148] (-3195.060) (-3205.281) * [-3194.948] (-3196.452) (-3206.562) (-3200.068) -- 0:02:55 291500 -- (-3198.529) (-3198.500) [-3201.131] (-3206.382) * [-3197.051] (-3205.317) (-3199.270) (-3202.460) -- 0:02:54 292000 -- (-3197.242) (-3206.732) [-3193.081] (-3197.645) * [-3195.590] (-3202.479) (-3197.982) (-3200.949) -- 0:02:57 292500 -- (-3197.920) [-3194.746] (-3198.710) (-3201.027) * (-3199.777) (-3197.324) [-3197.341] (-3200.851) -- 0:02:56 293000 -- (-3204.293) (-3196.375) (-3195.606) [-3197.181] * (-3197.885) (-3195.848) [-3194.242] (-3206.369) -- 0:02:56 293500 -- (-3206.390) (-3202.670) [-3201.939] (-3196.096) * (-3197.834) (-3202.513) [-3194.560] (-3197.287) -- 0:02:55 294000 -- (-3198.472) (-3197.591) (-3209.809) [-3197.528] * (-3201.743) (-3196.897) (-3195.086) [-3200.136] -- 0:02:55 294500 -- (-3202.201) [-3199.204] (-3201.829) (-3202.275) * (-3199.729) (-3199.536) [-3197.512] (-3205.661) -- 0:02:54 295000 -- (-3197.531) [-3196.287] (-3197.102) (-3203.242) * (-3199.802) (-3205.021) [-3201.437] (-3193.996) -- 0:02:54 Average standard deviation of split frequencies: 0.000796 295500 -- [-3199.096] (-3201.448) (-3204.180) (-3197.417) * [-3194.452] (-3202.404) (-3200.694) (-3200.211) -- 0:02:54 296000 -- [-3198.310] (-3200.471) (-3207.939) (-3201.609) * (-3202.235) (-3207.914) [-3197.714] (-3204.350) -- 0:02:56 296500 -- [-3198.789] (-3198.223) (-3200.180) (-3198.305) * [-3202.765] (-3200.647) (-3204.449) (-3196.848) -- 0:02:55 297000 -- (-3204.160) [-3197.224] (-3197.975) (-3201.457) * (-3199.535) (-3195.719) (-3196.189) [-3206.542] -- 0:02:55 297500 -- (-3205.313) (-3196.349) [-3197.999] (-3200.802) * (-3199.902) [-3198.349] (-3206.247) (-3200.458) -- 0:02:54 298000 -- (-3199.491) [-3208.633] (-3197.003) (-3194.071) * (-3201.278) [-3200.329] (-3197.315) (-3205.312) -- 0:02:54 298500 -- (-3194.441) (-3204.727) [-3194.009] (-3202.580) * [-3195.562] (-3195.798) (-3204.203) (-3200.067) -- 0:02:53 299000 -- [-3201.176] (-3201.062) (-3203.559) (-3204.188) * [-3195.996] (-3196.043) (-3202.182) (-3198.678) -- 0:02:53 299500 -- (-3196.835) (-3198.301) [-3202.727] (-3211.428) * (-3198.641) (-3200.735) (-3201.628) [-3199.032] -- 0:02:55 300000 -- (-3192.119) (-3203.051) [-3196.795] (-3196.616) * (-3197.516) (-3203.771) [-3201.288] (-3199.064) -- 0:02:55 Average standard deviation of split frequencies: 0.000784 300500 -- [-3204.202] (-3199.295) (-3196.837) (-3206.614) * (-3202.165) (-3197.294) [-3202.790] (-3194.852) -- 0:02:54 301000 -- (-3210.860) (-3196.936) (-3197.959) [-3198.842] * (-3196.759) (-3198.392) (-3204.556) [-3198.198] -- 0:02:54 301500 -- (-3195.566) [-3195.235] (-3198.066) (-3200.607) * (-3197.578) (-3198.420) [-3198.776] (-3199.807) -- 0:02:53 302000 -- (-3197.153) (-3194.508) (-3204.997) [-3197.417] * [-3197.567] (-3199.659) (-3204.992) (-3200.013) -- 0:02:53 302500 -- (-3196.965) (-3201.293) [-3199.956] (-3197.065) * [-3194.535] (-3203.588) (-3203.501) (-3201.677) -- 0:02:55 303000 -- (-3196.720) (-3196.514) [-3198.844] (-3199.339) * (-3205.297) (-3205.537) (-3205.345) [-3196.343] -- 0:02:54 303500 -- [-3199.384] (-3200.642) (-3194.527) (-3209.211) * [-3195.771] (-3197.040) (-3200.283) (-3200.207) -- 0:02:54 304000 -- (-3204.746) (-3197.007) [-3197.233] (-3207.116) * [-3195.230] (-3200.430) (-3207.137) (-3201.439) -- 0:02:54 304500 -- [-3200.321] (-3197.505) (-3197.105) (-3206.318) * [-3199.893] (-3199.375) (-3202.837) (-3199.442) -- 0:02:53 305000 -- (-3198.155) (-3196.946) [-3198.761] (-3205.191) * (-3196.092) (-3200.822) [-3200.718] (-3198.041) -- 0:02:53 Average standard deviation of split frequencies: 0.000770 305500 -- (-3197.657) [-3195.822] (-3196.645) (-3209.127) * (-3206.880) [-3196.590] (-3203.887) (-3205.483) -- 0:02:52 306000 -- (-3194.567) [-3192.129] (-3205.865) (-3204.748) * (-3214.102) (-3196.961) (-3202.152) [-3197.946] -- 0:02:52 306500 -- (-3198.340) (-3197.048) [-3199.328] (-3204.538) * [-3198.460] (-3201.369) (-3198.091) (-3202.532) -- 0:02:54 307000 -- (-3205.183) (-3197.874) [-3201.258] (-3204.163) * (-3196.958) [-3199.864] (-3198.538) (-3202.768) -- 0:02:53 307500 -- (-3201.197) (-3193.761) [-3196.263] (-3207.442) * (-3204.180) (-3198.950) (-3204.550) [-3196.779] -- 0:02:53 308000 -- (-3195.927) (-3201.253) [-3199.223] (-3202.088) * [-3195.293] (-3200.070) (-3200.642) (-3201.767) -- 0:02:53 308500 -- (-3199.084) [-3201.825] (-3193.329) (-3221.712) * [-3194.942] (-3200.208) (-3198.494) (-3211.713) -- 0:02:52 309000 -- (-3203.114) [-3198.617] (-3200.001) (-3209.251) * [-3197.215] (-3200.257) (-3197.204) (-3198.677) -- 0:02:52 309500 -- (-3209.190) (-3198.973) (-3202.116) [-3205.445] * [-3204.369] (-3197.539) (-3204.627) (-3195.282) -- 0:02:51 310000 -- (-3197.972) (-3204.188) (-3202.052) [-3204.684] * (-3196.473) [-3194.928] (-3206.823) (-3198.347) -- 0:02:51 Average standard deviation of split frequencies: 0.000759 310500 -- [-3196.237] (-3205.407) (-3201.879) (-3199.711) * (-3198.831) (-3202.403) (-3208.566) [-3202.891] -- 0:02:53 311000 -- (-3198.448) (-3200.766) (-3204.240) [-3196.863] * (-3201.609) (-3201.187) [-3200.137] (-3193.498) -- 0:02:52 311500 -- (-3198.686) [-3206.768] (-3200.279) (-3201.540) * (-3201.678) [-3203.270] (-3199.490) (-3197.522) -- 0:02:52 312000 -- [-3196.154] (-3198.600) (-3204.593) (-3201.398) * (-3195.394) [-3198.158] (-3197.460) (-3201.291) -- 0:02:52 312500 -- [-3203.744] (-3205.158) (-3196.963) (-3206.363) * (-3199.785) (-3200.432) (-3201.526) [-3193.567] -- 0:02:51 313000 -- (-3194.602) [-3200.345] (-3203.177) (-3203.329) * [-3198.222] (-3196.518) (-3199.996) (-3198.418) -- 0:02:51 313500 -- (-3197.927) (-3194.653) (-3203.777) [-3202.020] * [-3198.689] (-3201.727) (-3199.648) (-3194.143) -- 0:02:50 314000 -- (-3199.225) [-3202.088] (-3203.841) (-3201.874) * (-3197.887) [-3196.768] (-3201.887) (-3204.575) -- 0:02:52 314500 -- (-3196.385) (-3198.153) (-3201.493) [-3203.953] * (-3197.358) (-3197.433) [-3201.049] (-3200.619) -- 0:02:52 315000 -- (-3195.870) [-3198.477] (-3201.517) (-3201.223) * (-3202.372) (-3203.361) (-3196.510) [-3201.066] -- 0:02:51 Average standard deviation of split frequencies: 0.000746 315500 -- (-3198.773) (-3196.242) (-3201.224) [-3197.333] * [-3195.560] (-3192.376) (-3209.092) (-3201.213) -- 0:02:51 316000 -- (-3204.756) (-3197.706) [-3196.626] (-3199.772) * (-3200.667) [-3196.470] (-3200.568) (-3197.355) -- 0:02:51 316500 -- (-3200.076) (-3197.218) (-3199.727) [-3197.041] * (-3197.352) (-3199.954) (-3203.707) [-3201.111] -- 0:02:50 317000 -- [-3200.295] (-3199.359) (-3199.485) (-3196.437) * (-3198.783) [-3195.419] (-3203.417) (-3204.878) -- 0:02:50 317500 -- [-3200.220] (-3198.804) (-3192.952) (-3198.989) * [-3200.106] (-3199.551) (-3210.758) (-3196.570) -- 0:02:49 318000 -- (-3198.188) (-3197.775) (-3201.589) [-3201.595] * (-3198.376) (-3197.994) (-3201.225) [-3196.077] -- 0:02:51 318500 -- (-3201.891) [-3198.496] (-3201.247) (-3209.748) * (-3197.005) (-3195.230) (-3201.108) [-3197.570] -- 0:02:51 319000 -- (-3199.706) [-3195.891] (-3195.592) (-3210.650) * (-3199.380) (-3197.508) (-3195.588) [-3200.534] -- 0:02:50 319500 -- (-3197.773) [-3197.744] (-3203.096) (-3213.687) * [-3199.927] (-3201.706) (-3195.645) (-3195.750) -- 0:02:50 320000 -- (-3197.727) (-3201.955) [-3196.927] (-3210.313) * (-3203.440) (-3202.715) (-3196.002) [-3195.922] -- 0:02:50 Average standard deviation of split frequencies: 0.000735 320500 -- (-3197.162) (-3199.809) [-3199.502] (-3201.640) * (-3197.998) [-3198.316] (-3198.607) (-3200.425) -- 0:02:49 321000 -- (-3200.072) [-3197.501] (-3198.549) (-3198.851) * (-3194.540) [-3198.081] (-3201.105) (-3199.385) -- 0:02:49 321500 -- (-3199.470) (-3201.242) [-3196.831] (-3201.133) * [-3199.386] (-3197.937) (-3198.998) (-3203.231) -- 0:02:48 322000 -- (-3206.440) (-3205.827) (-3202.768) [-3198.072] * (-3200.548) (-3195.583) [-3193.620] (-3194.774) -- 0:02:50 322500 -- (-3204.330) [-3196.654] (-3204.086) (-3200.565) * (-3197.403) (-3196.778) [-3198.473] (-3198.717) -- 0:02:50 323000 -- (-3202.877) (-3199.402) (-3198.824) [-3199.657] * (-3199.568) (-3198.021) (-3196.641) [-3200.886] -- 0:02:49 323500 -- [-3198.263] (-3203.534) (-3198.640) (-3205.100) * [-3197.578] (-3200.903) (-3198.537) (-3201.050) -- 0:02:49 324000 -- [-3199.397] (-3195.605) (-3198.128) (-3199.378) * (-3203.813) (-3199.303) [-3200.441] (-3198.320) -- 0:02:49 324500 -- (-3197.009) (-3200.473) (-3197.799) [-3202.585] * (-3199.843) (-3202.417) [-3199.070] (-3201.343) -- 0:02:48 325000 -- [-3196.732] (-3204.776) (-3206.445) (-3200.195) * (-3207.196) [-3201.401] (-3204.584) (-3200.368) -- 0:02:48 Average standard deviation of split frequencies: 0.000723 325500 -- (-3196.554) (-3197.901) [-3193.502] (-3201.253) * [-3202.472] (-3197.333) (-3198.684) (-3201.513) -- 0:02:47 326000 -- (-3195.744) (-3203.892) [-3200.402] (-3198.611) * [-3198.016] (-3202.970) (-3204.841) (-3211.614) -- 0:02:49 326500 -- [-3199.816] (-3199.357) (-3197.398) (-3198.404) * [-3195.381] (-3195.784) (-3201.123) (-3207.941) -- 0:02:49 327000 -- (-3205.955) (-3199.433) (-3200.148) [-3194.169] * (-3202.970) (-3195.474) [-3200.197] (-3210.057) -- 0:02:48 327500 -- (-3199.444) (-3200.025) [-3200.954] (-3209.845) * (-3201.492) [-3199.558] (-3200.414) (-3199.498) -- 0:02:48 328000 -- (-3201.524) (-3198.711) [-3198.479] (-3199.875) * (-3201.789) [-3198.374] (-3206.225) (-3201.072) -- 0:02:48 328500 -- (-3204.301) (-3202.458) (-3203.242) [-3199.794] * (-3204.130) (-3198.744) (-3200.186) [-3202.612] -- 0:02:47 329000 -- (-3206.986) [-3197.564] (-3203.605) (-3201.679) * [-3198.070] (-3204.718) (-3205.444) (-3204.206) -- 0:02:47 329500 -- (-3211.033) (-3196.198) (-3198.803) [-3199.511] * (-3202.414) (-3197.865) (-3205.891) [-3203.862] -- 0:02:46 330000 -- (-3202.805) (-3198.894) (-3202.028) [-3202.371] * [-3198.160] (-3196.693) (-3205.713) (-3202.167) -- 0:02:48 Average standard deviation of split frequencies: 0.000713 330500 -- (-3202.891) (-3200.343) [-3199.115] (-3196.473) * (-3193.194) [-3202.104] (-3198.470) (-3213.613) -- 0:02:48 331000 -- (-3197.857) [-3202.866] (-3204.451) (-3195.135) * (-3198.053) (-3198.907) [-3197.783] (-3205.177) -- 0:02:47 331500 -- (-3199.122) [-3197.248] (-3200.200) (-3196.700) * [-3199.302] (-3200.359) (-3197.101) (-3206.653) -- 0:02:47 332000 -- (-3208.140) (-3202.436) (-3206.054) [-3196.099] * (-3197.607) (-3206.539) [-3202.188] (-3205.052) -- 0:02:47 332500 -- (-3202.246) (-3199.185) (-3202.789) [-3196.965] * (-3201.099) (-3198.443) [-3199.600] (-3200.249) -- 0:02:46 333000 -- (-3198.697) (-3199.241) (-3198.837) [-3200.423] * [-3196.882] (-3200.400) (-3196.569) (-3200.264) -- 0:02:46 333500 -- (-3199.262) (-3198.950) (-3198.953) [-3200.165] * (-3198.865) [-3203.978] (-3203.196) (-3197.300) -- 0:02:45 334000 -- (-3199.991) [-3196.784] (-3197.524) (-3202.224) * (-3202.582) (-3196.913) [-3194.369] (-3201.473) -- 0:02:45 334500 -- (-3197.350) [-3198.752] (-3196.153) (-3199.831) * (-3201.181) (-3200.830) [-3205.380] (-3204.143) -- 0:02:47 335000 -- (-3199.507) [-3198.040] (-3211.130) (-3198.120) * (-3199.630) (-3200.407) (-3196.888) [-3196.290] -- 0:02:46 Average standard deviation of split frequencies: 0.000701 335500 -- (-3200.471) [-3199.598] (-3200.145) (-3201.841) * (-3200.561) (-3197.831) (-3197.500) [-3193.765] -- 0:02:46 336000 -- (-3206.857) [-3201.392] (-3203.392) (-3203.262) * [-3203.270] (-3198.020) (-3198.580) (-3196.164) -- 0:02:46 336500 -- (-3199.740) [-3201.168] (-3200.992) (-3204.765) * (-3200.022) (-3205.896) [-3197.685] (-3197.472) -- 0:02:45 337000 -- (-3202.034) (-3197.976) [-3199.192] (-3198.761) * [-3202.722] (-3200.806) (-3199.684) (-3199.705) -- 0:02:45 337500 -- (-3202.301) (-3197.208) [-3200.705] (-3196.636) * (-3201.936) (-3200.188) (-3197.446) [-3199.527] -- 0:02:44 338000 -- [-3200.406] (-3201.615) (-3201.445) (-3198.102) * (-3200.407) (-3200.693) [-3192.118] (-3194.445) -- 0:02:44 338500 -- [-3199.380] (-3196.653) (-3200.466) (-3201.689) * [-3198.313] (-3201.102) (-3201.551) (-3195.401) -- 0:02:46 339000 -- [-3197.815] (-3202.287) (-3201.291) (-3200.385) * [-3200.940] (-3205.816) (-3195.965) (-3197.718) -- 0:02:45 339500 -- [-3196.025] (-3204.784) (-3203.409) (-3200.429) * (-3197.933) (-3206.733) (-3197.803) [-3198.677] -- 0:02:45 340000 -- [-3203.624] (-3199.110) (-3206.804) (-3197.826) * [-3199.675] (-3208.945) (-3199.009) (-3196.890) -- 0:02:45 Average standard deviation of split frequencies: 0.000692 340500 -- (-3197.412) (-3197.943) [-3199.563] (-3210.190) * (-3203.169) [-3199.327] (-3201.901) (-3196.983) -- 0:02:44 341000 -- (-3202.584) (-3193.692) [-3204.573] (-3200.368) * (-3199.809) (-3199.441) (-3199.044) [-3198.479] -- 0:02:44 341500 -- (-3192.899) [-3196.877] (-3201.154) (-3203.653) * [-3198.290] (-3202.036) (-3201.481) (-3202.763) -- 0:02:43 342000 -- (-3201.738) [-3199.402] (-3199.088) (-3206.424) * (-3195.595) [-3199.622] (-3196.086) (-3199.225) -- 0:02:43 342500 -- (-3201.775) (-3207.493) (-3199.108) [-3195.618] * (-3198.964) (-3198.047) [-3198.503] (-3199.461) -- 0:02:45 343000 -- [-3196.829] (-3201.965) (-3199.978) (-3200.732) * (-3199.634) [-3197.797] (-3201.713) (-3200.543) -- 0:02:44 343500 -- (-3200.976) (-3199.370) (-3198.363) [-3197.514] * [-3194.958] (-3203.358) (-3197.065) (-3193.859) -- 0:02:44 344000 -- [-3200.148] (-3205.468) (-3195.855) (-3203.097) * [-3195.777] (-3207.056) (-3202.086) (-3196.443) -- 0:02:44 344500 -- (-3200.642) [-3200.509] (-3198.815) (-3196.383) * [-3203.013] (-3199.063) (-3195.156) (-3204.035) -- 0:02:43 345000 -- [-3202.150] (-3198.169) (-3198.472) (-3201.263) * [-3202.374] (-3196.123) (-3202.501) (-3200.542) -- 0:02:43 Average standard deviation of split frequencies: 0.000681 345500 -- (-3201.825) [-3195.041] (-3200.763) (-3198.010) * (-3195.740) (-3195.554) [-3199.255] (-3207.136) -- 0:02:42 346000 -- (-3203.761) (-3201.048) [-3202.679] (-3196.398) * (-3201.086) (-3200.306) [-3206.926] (-3203.230) -- 0:02:42 346500 -- (-3201.153) (-3198.256) [-3199.122] (-3201.757) * (-3201.298) [-3203.352] (-3203.604) (-3199.966) -- 0:02:44 347000 -- (-3201.334) [-3198.426] (-3195.443) (-3201.220) * [-3198.524] (-3200.557) (-3204.096) (-3197.398) -- 0:02:43 347500 -- (-3197.871) (-3202.056) (-3195.120) [-3199.863] * (-3206.021) (-3201.930) (-3208.778) [-3198.531] -- 0:02:43 348000 -- (-3198.920) [-3201.756] (-3194.018) (-3203.233) * [-3199.930] (-3200.430) (-3200.407) (-3202.456) -- 0:02:43 348500 -- (-3202.119) (-3207.490) (-3197.404) [-3199.578] * (-3201.654) [-3199.180] (-3205.154) (-3210.686) -- 0:02:42 349000 -- (-3199.120) (-3200.052) (-3197.010) [-3200.825] * (-3200.052) (-3199.390) (-3198.555) [-3200.230] -- 0:02:42 349500 -- (-3197.113) [-3205.092] (-3197.916) (-3197.170) * (-3204.009) [-3197.626] (-3205.211) (-3200.543) -- 0:02:41 350000 -- [-3198.469] (-3192.195) (-3199.593) (-3202.395) * (-3199.404) (-3197.905) (-3196.556) [-3207.174] -- 0:02:41 Average standard deviation of split frequencies: 0.000672 350500 -- (-3199.982) (-3193.764) (-3209.224) [-3199.763] * (-3202.891) (-3198.701) [-3197.594] (-3198.784) -- 0:02:41 351000 -- (-3199.282) [-3195.858] (-3202.328) (-3201.676) * [-3197.342] (-3205.227) (-3195.861) (-3205.387) -- 0:02:42 351500 -- (-3194.639) [-3203.541] (-3206.655) (-3205.154) * [-3197.366] (-3210.624) (-3196.863) (-3202.240) -- 0:02:42 352000 -- (-3197.659) (-3202.388) (-3206.664) [-3202.782] * [-3197.735] (-3203.999) (-3196.312) (-3206.279) -- 0:02:42 352500 -- (-3197.550) [-3199.430] (-3204.510) (-3205.860) * [-3195.289] (-3199.995) (-3200.219) (-3201.119) -- 0:02:41 353000 -- (-3199.199) (-3202.774) [-3200.422] (-3199.544) * (-3196.695) (-3198.087) (-3198.211) [-3202.731] -- 0:02:41 353500 -- [-3201.672] (-3199.769) (-3202.077) (-3206.840) * [-3195.753] (-3201.592) (-3195.643) (-3201.885) -- 0:02:40 354000 -- [-3193.634] (-3202.840) (-3203.023) (-3202.534) * [-3194.716] (-3204.665) (-3198.624) (-3205.705) -- 0:02:40 354500 -- (-3202.466) (-3203.336) (-3200.340) [-3203.451] * [-3201.911] (-3199.432) (-3202.499) (-3214.280) -- 0:02:40 355000 -- (-3198.065) (-3195.232) [-3195.862] (-3205.276) * (-3202.101) (-3201.098) [-3197.267] (-3202.407) -- 0:02:41 Average standard deviation of split frequencies: 0.000662 355500 -- [-3198.458] (-3198.536) (-3198.723) (-3207.023) * [-3202.051] (-3205.702) (-3200.680) (-3207.574) -- 0:02:41 356000 -- (-3206.789) (-3200.875) (-3199.016) [-3201.817] * (-3195.797) (-3197.490) (-3203.336) [-3198.690] -- 0:02:41 356500 -- (-3193.233) (-3199.791) (-3197.286) [-3195.307] * (-3200.535) [-3194.701] (-3207.052) (-3204.101) -- 0:02:40 357000 -- (-3201.184) (-3202.088) [-3195.473] (-3200.720) * [-3197.137] (-3195.954) (-3200.006) (-3206.600) -- 0:02:40 357500 -- [-3195.385] (-3201.812) (-3201.495) (-3195.793) * (-3193.002) [-3198.392] (-3201.629) (-3200.165) -- 0:02:39 358000 -- (-3202.172) (-3196.315) (-3199.204) [-3197.783] * [-3194.816] (-3197.765) (-3200.109) (-3196.875) -- 0:02:39 358500 -- [-3201.174] (-3199.693) (-3199.924) (-3194.923) * (-3200.199) (-3204.494) [-3202.669] (-3195.712) -- 0:02:39 359000 -- (-3201.609) (-3196.085) (-3224.202) [-3200.058] * (-3196.487) (-3203.151) (-3197.825) [-3200.820] -- 0:02:40 359500 -- (-3198.928) (-3196.915) (-3205.655) [-3199.832] * [-3201.534] (-3198.905) (-3200.201) (-3198.985) -- 0:02:40 360000 -- (-3200.312) (-3202.991) [-3203.815] (-3203.145) * (-3199.727) (-3202.281) [-3201.278] (-3198.655) -- 0:02:40 Average standard deviation of split frequencies: 0.000654 360500 -- (-3201.679) (-3198.454) [-3195.093] (-3203.629) * [-3201.644] (-3194.363) (-3200.130) (-3196.818) -- 0:02:39 361000 -- (-3202.124) (-3200.191) (-3196.057) [-3198.893] * [-3201.612] (-3205.090) (-3200.124) (-3197.845) -- 0:02:39 361500 -- (-3202.816) [-3194.151] (-3201.863) (-3197.313) * (-3197.857) (-3212.752) (-3197.987) [-3204.122] -- 0:02:38 362000 -- (-3197.599) [-3200.398] (-3197.864) (-3205.194) * (-3198.348) (-3204.821) (-3200.701) [-3197.541] -- 0:02:38 362500 -- (-3205.352) (-3201.926) [-3203.580] (-3197.056) * (-3200.619) [-3200.780] (-3201.355) (-3197.365) -- 0:02:38 363000 -- (-3199.633) [-3201.656] (-3201.105) (-3201.359) * (-3196.708) (-3194.964) (-3200.229) [-3196.801] -- 0:02:39 363500 -- (-3203.405) [-3197.559] (-3200.264) (-3201.051) * (-3201.678) (-3194.673) (-3200.842) [-3195.900] -- 0:02:39 364000 -- [-3209.565] (-3198.899) (-3197.809) (-3199.175) * (-3203.144) [-3193.106] (-3202.674) (-3193.767) -- 0:02:39 364500 -- (-3207.794) [-3198.229] (-3195.393) (-3200.441) * (-3205.530) [-3198.239] (-3196.877) (-3195.305) -- 0:02:38 365000 -- [-3201.876] (-3204.050) (-3198.302) (-3197.270) * (-3197.252) (-3208.890) [-3199.376] (-3202.210) -- 0:02:38 Average standard deviation of split frequencies: 0.000644 365500 -- [-3203.255] (-3197.032) (-3198.564) (-3203.513) * (-3205.386) [-3198.663] (-3197.234) (-3199.898) -- 0:02:37 366000 -- (-3195.137) (-3202.048) (-3197.857) [-3202.703] * [-3200.236] (-3195.200) (-3195.989) (-3202.693) -- 0:02:37 366500 -- (-3204.945) [-3198.272] (-3200.772) (-3202.621) * (-3195.480) (-3198.329) (-3197.237) [-3200.185] -- 0:02:37 367000 -- [-3194.338] (-3195.745) (-3198.056) (-3200.269) * [-3194.305] (-3201.972) (-3198.636) (-3205.752) -- 0:02:36 367500 -- (-3199.357) [-3200.701] (-3198.133) (-3198.093) * (-3202.249) (-3202.354) [-3193.128] (-3201.714) -- 0:02:38 368000 -- (-3199.342) [-3201.429] (-3198.215) (-3198.312) * [-3198.521] (-3201.908) (-3196.364) (-3206.336) -- 0:02:38 368500 -- (-3197.624) (-3202.835) (-3198.077) [-3196.046] * (-3203.811) [-3198.865] (-3197.326) (-3201.624) -- 0:02:37 369000 -- [-3196.166] (-3198.374) (-3198.368) (-3204.370) * (-3198.067) (-3199.910) (-3199.310) [-3200.467] -- 0:02:37 369500 -- [-3199.729] (-3196.133) (-3202.462) (-3202.888) * (-3204.098) (-3199.357) (-3194.856) [-3208.581] -- 0:02:36 370000 -- (-3197.384) (-3195.774) (-3201.222) [-3196.331] * (-3200.688) [-3201.074] (-3195.457) (-3198.497) -- 0:02:36 Average standard deviation of split frequencies: 0.000636 370500 -- (-3195.010) (-3197.151) [-3195.053] (-3200.212) * [-3199.921] (-3197.293) (-3199.303) (-3199.609) -- 0:02:36 371000 -- (-3198.450) (-3195.436) (-3195.583) [-3198.768] * [-3196.140] (-3199.292) (-3203.007) (-3198.608) -- 0:02:35 371500 -- (-3210.008) (-3204.130) (-3197.101) [-3200.157] * (-3197.151) (-3204.052) [-3200.350] (-3201.999) -- 0:02:37 372000 -- [-3201.061] (-3197.710) (-3200.168) (-3205.934) * (-3201.305) [-3204.476] (-3201.527) (-3210.543) -- 0:02:37 372500 -- (-3195.710) (-3198.859) [-3204.704] (-3199.243) * (-3202.458) (-3201.860) [-3198.096] (-3200.963) -- 0:02:36 373000 -- (-3198.642) (-3203.560) (-3197.697) [-3197.623] * (-3194.113) [-3198.958] (-3202.004) (-3201.994) -- 0:02:36 373500 -- (-3206.942) (-3205.618) [-3194.897] (-3208.676) * (-3194.803) (-3205.192) [-3191.676] (-3207.948) -- 0:02:35 374000 -- (-3195.285) (-3203.437) (-3198.703) [-3198.108] * (-3201.309) (-3203.317) (-3200.312) [-3201.991] -- 0:02:35 374500 -- [-3204.796] (-3200.441) (-3205.176) (-3198.758) * (-3201.246) (-3195.299) [-3198.531] (-3197.398) -- 0:02:35 375000 -- (-3210.005) (-3196.031) (-3201.467) [-3200.009] * [-3196.481] (-3200.208) (-3200.046) (-3203.614) -- 0:02:35 Average standard deviation of split frequencies: 0.000627 375500 -- (-3202.440) (-3198.883) (-3195.431) [-3202.119] * (-3197.065) (-3198.647) (-3202.305) [-3200.452] -- 0:02:36 376000 -- (-3204.055) [-3205.118] (-3195.998) (-3203.229) * (-3199.838) (-3195.169) (-3195.193) [-3197.550] -- 0:02:36 376500 -- (-3194.406) (-3201.774) (-3200.723) [-3198.744] * (-3198.447) (-3196.055) (-3203.166) [-3197.056] -- 0:02:35 377000 -- [-3202.061] (-3199.018) (-3201.201) (-3202.493) * (-3196.099) (-3204.684) [-3202.812] (-3196.890) -- 0:02:35 377500 -- [-3200.273] (-3205.945) (-3199.377) (-3197.370) * (-3204.843) (-3202.394) (-3197.494) [-3201.252] -- 0:02:35 378000 -- (-3205.593) (-3197.130) [-3199.296] (-3201.094) * (-3201.714) (-3202.105) [-3198.772] (-3202.072) -- 0:02:34 378500 -- (-3198.674) (-3197.576) (-3203.824) [-3198.829] * (-3200.227) (-3203.306) (-3203.466) [-3202.861] -- 0:02:34 379000 -- (-3209.196) (-3202.802) [-3198.634] (-3210.224) * (-3204.930) (-3207.957) (-3201.123) [-3203.578] -- 0:02:34 379500 -- (-3193.310) (-3201.160) [-3198.516] (-3204.483) * [-3199.046] (-3207.466) (-3196.211) (-3196.480) -- 0:02:33 380000 -- (-3197.154) (-3202.886) [-3196.093] (-3198.845) * (-3201.390) (-3203.998) (-3199.881) [-3198.974] -- 0:02:35 Average standard deviation of split frequencies: 0.000619 380500 -- (-3198.385) (-3204.861) [-3196.500] (-3204.265) * [-3200.476] (-3205.561) (-3197.915) (-3203.972) -- 0:02:34 381000 -- [-3197.579] (-3196.761) (-3197.159) (-3201.258) * (-3197.580) (-3201.054) [-3199.792] (-3201.426) -- 0:02:34 381500 -- [-3203.743] (-3196.317) (-3197.479) (-3198.505) * (-3205.899) (-3203.755) [-3197.811] (-3197.869) -- 0:02:34 382000 -- (-3205.089) (-3194.481) (-3201.146) [-3204.806] * (-3202.317) (-3198.419) [-3196.176] (-3200.265) -- 0:02:33 382500 -- (-3195.633) [-3197.473] (-3203.867) (-3201.067) * (-3202.860) (-3205.068) [-3202.541] (-3198.733) -- 0:02:33 383000 -- [-3198.194] (-3200.606) (-3198.756) (-3196.786) * (-3205.008) [-3199.152] (-3210.056) (-3197.717) -- 0:02:33 383500 -- (-3196.774) (-3201.567) [-3203.108] (-3197.419) * (-3204.285) (-3196.149) [-3200.988] (-3198.420) -- 0:02:32 384000 -- (-3200.040) (-3195.110) (-3203.846) [-3202.203] * (-3201.754) (-3197.266) [-3196.981] (-3204.769) -- 0:02:34 384500 -- (-3196.903) [-3199.560] (-3204.847) (-3202.578) * [-3196.339] (-3211.540) (-3204.165) (-3204.860) -- 0:02:33 385000 -- (-3200.020) [-3197.851] (-3202.468) (-3202.708) * [-3199.705] (-3199.479) (-3206.530) (-3201.225) -- 0:02:33 Average standard deviation of split frequencies: 0.000611 385500 -- (-3204.011) (-3204.375) [-3199.467] (-3199.618) * (-3196.433) (-3204.673) [-3203.907] (-3199.267) -- 0:02:33 386000 -- [-3199.367] (-3204.742) (-3198.427) (-3198.218) * (-3195.405) (-3195.359) (-3208.538) [-3203.794] -- 0:02:32 386500 -- (-3193.881) [-3199.218] (-3196.414) (-3199.636) * (-3206.108) (-3199.726) [-3200.038] (-3195.130) -- 0:02:32 387000 -- (-3198.737) [-3202.742] (-3209.945) (-3195.747) * [-3207.132] (-3202.182) (-3195.466) (-3204.536) -- 0:02:32 387500 -- [-3194.775] (-3200.340) (-3200.120) (-3202.525) * (-3197.968) (-3204.062) (-3204.315) [-3201.413] -- 0:02:31 388000 -- (-3202.287) [-3202.594] (-3204.348) (-3205.745) * (-3194.920) (-3198.135) (-3205.820) [-3202.158] -- 0:02:33 388500 -- (-3201.119) (-3212.804) (-3203.076) [-3197.514] * (-3196.896) (-3203.167) (-3200.491) [-3202.493] -- 0:02:32 389000 -- (-3211.679) (-3203.109) [-3197.942] (-3199.428) * [-3206.837] (-3206.301) (-3198.794) (-3199.640) -- 0:02:32 389500 -- (-3195.930) (-3198.978) [-3200.029] (-3208.376) * (-3198.841) (-3198.964) (-3202.215) [-3198.905] -- 0:02:32 390000 -- (-3200.868) (-3198.189) (-3200.119) [-3198.209] * (-3202.625) (-3199.574) (-3197.799) [-3199.709] -- 0:02:31 Average standard deviation of split frequencies: 0.000603 390500 -- (-3196.131) [-3198.903] (-3207.058) (-3205.457) * [-3204.165] (-3197.355) (-3197.440) (-3197.316) -- 0:02:31 391000 -- [-3198.748] (-3201.411) (-3205.770) (-3208.340) * (-3196.489) (-3201.273) [-3204.460] (-3201.356) -- 0:02:31 391500 -- [-3196.051] (-3201.975) (-3206.262) (-3198.209) * (-3204.571) [-3200.617] (-3197.468) (-3195.784) -- 0:02:30 392000 -- (-3213.580) (-3199.810) (-3202.846) [-3198.883] * (-3202.653) [-3195.089] (-3197.453) (-3196.876) -- 0:02:32 392500 -- (-3206.032) (-3199.955) [-3206.683] (-3204.722) * (-3206.403) [-3201.102] (-3201.526) (-3199.091) -- 0:02:31 393000 -- [-3201.812] (-3201.343) (-3196.238) (-3202.533) * (-3207.820) (-3205.710) [-3199.934] (-3204.300) -- 0:02:31 393500 -- (-3209.465) [-3206.196] (-3199.009) (-3199.974) * (-3204.580) [-3197.600] (-3205.026) (-3198.203) -- 0:02:31 394000 -- (-3198.103) [-3210.172] (-3204.257) (-3202.578) * (-3203.783) (-3201.869) (-3203.849) [-3197.849] -- 0:02:30 394500 -- (-3198.083) (-3195.792) (-3201.597) [-3198.692] * (-3203.792) (-3200.203) (-3201.765) [-3201.381] -- 0:02:30 395000 -- (-3202.702) (-3208.258) (-3198.049) [-3205.332] * (-3202.250) (-3200.798) (-3196.075) [-3196.345] -- 0:02:30 Average standard deviation of split frequencies: 0.000595 395500 -- (-3198.955) (-3199.561) (-3209.499) [-3199.422] * (-3203.157) (-3198.918) [-3194.201] (-3198.004) -- 0:02:29 396000 -- (-3197.152) [-3197.409] (-3210.588) (-3208.762) * (-3209.029) (-3196.542) (-3197.235) [-3199.766] -- 0:02:29 396500 -- [-3198.697] (-3203.687) (-3199.728) (-3198.492) * (-3209.727) (-3199.967) (-3199.450) [-3199.706] -- 0:02:30 397000 -- (-3205.527) (-3203.062) [-3201.887] (-3199.261) * [-3205.358] (-3199.108) (-3201.195) (-3196.792) -- 0:02:30 397500 -- (-3201.786) (-3201.146) [-3202.611] (-3200.338) * (-3200.481) (-3199.949) [-3198.067] (-3198.752) -- 0:02:30 398000 -- (-3202.644) (-3202.664) (-3202.119) [-3196.766] * (-3200.023) [-3197.962] (-3201.798) (-3198.392) -- 0:02:29 398500 -- (-3195.765) (-3200.965) (-3198.738) [-3198.454] * [-3199.028] (-3202.058) (-3200.948) (-3201.297) -- 0:02:29 399000 -- (-3197.934) (-3205.254) (-3197.245) [-3197.299] * (-3208.678) [-3197.038] (-3204.301) (-3202.295) -- 0:02:29 399500 -- (-3205.849) [-3203.468] (-3196.314) (-3200.149) * (-3202.315) (-3194.482) [-3198.110] (-3197.612) -- 0:02:28 400000 -- (-3201.508) [-3202.007] (-3199.612) (-3197.689) * (-3197.052) [-3196.519] (-3198.476) (-3196.337) -- 0:02:28 Average standard deviation of split frequencies: 0.000588 400500 -- (-3200.898) [-3198.264] (-3197.432) (-3197.811) * (-3200.651) (-3210.561) (-3202.040) [-3197.559] -- 0:02:29 401000 -- [-3199.262] (-3199.721) (-3201.536) (-3195.225) * (-3192.586) (-3202.703) [-3195.840] (-3200.663) -- 0:02:29 401500 -- (-3198.124) (-3195.812) [-3196.007] (-3198.716) * (-3197.090) (-3201.372) [-3194.047] (-3199.902) -- 0:02:29 402000 -- (-3199.243) (-3206.913) (-3199.326) [-3201.227] * [-3201.818] (-3200.708) (-3201.301) (-3211.541) -- 0:02:28 402500 -- [-3193.191] (-3204.506) (-3199.868) (-3199.586) * [-3197.162] (-3193.621) (-3202.806) (-3193.772) -- 0:02:28 403000 -- [-3193.663] (-3197.550) (-3219.014) (-3208.170) * [-3199.249] (-3197.273) (-3199.276) (-3194.295) -- 0:02:28 403500 -- (-3202.665) (-3200.576) (-3201.111) [-3202.687] * (-3200.233) [-3196.919] (-3199.184) (-3203.247) -- 0:02:27 404000 -- [-3200.343] (-3206.566) (-3199.008) (-3201.145) * [-3197.209] (-3198.416) (-3200.828) (-3201.310) -- 0:02:27 404500 -- (-3196.082) (-3205.546) (-3204.813) [-3196.968] * (-3194.948) (-3198.529) [-3203.304] (-3195.321) -- 0:02:28 405000 -- [-3202.142] (-3197.776) (-3199.841) (-3197.719) * [-3195.232] (-3200.509) (-3205.923) (-3201.175) -- 0:02:28 Average standard deviation of split frequencies: 0.000581 405500 -- (-3196.060) (-3207.919) (-3200.300) [-3197.229] * [-3196.735] (-3199.216) (-3197.444) (-3199.376) -- 0:02:28 406000 -- [-3195.320] (-3201.798) (-3200.431) (-3201.401) * (-3196.669) (-3198.394) [-3195.479] (-3202.109) -- 0:02:27 406500 -- (-3197.927) [-3204.574] (-3195.673) (-3197.492) * (-3199.344) (-3204.566) [-3197.439] (-3206.315) -- 0:02:27 407000 -- (-3198.621) (-3201.117) [-3201.313] (-3196.665) * [-3197.564] (-3197.456) (-3203.656) (-3206.158) -- 0:02:27 407500 -- (-3199.753) (-3200.799) [-3202.702] (-3202.547) * [-3206.424] (-3209.128) (-3198.997) (-3197.989) -- 0:02:26 408000 -- (-3198.502) [-3197.210] (-3199.478) (-3201.893) * (-3202.965) [-3201.393] (-3198.241) (-3209.836) -- 0:02:26 408500 -- (-3208.451) [-3196.061] (-3209.196) (-3204.482) * (-3195.370) (-3195.420) [-3196.371] (-3220.411) -- 0:02:27 409000 -- (-3203.248) [-3198.138] (-3208.746) (-3204.214) * (-3199.588) (-3201.163) [-3197.389] (-3207.170) -- 0:02:27 409500 -- [-3197.198] (-3198.956) (-3199.692) (-3208.178) * (-3207.672) (-3202.170) (-3196.758) [-3200.057] -- 0:02:27 410000 -- (-3200.339) [-3200.882] (-3203.812) (-3207.356) * [-3201.934] (-3204.876) (-3200.830) (-3201.076) -- 0:02:26 Average standard deviation of split frequencies: 0.000574 410500 -- (-3203.535) (-3206.704) (-3209.009) [-3203.310] * [-3199.889] (-3201.344) (-3199.148) (-3203.124) -- 0:02:26 411000 -- (-3199.167) [-3204.130] (-3204.678) (-3211.512) * (-3208.240) (-3205.394) [-3197.097] (-3204.829) -- 0:02:26 411500 -- (-3195.119) (-3200.548) [-3194.145] (-3205.863) * (-3206.722) [-3199.425] (-3200.490) (-3200.396) -- 0:02:25 412000 -- (-3194.047) (-3201.550) [-3197.659] (-3202.004) * [-3199.651] (-3205.677) (-3202.070) (-3199.361) -- 0:02:25 412500 -- [-3196.802] (-3200.026) (-3202.827) (-3201.424) * (-3204.693) (-3200.181) [-3195.885] (-3196.879) -- 0:02:25 413000 -- (-3198.885) (-3197.482) [-3199.815] (-3196.931) * (-3200.625) [-3193.822] (-3197.988) (-3203.753) -- 0:02:26 413500 -- (-3195.701) [-3196.288] (-3201.292) (-3203.196) * (-3202.050) (-3201.496) [-3202.097] (-3199.618) -- 0:02:26 414000 -- (-3195.219) (-3201.203) [-3203.589] (-3197.110) * (-3198.792) [-3202.054] (-3205.270) (-3199.353) -- 0:02:25 414500 -- (-3195.439) (-3196.117) [-3197.955] (-3199.827) * [-3199.734] (-3200.799) (-3210.667) (-3201.223) -- 0:02:25 415000 -- (-3199.553) (-3197.570) [-3201.704] (-3207.052) * (-3214.080) [-3200.980] (-3203.602) (-3202.084) -- 0:02:25 Average standard deviation of split frequencies: 0.000567 415500 -- (-3200.563) (-3200.210) [-3196.474] (-3200.724) * (-3201.169) (-3196.519) (-3203.405) [-3207.360] -- 0:02:24 416000 -- [-3198.500] (-3205.622) (-3199.669) (-3199.416) * (-3197.821) [-3195.375] (-3201.389) (-3199.039) -- 0:02:24 416500 -- (-3196.558) [-3199.165] (-3202.606) (-3198.180) * (-3203.107) [-3193.350] (-3198.470) (-3195.867) -- 0:02:24 417000 -- (-3198.728) (-3196.230) [-3198.312] (-3201.844) * [-3198.580] (-3196.990) (-3200.321) (-3196.044) -- 0:02:25 417500 -- (-3194.760) (-3198.228) [-3196.654] (-3201.960) * (-3197.906) [-3194.198] (-3203.121) (-3197.712) -- 0:02:25 418000 -- (-3196.734) (-3198.533) [-3199.941] (-3201.926) * [-3197.138] (-3203.974) (-3198.509) (-3196.833) -- 0:02:24 418500 -- (-3196.579) (-3202.715) [-3197.520] (-3204.873) * (-3201.490) [-3197.951] (-3200.518) (-3197.295) -- 0:02:24 419000 -- (-3194.652) (-3203.496) [-3198.501] (-3196.619) * (-3202.444) (-3200.691) [-3198.540] (-3201.735) -- 0:02:24 419500 -- [-3196.433] (-3196.803) (-3198.730) (-3201.798) * (-3201.264) (-3199.943) [-3200.507] (-3200.795) -- 0:02:23 420000 -- (-3195.450) (-3208.560) (-3196.816) [-3198.298] * [-3199.827] (-3199.371) (-3196.904) (-3202.447) -- 0:02:23 Average standard deviation of split frequencies: 0.000560 420500 -- (-3200.340) (-3204.768) (-3193.237) [-3202.233] * [-3206.025] (-3199.708) (-3200.189) (-3201.786) -- 0:02:23 421000 -- (-3201.198) (-3201.110) [-3204.219] (-3197.334) * (-3204.177) (-3200.951) [-3198.821] (-3209.394) -- 0:02:24 421500 -- (-3199.913) [-3199.455] (-3196.886) (-3202.582) * (-3212.077) [-3198.941] (-3198.576) (-3200.735) -- 0:02:24 422000 -- (-3206.156) [-3203.366] (-3195.022) (-3198.138) * [-3207.325] (-3195.540) (-3198.073) (-3202.505) -- 0:02:23 422500 -- (-3200.906) (-3196.230) (-3200.560) [-3194.278] * (-3209.531) [-3195.307] (-3201.258) (-3198.225) -- 0:02:23 423000 -- (-3212.214) [-3196.389] (-3200.904) (-3198.707) * (-3198.963) [-3200.980] (-3199.303) (-3202.951) -- 0:02:23 423500 -- (-3199.959) (-3208.196) [-3202.625] (-3201.911) * (-3198.104) (-3206.481) [-3206.882] (-3200.240) -- 0:02:22 424000 -- (-3199.399) (-3199.059) [-3195.647] (-3199.067) * (-3205.300) (-3213.036) (-3202.113) [-3198.159] -- 0:02:22 424500 -- (-3212.004) [-3199.678] (-3205.093) (-3197.937) * [-3201.398] (-3213.330) (-3195.955) (-3199.332) -- 0:02:22 425000 -- [-3203.503] (-3196.427) (-3204.134) (-3195.446) * [-3208.096] (-3201.771) (-3201.446) (-3199.106) -- 0:02:23 Average standard deviation of split frequencies: 0.000553 425500 -- (-3200.656) [-3194.093] (-3208.462) (-3199.784) * [-3196.657] (-3200.140) (-3197.283) (-3195.271) -- 0:02:23 426000 -- (-3198.395) (-3201.158) [-3198.091] (-3217.061) * [-3193.431] (-3203.335) (-3195.629) (-3198.437) -- 0:02:22 426500 -- [-3200.159] (-3212.992) (-3204.001) (-3208.994) * [-3197.841] (-3203.110) (-3199.473) (-3202.088) -- 0:02:22 427000 -- [-3195.510] (-3198.066) (-3204.803) (-3199.844) * (-3201.503) (-3199.950) [-3197.705] (-3199.518) -- 0:02:22 427500 -- (-3199.132) [-3196.508] (-3201.995) (-3205.377) * (-3198.294) [-3191.048] (-3199.095) (-3203.333) -- 0:02:21 428000 -- (-3203.462) (-3199.289) (-3193.033) [-3198.947] * (-3201.263) (-3196.449) (-3201.740) [-3199.170] -- 0:02:21 428500 -- (-3205.947) (-3206.007) (-3196.768) [-3201.535] * (-3195.572) (-3202.611) [-3196.384] (-3202.777) -- 0:02:21 429000 -- (-3206.668) (-3201.067) (-3208.309) [-3197.505] * [-3199.461] (-3200.234) (-3197.375) (-3206.709) -- 0:02:21 429500 -- (-3197.007) (-3206.530) [-3197.122] (-3201.133) * (-3211.513) (-3198.850) (-3203.861) [-3198.669] -- 0:02:22 430000 -- [-3200.441] (-3203.911) (-3195.150) (-3204.688) * [-3199.702] (-3197.935) (-3197.868) (-3195.532) -- 0:02:21 Average standard deviation of split frequencies: 0.000547 430500 -- (-3199.333) (-3210.098) (-3197.264) [-3204.317] * (-3206.678) [-3203.326] (-3202.657) (-3201.426) -- 0:02:21 431000 -- [-3202.568] (-3195.230) (-3203.744) (-3204.221) * (-3195.941) (-3195.998) (-3200.540) [-3201.823] -- 0:02:21 431500 -- (-3201.603) [-3196.292] (-3200.686) (-3196.076) * (-3197.179) (-3193.994) (-3208.027) [-3195.991] -- 0:02:20 432000 -- (-3202.712) (-3203.817) (-3201.732) [-3197.174] * (-3197.829) (-3199.171) (-3211.957) [-3199.554] -- 0:02:20 432500 -- (-3201.085) (-3203.200) [-3201.726] (-3197.141) * (-3202.344) (-3203.594) (-3202.605) [-3202.217] -- 0:02:20 433000 -- (-3198.932) (-3200.324) (-3196.783) [-3200.292] * [-3198.475] (-3195.839) (-3203.354) (-3203.925) -- 0:02:20 433500 -- (-3210.593) (-3199.113) (-3200.909) [-3200.504] * (-3199.458) [-3199.269] (-3207.347) (-3196.881) -- 0:02:21 434000 -- (-3213.678) (-3201.476) [-3196.513] (-3194.175) * (-3200.743) (-3201.027) (-3197.083) [-3201.153] -- 0:02:20 434500 -- (-3209.082) (-3196.700) [-3196.554] (-3199.122) * (-3203.142) [-3197.083] (-3198.122) (-3200.278) -- 0:02:20 435000 -- (-3203.070) (-3202.084) (-3197.004) [-3211.734] * (-3205.303) (-3200.114) [-3199.302] (-3199.085) -- 0:02:20 Average standard deviation of split frequencies: 0.001081 435500 -- (-3202.046) [-3199.211] (-3200.268) (-3207.625) * (-3197.581) (-3202.122) [-3194.834] (-3198.200) -- 0:02:19 436000 -- [-3198.320] (-3199.466) (-3200.802) (-3203.981) * (-3198.554) (-3199.479) [-3196.297] (-3199.035) -- 0:02:19 436500 -- (-3202.288) (-3196.959) [-3201.727] (-3199.372) * (-3198.678) (-3205.863) [-3205.034] (-3198.167) -- 0:02:19 437000 -- [-3200.520] (-3201.051) (-3206.172) (-3202.994) * (-3195.050) (-3199.279) (-3211.520) [-3194.768] -- 0:02:19 437500 -- (-3203.639) (-3201.727) (-3214.405) [-3203.212] * (-3200.691) (-3202.912) (-3201.327) [-3202.415] -- 0:02:20 438000 -- [-3204.251] (-3200.355) (-3196.692) (-3201.826) * (-3217.207) [-3195.287] (-3207.132) (-3200.817) -- 0:02:19 438500 -- (-3201.898) (-3201.657) [-3193.330] (-3201.008) * (-3202.349) (-3198.314) [-3199.645] (-3198.677) -- 0:02:19 439000 -- (-3199.930) [-3203.513] (-3201.091) (-3195.065) * (-3202.563) [-3200.674] (-3200.499) (-3196.502) -- 0:02:19 439500 -- [-3198.583] (-3203.231) (-3196.354) (-3197.175) * (-3201.080) (-3199.047) [-3197.584] (-3200.890) -- 0:02:19 440000 -- [-3199.020] (-3198.661) (-3203.548) (-3207.112) * (-3197.803) [-3204.908] (-3198.486) (-3200.447) -- 0:02:18 Average standard deviation of split frequencies: 0.001070 440500 -- (-3200.367) (-3199.654) (-3199.622) [-3204.097] * (-3198.991) (-3203.407) (-3195.883) [-3206.697] -- 0:02:18 441000 -- (-3199.018) [-3196.374] (-3207.455) (-3198.056) * (-3205.414) (-3199.776) (-3197.596) [-3200.957] -- 0:02:18 441500 -- (-3201.839) (-3199.560) (-3198.592) [-3194.872] * [-3197.695] (-3204.129) (-3203.761) (-3203.536) -- 0:02:19 442000 -- (-3196.997) (-3196.672) (-3199.600) [-3199.015] * (-3204.490) (-3201.764) (-3196.219) [-3203.221] -- 0:02:18 442500 -- [-3198.169] (-3200.305) (-3200.023) (-3199.103) * (-3198.863) (-3197.082) [-3196.584] (-3198.577) -- 0:02:18 443000 -- (-3198.392) (-3194.355) (-3202.505) [-3194.496] * (-3196.361) (-3198.289) (-3198.463) [-3207.176] -- 0:02:18 443500 -- (-3201.910) (-3204.971) [-3198.542] (-3199.160) * (-3201.411) (-3202.482) [-3200.906] (-3204.333) -- 0:02:18 444000 -- [-3197.058] (-3201.707) (-3194.199) (-3198.699) * (-3197.016) [-3201.418] (-3201.453) (-3209.755) -- 0:02:17 444500 -- (-3200.961) (-3205.041) (-3196.809) [-3199.353] * (-3203.070) (-3196.048) [-3198.349] (-3209.003) -- 0:02:17 445000 -- [-3197.783] (-3204.180) (-3196.821) (-3201.461) * (-3203.825) (-3195.865) [-3196.579] (-3209.338) -- 0:02:17 Average standard deviation of split frequencies: 0.001057 445500 -- (-3205.141) [-3200.675] (-3199.210) (-3205.371) * (-3195.792) (-3196.986) [-3199.959] (-3206.325) -- 0:02:16 446000 -- (-3209.239) (-3195.379) [-3202.829] (-3206.637) * (-3200.091) [-3200.614] (-3199.306) (-3206.532) -- 0:02:17 446500 -- [-3199.605] (-3196.896) (-3201.657) (-3197.758) * (-3207.252) (-3201.965) [-3207.254] (-3198.731) -- 0:02:17 447000 -- (-3205.434) (-3199.962) (-3199.624) [-3198.786] * [-3196.274] (-3193.882) (-3205.322) (-3202.574) -- 0:02:17 447500 -- (-3199.048) (-3197.534) [-3198.808] (-3199.608) * (-3197.347) [-3205.661] (-3200.151) (-3202.523) -- 0:02:17 448000 -- (-3201.566) (-3203.573) [-3200.330] (-3200.201) * (-3207.520) (-3197.341) (-3197.749) [-3202.396] -- 0:02:16 448500 -- (-3200.653) (-3201.087) (-3202.260) [-3200.673] * (-3198.131) (-3194.687) (-3195.851) [-3202.454] -- 0:02:16 449000 -- [-3200.842] (-3202.935) (-3205.865) (-3201.967) * (-3202.877) [-3195.988] (-3199.714) (-3200.535) -- 0:02:16 449500 -- (-3198.199) (-3204.220) (-3199.792) [-3197.696] * (-3199.457) (-3197.059) (-3196.733) [-3201.115] -- 0:02:15 450000 -- (-3200.365) [-3205.479] (-3196.676) (-3200.827) * [-3195.585] (-3207.277) (-3205.372) (-3197.897) -- 0:02:16 Average standard deviation of split frequencies: 0.001046 450500 -- (-3207.945) (-3199.436) [-3200.478] (-3199.628) * (-3199.482) (-3191.350) [-3201.480] (-3205.350) -- 0:02:16 451000 -- [-3199.985] (-3198.708) (-3199.149) (-3203.714) * (-3205.670) (-3194.760) [-3200.056] (-3200.051) -- 0:02:16 451500 -- (-3199.211) [-3200.250] (-3202.908) (-3198.277) * (-3207.397) (-3195.710) (-3199.112) [-3197.302] -- 0:02:16 452000 -- (-3198.469) [-3197.571] (-3207.524) (-3197.272) * (-3208.363) (-3200.644) [-3203.090] (-3200.999) -- 0:02:15 452500 -- (-3201.813) [-3196.931] (-3199.242) (-3198.334) * [-3201.367] (-3208.084) (-3195.001) (-3197.563) -- 0:02:15 453000 -- [-3199.990] (-3196.612) (-3202.042) (-3194.075) * (-3206.097) (-3200.723) [-3204.038] (-3199.172) -- 0:02:15 453500 -- (-3202.291) [-3195.964] (-3211.653) (-3196.835) * (-3207.127) [-3200.816] (-3201.113) (-3200.416) -- 0:02:14 454000 -- (-3201.762) (-3199.011) [-3199.491] (-3202.036) * (-3197.910) [-3197.145] (-3199.780) (-3197.079) -- 0:02:15 454500 -- (-3200.122) (-3197.665) [-3196.951] (-3197.858) * (-3198.292) [-3201.336] (-3199.108) (-3196.965) -- 0:02:15 455000 -- (-3202.317) (-3203.467) [-3201.099] (-3197.849) * (-3202.455) [-3202.220] (-3208.059) (-3198.579) -- 0:02:15 Average standard deviation of split frequencies: 0.001034 455500 -- [-3199.720] (-3199.778) (-3199.954) (-3201.782) * (-3199.253) (-3202.281) (-3198.159) [-3205.700] -- 0:02:15 456000 -- [-3200.019] (-3203.116) (-3201.111) (-3204.390) * [-3200.177] (-3202.191) (-3202.272) (-3200.733) -- 0:02:14 456500 -- [-3199.129] (-3196.054) (-3200.694) (-3198.582) * (-3200.582) [-3197.330] (-3198.639) (-3198.624) -- 0:02:14 457000 -- (-3198.528) (-3203.454) [-3198.438] (-3198.356) * (-3197.512) (-3200.589) [-3198.712] (-3205.604) -- 0:02:14 457500 -- (-3203.099) [-3198.552] (-3193.969) (-3204.443) * [-3195.212] (-3202.071) (-3196.229) (-3202.373) -- 0:02:13 458000 -- (-3201.732) (-3202.299) [-3202.136] (-3202.876) * (-3201.970) [-3201.127] (-3194.017) (-3201.145) -- 0:02:14 458500 -- (-3200.437) (-3200.389) [-3200.068] (-3205.881) * (-3202.312) (-3201.146) [-3197.630] (-3205.988) -- 0:02:14 459000 -- (-3200.147) [-3194.132] (-3199.856) (-3199.657) * [-3195.602] (-3200.249) (-3205.682) (-3197.811) -- 0:02:14 459500 -- [-3199.474] (-3205.401) (-3203.991) (-3200.973) * (-3195.871) (-3202.308) [-3197.941] (-3196.835) -- 0:02:14 460000 -- [-3193.075] (-3201.251) (-3199.784) (-3200.413) * [-3194.843] (-3196.999) (-3196.049) (-3199.258) -- 0:02:13 Average standard deviation of split frequencies: 0.001023 460500 -- (-3197.736) (-3203.555) (-3196.387) [-3197.261] * (-3198.041) [-3197.068] (-3195.245) (-3197.046) -- 0:02:13 461000 -- (-3203.183) (-3199.471) (-3197.592) [-3198.023] * (-3201.349) [-3199.422] (-3197.830) (-3195.673) -- 0:02:13 461500 -- (-3211.106) (-3200.735) (-3203.789) [-3197.647] * [-3196.267] (-3198.113) (-3195.683) (-3198.746) -- 0:02:13 462000 -- (-3204.937) (-3203.249) [-3200.691] (-3200.422) * (-3199.381) (-3206.366) [-3202.627] (-3200.381) -- 0:02:12 462500 -- (-3206.406) (-3206.672) (-3202.418) [-3198.379] * (-3199.351) (-3200.261) [-3197.562] (-3200.745) -- 0:02:13 463000 -- (-3201.320) [-3200.394] (-3201.299) (-3196.612) * (-3194.860) (-3198.250) [-3195.140] (-3200.139) -- 0:02:13 463500 -- (-3194.502) (-3196.709) (-3206.906) [-3198.881] * [-3193.200] (-3211.163) (-3200.916) (-3196.212) -- 0:02:13 464000 -- [-3197.726] (-3202.891) (-3206.702) (-3194.530) * (-3201.644) (-3200.083) (-3209.192) [-3196.715] -- 0:02:12 464500 -- (-3202.208) (-3203.477) (-3206.779) [-3198.267] * [-3203.490] (-3196.950) (-3197.859) (-3200.279) -- 0:02:12 465000 -- (-3201.179) (-3194.685) (-3197.052) [-3193.225] * (-3199.605) (-3199.129) [-3196.719] (-3197.785) -- 0:02:12 Average standard deviation of split frequencies: 0.001012 465500 -- (-3203.210) (-3199.022) (-3201.171) [-3199.028] * [-3198.198] (-3205.757) (-3203.843) (-3205.021) -- 0:02:12 466000 -- (-3204.668) (-3205.488) (-3199.271) [-3198.166] * (-3194.271) [-3194.597] (-3203.040) (-3212.072) -- 0:02:11 466500 -- (-3198.390) (-3198.408) (-3204.306) [-3195.932] * [-3199.304] (-3200.274) (-3198.564) (-3198.331) -- 0:02:12 467000 -- (-3202.529) [-3200.366] (-3199.865) (-3203.203) * (-3198.976) [-3199.800] (-3206.319) (-3199.120) -- 0:02:12 467500 -- [-3201.253] (-3196.460) (-3198.592) (-3199.389) * (-3198.497) [-3200.755] (-3198.800) (-3201.418) -- 0:02:12 468000 -- (-3195.165) (-3198.187) [-3195.767] (-3200.453) * [-3196.495] (-3194.865) (-3200.756) (-3199.757) -- 0:02:11 468500 -- [-3196.417] (-3195.105) (-3200.676) (-3197.371) * (-3201.846) [-3203.989] (-3204.836) (-3198.769) -- 0:02:11 469000 -- (-3196.564) (-3199.972) (-3202.525) [-3197.552] * (-3197.563) (-3197.169) (-3197.950) [-3201.178] -- 0:02:11 469500 -- (-3197.841) (-3199.113) (-3207.607) [-3200.840] * (-3195.219) [-3206.739] (-3202.833) (-3201.568) -- 0:02:11 470000 -- (-3202.951) [-3199.026] (-3210.175) (-3199.332) * (-3205.828) (-3203.478) [-3199.995] (-3197.588) -- 0:02:10 Average standard deviation of split frequencies: 0.001002 470500 -- (-3209.803) [-3197.793] (-3206.601) (-3205.304) * (-3205.755) [-3197.805] (-3197.588) (-3199.420) -- 0:02:11 471000 -- [-3204.156] (-3201.721) (-3201.518) (-3196.583) * [-3202.155] (-3200.612) (-3198.769) (-3203.748) -- 0:02:11 471500 -- (-3197.486) (-3200.675) [-3196.897] (-3196.394) * (-3200.811) (-3199.228) [-3194.277] (-3201.280) -- 0:02:11 472000 -- (-3194.618) [-3200.524] (-3205.794) (-3199.527) * (-3198.131) (-3199.971) [-3195.544] (-3201.876) -- 0:02:10 472500 -- [-3197.986] (-3200.875) (-3195.599) (-3199.631) * [-3202.636] (-3198.848) (-3194.561) (-3204.762) -- 0:02:10 473000 -- [-3199.296] (-3203.332) (-3199.873) (-3195.098) * (-3197.963) [-3199.326] (-3198.888) (-3198.605) -- 0:02:10 473500 -- (-3204.914) (-3199.257) (-3196.278) [-3197.225] * [-3197.795] (-3201.982) (-3197.965) (-3199.846) -- 0:02:10 474000 -- (-3200.562) (-3206.729) [-3193.936] (-3202.130) * (-3198.254) [-3207.285] (-3201.254) (-3200.794) -- 0:02:09 474500 -- [-3201.006] (-3207.497) (-3199.153) (-3200.108) * (-3198.677) [-3203.436] (-3202.416) (-3202.812) -- 0:02:10 475000 -- (-3209.848) [-3197.822] (-3200.293) (-3199.570) * (-3199.743) [-3203.171] (-3195.218) (-3201.704) -- 0:02:10 Average standard deviation of split frequencies: 0.000990 475500 -- [-3205.624] (-3201.663) (-3200.468) (-3205.188) * [-3196.727] (-3203.396) (-3196.677) (-3200.511) -- 0:02:10 476000 -- [-3202.726] (-3202.143) (-3206.175) (-3200.875) * (-3198.157) (-3206.003) (-3201.428) [-3198.641] -- 0:02:09 476500 -- (-3202.881) (-3211.012) (-3197.670) [-3201.862] * (-3197.791) (-3198.350) [-3200.151] (-3199.263) -- 0:02:09 477000 -- (-3202.308) (-3198.932) (-3204.885) [-3197.957] * [-3200.101] (-3203.185) (-3199.709) (-3201.283) -- 0:02:09 477500 -- [-3201.187] (-3198.432) (-3197.819) (-3194.140) * (-3200.157) (-3196.302) [-3198.093] (-3202.965) -- 0:02:09 478000 -- [-3202.313] (-3201.136) (-3198.396) (-3201.781) * (-3201.803) (-3197.703) [-3197.655] (-3197.318) -- 0:02:08 478500 -- (-3207.239) (-3195.365) (-3195.501) [-3199.688] * (-3196.275) (-3198.452) [-3196.053] (-3197.731) -- 0:02:09 479000 -- (-3202.620) [-3198.287] (-3197.663) (-3204.261) * (-3196.208) (-3211.310) (-3200.634) [-3202.622] -- 0:02:09 479500 -- [-3202.586] (-3196.229) (-3212.036) (-3199.256) * (-3196.938) (-3206.677) [-3197.984] (-3200.702) -- 0:02:09 480000 -- [-3195.747] (-3197.609) (-3200.755) (-3199.151) * (-3197.957) (-3199.624) [-3200.146] (-3204.151) -- 0:02:08 Average standard deviation of split frequencies: 0.000981 480500 -- (-3201.315) (-3198.724) [-3203.174] (-3197.992) * (-3199.873) [-3199.810] (-3204.048) (-3202.302) -- 0:02:08 481000 -- [-3204.732] (-3198.724) (-3200.710) (-3195.162) * (-3199.129) (-3198.825) [-3197.952] (-3204.725) -- 0:02:08 481500 -- [-3199.905] (-3206.645) (-3193.335) (-3197.738) * [-3200.741] (-3203.771) (-3200.060) (-3204.478) -- 0:02:08 482000 -- (-3201.373) (-3200.290) [-3198.868] (-3194.798) * [-3198.394] (-3200.993) (-3204.123) (-3204.423) -- 0:02:07 482500 -- (-3194.818) (-3197.777) [-3201.161] (-3197.906) * (-3198.251) (-3201.162) [-3201.357] (-3201.901) -- 0:02:08 483000 -- (-3192.783) [-3201.172] (-3194.818) (-3198.504) * (-3196.019) (-3210.317) (-3199.563) [-3198.028] -- 0:02:08 483500 -- [-3192.414] (-3200.906) (-3196.778) (-3201.955) * (-3199.673) (-3200.503) [-3201.756] (-3197.319) -- 0:02:08 484000 -- (-3195.636) [-3198.656] (-3204.453) (-3197.716) * (-3197.003) [-3195.978] (-3202.491) (-3198.727) -- 0:02:07 484500 -- (-3198.609) (-3198.323) [-3197.161] (-3205.142) * (-3199.630) [-3198.063] (-3208.073) (-3194.852) -- 0:02:07 485000 -- (-3206.263) [-3198.019] (-3202.735) (-3195.493) * (-3201.686) [-3201.839] (-3218.718) (-3205.018) -- 0:02:07 Average standard deviation of split frequencies: 0.000970 485500 -- (-3198.743) (-3201.520) [-3201.645] (-3199.596) * (-3199.763) (-3202.513) (-3207.689) [-3197.263] -- 0:02:07 486000 -- (-3198.280) (-3197.426) (-3200.345) [-3198.310] * (-3203.612) [-3198.475] (-3213.320) (-3196.746) -- 0:02:06 486500 -- (-3203.036) (-3204.066) (-3201.734) [-3194.843] * (-3202.251) [-3198.947] (-3214.359) (-3197.296) -- 0:02:06 487000 -- (-3199.216) [-3202.455] (-3195.186) (-3204.439) * (-3204.901) (-3199.642) (-3202.386) [-3202.384] -- 0:02:07 487500 -- [-3198.131] (-3198.781) (-3200.606) (-3200.235) * (-3196.614) [-3195.782] (-3198.898) (-3206.349) -- 0:02:07 488000 -- [-3197.951] (-3202.511) (-3198.569) (-3201.705) * (-3203.864) (-3200.401) [-3198.152] (-3199.215) -- 0:02:06 488500 -- [-3206.955] (-3206.533) (-3198.485) (-3197.462) * [-3203.927] (-3198.545) (-3202.185) (-3198.818) -- 0:02:06 489000 -- [-3206.103] (-3203.019) (-3198.101) (-3204.004) * (-3197.857) (-3198.635) (-3203.250) [-3195.106] -- 0:02:06 489500 -- [-3200.058] (-3199.256) (-3206.200) (-3209.234) * [-3198.143] (-3203.898) (-3206.609) (-3195.637) -- 0:02:06 490000 -- (-3198.780) [-3196.437] (-3200.495) (-3200.943) * (-3202.067) [-3201.261] (-3199.331) (-3209.777) -- 0:02:05 Average standard deviation of split frequencies: 0.000961 490500 -- [-3202.629] (-3201.045) (-3199.737) (-3200.305) * [-3200.023] (-3201.019) (-3200.473) (-3200.449) -- 0:02:05 491000 -- [-3198.694] (-3197.120) (-3198.174) (-3204.212) * (-3197.440) (-3203.294) [-3197.283] (-3207.676) -- 0:02:06 491500 -- [-3197.349] (-3199.456) (-3205.944) (-3203.395) * (-3195.204) [-3196.494] (-3200.722) (-3196.937) -- 0:02:06 492000 -- [-3198.812] (-3200.319) (-3216.020) (-3198.397) * (-3198.831) (-3204.759) (-3205.032) [-3195.559] -- 0:02:05 492500 -- (-3200.915) [-3202.413] (-3207.699) (-3198.280) * (-3200.204) (-3195.230) (-3196.187) [-3192.348] -- 0:02:05 493000 -- (-3201.511) [-3197.023] (-3201.210) (-3202.048) * (-3200.927) (-3198.551) (-3201.433) [-3195.944] -- 0:02:05 493500 -- (-3197.434) [-3194.536] (-3200.452) (-3198.693) * (-3202.636) (-3199.674) (-3201.313) [-3199.112] -- 0:02:05 494000 -- (-3200.339) [-3197.757] (-3200.287) (-3203.795) * (-3199.188) [-3194.903] (-3200.259) (-3202.530) -- 0:02:04 494500 -- [-3208.563] (-3202.372) (-3195.016) (-3201.112) * (-3198.661) [-3200.421] (-3198.404) (-3198.012) -- 0:02:04 495000 -- (-3207.027) [-3206.730] (-3205.992) (-3202.427) * (-3193.665) [-3198.710] (-3195.889) (-3195.962) -- 0:02:05 Average standard deviation of split frequencies: 0.000950 495500 -- (-3208.905) (-3200.898) [-3211.040] (-3198.484) * (-3195.960) (-3202.876) [-3193.942] (-3200.681) -- 0:02:05 496000 -- (-3206.018) (-3199.546) (-3201.457) [-3196.428] * [-3198.579] (-3197.339) (-3208.081) (-3199.885) -- 0:02:04 496500 -- (-3207.328) [-3199.355] (-3199.806) (-3205.716) * (-3201.958) [-3193.852] (-3209.447) (-3205.693) -- 0:02:04 497000 -- [-3198.933] (-3201.417) (-3201.855) (-3193.975) * (-3202.162) [-3203.658] (-3206.713) (-3204.318) -- 0:02:04 497500 -- (-3205.515) (-3202.626) (-3198.226) [-3197.777] * (-3196.973) [-3202.243] (-3208.520) (-3204.160) -- 0:02:04 498000 -- [-3197.323] (-3212.594) (-3193.786) (-3204.273) * (-3202.723) (-3196.114) (-3206.355) [-3201.436] -- 0:02:03 498500 -- [-3205.005] (-3203.377) (-3204.044) (-3200.895) * (-3198.394) (-3202.195) (-3213.802) [-3193.968] -- 0:02:03 499000 -- (-3199.459) (-3202.219) [-3201.599] (-3211.311) * (-3205.864) (-3194.610) (-3201.440) [-3202.539] -- 0:02:03 499500 -- (-3200.472) (-3210.456) [-3195.415] (-3212.052) * (-3201.762) [-3198.681] (-3194.547) (-3201.729) -- 0:02:04 500000 -- (-3206.227) (-3200.339) [-3198.621] (-3204.614) * (-3196.840) (-3200.506) (-3199.934) [-3204.714] -- 0:02:04 Average standard deviation of split frequencies: 0.000942 500500 -- [-3204.647] (-3200.328) (-3202.590) (-3201.851) * (-3202.945) (-3202.491) (-3200.131) [-3195.491] -- 0:02:03 501000 -- (-3202.951) (-3199.115) [-3197.061] (-3204.837) * (-3198.709) (-3202.825) [-3197.925] (-3205.846) -- 0:02:03 501500 -- (-3196.759) (-3206.260) [-3201.276] (-3205.660) * [-3196.807] (-3199.078) (-3205.605) (-3201.918) -- 0:02:03 502000 -- (-3197.580) (-3203.146) (-3197.316) [-3207.024] * (-3197.944) (-3202.172) (-3204.779) [-3199.326] -- 0:02:03 502500 -- [-3194.436] (-3201.209) (-3199.142) (-3205.879) * (-3199.909) (-3201.214) (-3212.720) [-3201.096] -- 0:02:02 503000 -- (-3198.714) (-3204.313) [-3202.606] (-3199.865) * (-3205.063) (-3199.891) (-3202.246) [-3202.533] -- 0:02:02 503500 -- (-3199.009) [-3204.311] (-3200.989) (-3199.878) * (-3200.960) (-3195.947) (-3200.138) [-3194.584] -- 0:02:03 504000 -- (-3206.290) (-3196.301) [-3201.621] (-3201.255) * (-3204.839) (-3201.522) (-3202.260) [-3196.427] -- 0:02:03 504500 -- (-3206.796) [-3204.232] (-3198.163) (-3202.302) * (-3196.165) [-3195.718] (-3200.285) (-3202.197) -- 0:02:02 505000 -- (-3198.524) [-3193.648] (-3201.703) (-3196.847) * (-3201.733) (-3203.151) (-3197.507) [-3198.005] -- 0:02:02 Average standard deviation of split frequencies: 0.000932 505500 -- (-3195.083) (-3203.070) [-3194.655] (-3203.013) * (-3199.796) (-3197.347) [-3195.834] (-3196.189) -- 0:02:02 506000 -- (-3199.629) (-3201.794) (-3203.467) [-3196.506] * (-3199.276) [-3195.773] (-3195.773) (-3196.245) -- 0:02:02 506500 -- (-3195.224) (-3196.143) (-3205.476) [-3195.396] * (-3208.694) (-3202.414) [-3206.063] (-3201.008) -- 0:02:01 507000 -- (-3206.808) [-3204.764] (-3203.381) (-3195.308) * (-3205.804) [-3203.651] (-3200.274) (-3199.546) -- 0:02:01 507500 -- (-3197.923) (-3205.426) [-3196.669] (-3203.101) * (-3196.804) (-3203.928) [-3202.082] (-3204.355) -- 0:02:02 508000 -- (-3199.992) [-3198.961] (-3200.035) (-3200.684) * (-3199.663) [-3198.187] (-3209.923) (-3201.811) -- 0:02:02 508500 -- [-3204.936] (-3201.722) (-3197.685) (-3196.817) * [-3195.932] (-3197.495) (-3200.372) (-3202.963) -- 0:02:01 509000 -- (-3204.380) (-3202.102) (-3200.821) [-3204.095] * (-3196.848) (-3197.672) [-3211.367] (-3198.539) -- 0:02:01 509500 -- (-3201.364) [-3195.640] (-3206.439) (-3209.806) * (-3201.687) (-3197.105) (-3204.675) [-3199.937] -- 0:02:01 510000 -- (-3205.410) (-3201.680) (-3201.542) [-3204.207] * (-3197.460) (-3201.124) (-3207.662) [-3196.994] -- 0:02:01 Average standard deviation of split frequencies: 0.000923 510500 -- (-3204.734) (-3199.207) (-3202.353) [-3198.893] * [-3202.482] (-3195.964) (-3201.795) (-3195.794) -- 0:02:00 511000 -- (-3196.207) (-3210.465) (-3202.784) [-3200.213] * [-3198.324] (-3198.659) (-3204.112) (-3196.227) -- 0:02:00 511500 -- (-3197.163) (-3208.083) [-3203.364] (-3198.531) * (-3200.360) [-3197.657] (-3204.291) (-3200.065) -- 0:02:01 512000 -- (-3205.543) (-3199.629) [-3198.257] (-3196.241) * (-3196.136) (-3204.926) [-3202.550] (-3203.505) -- 0:02:01 512500 -- (-3208.001) [-3205.297] (-3198.869) (-3201.399) * [-3196.320] (-3199.293) (-3209.940) (-3199.928) -- 0:02:00 513000 -- (-3199.689) (-3205.143) (-3199.942) [-3206.144] * (-3200.223) [-3197.336] (-3198.928) (-3203.324) -- 0:02:00 513500 -- (-3197.271) (-3204.460) (-3200.593) [-3204.735] * [-3200.002] (-3216.220) (-3205.920) (-3200.966) -- 0:02:00 514000 -- (-3205.282) (-3195.140) (-3203.365) [-3196.402] * (-3198.318) (-3213.853) (-3198.437) [-3198.683] -- 0:02:00 514500 -- (-3201.571) (-3202.621) (-3200.552) [-3195.478] * (-3200.054) (-3202.058) [-3194.567] (-3199.722) -- 0:01:59 515000 -- (-3199.075) [-3195.202] (-3197.678) (-3194.165) * (-3202.949) (-3201.432) (-3197.288) [-3197.911] -- 0:01:59 Average standard deviation of split frequencies: 0.000914 515500 -- (-3197.872) (-3194.379) [-3197.137] (-3193.791) * (-3197.838) (-3196.268) (-3203.002) [-3197.975] -- 0:01:59 516000 -- (-3198.382) [-3200.525] (-3204.280) (-3198.901) * (-3196.288) (-3201.139) (-3199.442) [-3201.156] -- 0:02:00 516500 -- (-3197.617) [-3198.320] (-3207.133) (-3208.292) * [-3200.131] (-3199.871) (-3200.223) (-3204.967) -- 0:01:59 517000 -- (-3200.333) (-3199.478) (-3197.863) [-3194.897] * (-3195.857) [-3195.163] (-3196.832) (-3197.556) -- 0:01:59 517500 -- (-3197.777) (-3201.596) [-3199.958] (-3197.674) * (-3199.342) [-3197.641] (-3202.200) (-3203.783) -- 0:01:59 518000 -- [-3192.378] (-3210.475) (-3201.328) (-3198.574) * (-3199.305) (-3193.992) (-3200.955) [-3198.767] -- 0:01:59 518500 -- (-3196.644) (-3199.856) (-3201.177) [-3198.217] * (-3200.105) (-3200.426) (-3195.458) [-3200.578] -- 0:01:58 519000 -- (-3201.565) (-3195.660) (-3197.904) [-3198.345] * [-3203.635] (-3203.432) (-3198.295) (-3207.633) -- 0:01:58 519500 -- (-3200.272) (-3200.595) (-3200.467) [-3200.523] * (-3202.359) (-3200.666) (-3198.376) [-3198.889] -- 0:01:58 520000 -- (-3203.505) [-3199.088] (-3196.295) (-3196.794) * (-3200.864) (-3197.747) [-3197.517] (-3203.291) -- 0:01:59 Average standard deviation of split frequencies: 0.000905 520500 -- (-3206.043) (-3201.020) [-3197.825] (-3204.296) * [-3196.677] (-3201.509) (-3198.284) (-3200.042) -- 0:01:58 521000 -- (-3198.834) (-3206.984) (-3204.524) [-3201.228] * (-3206.442) (-3199.813) (-3199.781) [-3199.002] -- 0:01:58 521500 -- (-3202.883) [-3200.253] (-3201.179) (-3202.432) * (-3199.117) [-3203.184] (-3198.873) (-3201.456) -- 0:01:58 522000 -- (-3204.010) [-3196.135] (-3199.719) (-3204.559) * (-3200.741) (-3195.786) [-3201.320] (-3207.745) -- 0:01:58 522500 -- (-3211.520) (-3191.369) [-3197.851] (-3200.438) * [-3200.513] (-3208.149) (-3203.044) (-3198.226) -- 0:01:57 523000 -- (-3200.654) [-3196.413] (-3195.338) (-3197.908) * (-3198.965) (-3209.598) [-3201.627] (-3197.494) -- 0:01:57 523500 -- (-3198.214) [-3196.217] (-3198.190) (-3200.713) * (-3203.043) (-3196.987) (-3195.730) [-3204.447] -- 0:01:57 524000 -- [-3197.542] (-3204.390) (-3205.880) (-3200.249) * (-3199.488) (-3201.734) (-3203.083) [-3207.136] -- 0:01:58 524500 -- [-3195.883] (-3195.470) (-3197.125) (-3198.826) * (-3202.793) (-3198.167) [-3195.563] (-3198.741) -- 0:01:57 525000 -- (-3207.594) [-3202.560] (-3199.754) (-3201.395) * [-3200.626] (-3193.993) (-3207.045) (-3205.277) -- 0:01:57 Average standard deviation of split frequencies: 0.000896 525500 -- (-3200.245) (-3203.366) (-3201.360) [-3202.498] * [-3199.494] (-3204.752) (-3200.143) (-3196.417) -- 0:01:57 526000 -- [-3201.915] (-3200.384) (-3199.954) (-3206.060) * (-3198.025) (-3202.408) (-3195.178) [-3201.752] -- 0:01:57 526500 -- (-3197.124) (-3207.428) [-3195.549] (-3198.769) * (-3199.124) (-3214.879) (-3202.413) [-3202.792] -- 0:01:56 527000 -- (-3204.344) (-3203.371) (-3195.537) [-3199.015] * [-3198.597] (-3201.372) (-3203.256) (-3201.311) -- 0:01:56 527500 -- (-3198.826) (-3209.821) (-3201.774) [-3201.270] * [-3201.005] (-3203.184) (-3202.308) (-3206.324) -- 0:01:56 528000 -- [-3202.166] (-3203.473) (-3204.371) (-3202.602) * [-3202.562] (-3200.856) (-3201.686) (-3197.288) -- 0:01:56 528500 -- [-3204.101] (-3203.380) (-3202.753) (-3202.743) * [-3196.902] (-3198.204) (-3198.306) (-3200.962) -- 0:01:56 529000 -- (-3202.517) [-3202.190] (-3205.300) (-3207.383) * (-3197.888) (-3200.599) [-3201.384] (-3203.985) -- 0:01:56 529500 -- [-3209.278] (-3196.516) (-3196.357) (-3207.583) * (-3204.942) (-3194.444) [-3195.205] (-3200.731) -- 0:01:56 530000 -- [-3198.775] (-3201.415) (-3197.989) (-3200.320) * (-3209.287) (-3195.369) [-3199.372] (-3200.398) -- 0:01:56 Average standard deviation of split frequencies: 0.000888 530500 -- (-3198.238) (-3198.382) (-3195.919) [-3195.221] * [-3198.428] (-3202.910) (-3200.684) (-3199.520) -- 0:01:55 531000 -- (-3198.924) (-3205.296) [-3201.701] (-3200.289) * [-3202.737] (-3201.223) (-3195.492) (-3194.735) -- 0:01:55 531500 -- [-3198.801] (-3200.725) (-3195.673) (-3214.109) * (-3201.732) (-3203.154) [-3197.647] (-3199.691) -- 0:01:55 532000 -- (-3199.367) [-3198.193] (-3201.613) (-3211.599) * (-3197.042) (-3198.011) (-3202.855) [-3197.407] -- 0:01:55 532500 -- (-3195.904) (-3203.206) (-3199.838) [-3193.607] * (-3195.446) (-3201.801) [-3194.757] (-3204.289) -- 0:01:55 533000 -- (-3200.604) (-3193.302) (-3202.625) [-3198.214] * (-3197.140) [-3201.033] (-3201.546) (-3197.236) -- 0:01:55 533500 -- [-3201.070] (-3199.652) (-3205.019) (-3202.535) * (-3200.076) (-3204.953) [-3200.038] (-3202.534) -- 0:01:55 534000 -- [-3197.900] (-3203.834) (-3196.684) (-3199.209) * (-3200.761) [-3205.994] (-3196.842) (-3199.142) -- 0:01:55 534500 -- (-3199.315) (-3198.968) (-3203.945) [-3198.143] * (-3198.509) [-3197.819] (-3198.086) (-3196.829) -- 0:01:54 535000 -- [-3200.432] (-3205.770) (-3197.839) (-3208.689) * (-3199.067) (-3203.088) [-3203.016] (-3204.924) -- 0:01:54 Average standard deviation of split frequencies: 0.000879 535500 -- (-3198.510) (-3208.161) (-3204.026) [-3197.782] * (-3202.545) [-3197.344] (-3197.365) (-3197.665) -- 0:01:54 536000 -- (-3202.061) (-3203.653) [-3200.729] (-3197.976) * (-3200.358) (-3199.050) (-3199.973) [-3201.515] -- 0:01:54 536500 -- (-3200.397) (-3198.114) [-3199.540] (-3205.920) * (-3207.971) [-3200.641] (-3201.142) (-3199.922) -- 0:01:54 537000 -- (-3202.809) [-3202.669] (-3198.653) (-3198.752) * [-3203.690] (-3198.687) (-3206.515) (-3201.531) -- 0:01:54 537500 -- (-3199.980) (-3196.052) (-3201.451) [-3199.593] * (-3199.751) (-3199.848) [-3195.341] (-3200.501) -- 0:01:54 538000 -- (-3198.485) [-3192.943] (-3198.317) (-3197.038) * (-3200.410) (-3206.621) [-3196.007] (-3203.717) -- 0:01:54 538500 -- (-3193.585) (-3214.620) [-3198.056] (-3201.579) * (-3200.069) (-3206.850) (-3196.448) [-3196.888] -- 0:01:53 539000 -- (-3206.350) (-3206.354) (-3202.061) [-3200.127] * (-3197.572) (-3193.493) (-3202.391) [-3203.390] -- 0:01:53 539500 -- (-3202.997) (-3205.838) (-3204.380) [-3199.512] * (-3196.607) (-3197.505) [-3201.033] (-3201.911) -- 0:01:53 540000 -- (-3199.915) (-3202.534) (-3201.327) [-3205.175] * [-3194.778] (-3194.888) (-3201.604) (-3205.169) -- 0:01:53 Average standard deviation of split frequencies: 0.000872 540500 -- [-3202.897] (-3204.128) (-3199.626) (-3204.697) * (-3197.351) [-3203.175] (-3206.675) (-3202.203) -- 0:01:53 541000 -- (-3206.195) (-3198.625) [-3200.138] (-3209.676) * (-3198.341) (-3204.329) (-3203.473) [-3207.828] -- 0:01:53 541500 -- (-3201.768) (-3207.369) (-3203.333) [-3196.925] * (-3193.261) (-3196.762) [-3198.218] (-3204.984) -- 0:01:53 542000 -- (-3202.091) (-3201.369) [-3204.026] (-3196.686) * (-3201.079) (-3202.016) [-3203.037] (-3197.523) -- 0:01:53 542500 -- (-3199.166) (-3203.274) [-3198.246] (-3203.737) * [-3197.623] (-3213.030) (-3197.277) (-3201.669) -- 0:01:53 543000 -- (-3198.745) [-3196.454] (-3195.706) (-3201.808) * (-3204.322) [-3200.965] (-3198.208) (-3203.907) -- 0:01:52 543500 -- (-3201.417) [-3199.956] (-3202.902) (-3198.628) * (-3209.281) [-3195.511] (-3202.425) (-3206.728) -- 0:01:52 544000 -- (-3194.998) [-3197.624] (-3202.644) (-3204.169) * (-3207.945) (-3208.578) (-3194.225) [-3202.259] -- 0:01:52 544500 -- (-3200.256) (-3207.810) (-3197.540) [-3198.208] * (-3200.676) [-3199.675] (-3205.032) (-3196.892) -- 0:01:52 545000 -- (-3197.058) (-3202.331) [-3199.179] (-3200.098) * (-3206.390) [-3200.204] (-3200.305) (-3196.367) -- 0:01:52 Average standard deviation of split frequencies: 0.000863 545500 -- (-3198.347) [-3197.278] (-3201.338) (-3207.871) * (-3206.661) (-3198.983) (-3196.628) [-3195.478] -- 0:01:52 546000 -- [-3200.823] (-3194.737) (-3199.421) (-3201.936) * (-3204.587) [-3198.786] (-3200.914) (-3198.303) -- 0:01:52 546500 -- (-3196.760) (-3201.336) (-3200.492) [-3199.030] * (-3203.641) (-3196.995) [-3205.102] (-3197.334) -- 0:01:52 547000 -- (-3198.427) [-3196.487] (-3199.726) (-3197.019) * (-3200.233) (-3198.251) (-3205.490) [-3192.451] -- 0:01:51 547500 -- (-3199.344) [-3200.089] (-3201.929) (-3201.656) * (-3200.304) [-3198.040] (-3203.647) (-3194.575) -- 0:01:51 548000 -- [-3199.251] (-3201.503) (-3200.452) (-3197.234) * (-3207.850) [-3194.226] (-3206.441) (-3201.068) -- 0:01:51 548500 -- (-3203.562) (-3194.675) [-3200.591] (-3198.465) * (-3202.779) (-3195.290) (-3203.740) [-3204.445] -- 0:01:51 549000 -- (-3196.252) [-3199.174] (-3194.827) (-3194.498) * (-3200.493) (-3196.415) [-3198.499] (-3206.349) -- 0:01:51 549500 -- (-3206.132) (-3195.154) [-3197.569] (-3197.772) * (-3201.530) [-3198.201] (-3203.274) (-3201.635) -- 0:01:51 550000 -- (-3197.579) (-3198.456) [-3195.568] (-3206.181) * (-3201.007) [-3199.502] (-3202.454) (-3199.104) -- 0:01:51 Average standard deviation of split frequencies: 0.000856 550500 -- (-3196.979) [-3197.183] (-3201.359) (-3195.785) * (-3204.544) (-3195.903) (-3196.813) [-3200.239] -- 0:01:51 551000 -- (-3198.257) (-3202.467) [-3197.840] (-3198.225) * (-3201.214) (-3204.234) [-3203.185] (-3203.642) -- 0:01:50 551500 -- (-3198.463) (-3204.578) (-3200.466) [-3199.289] * (-3201.722) [-3197.215] (-3205.440) (-3203.464) -- 0:01:50 552000 -- (-3197.419) [-3195.162] (-3196.836) (-3203.213) * (-3198.572) (-3198.645) (-3203.833) [-3194.598] -- 0:01:50 552500 -- (-3198.115) (-3202.613) (-3198.519) [-3206.638] * (-3206.491) (-3198.990) (-3206.773) [-3202.399] -- 0:01:50 553000 -- (-3201.249) (-3196.814) [-3198.916] (-3198.885) * (-3208.577) (-3203.303) (-3203.470) [-3195.444] -- 0:01:49 553500 -- (-3203.463) (-3201.169) [-3199.122] (-3208.189) * [-3202.170] (-3207.002) (-3199.349) (-3201.503) -- 0:01:50 554000 -- (-3204.821) (-3198.028) (-3202.005) [-3200.360] * (-3200.365) (-3197.025) [-3195.557] (-3197.011) -- 0:01:50 554500 -- (-3203.654) (-3205.118) (-3202.589) [-3195.336] * (-3201.349) (-3201.406) (-3195.596) [-3200.748] -- 0:01:50 555000 -- (-3200.919) (-3204.583) (-3202.663) [-3195.823] * (-3209.710) (-3200.321) (-3192.622) [-3198.190] -- 0:01:49 Average standard deviation of split frequencies: 0.000848 555500 -- (-3199.316) (-3200.127) [-3196.526] (-3195.906) * [-3196.995] (-3201.827) (-3200.150) (-3196.477) -- 0:01:49 556000 -- (-3197.439) (-3200.881) [-3197.388] (-3197.579) * (-3203.919) (-3205.381) [-3197.728] (-3196.127) -- 0:01:49 556500 -- (-3200.486) [-3197.832] (-3196.810) (-3205.645) * [-3199.247] (-3202.669) (-3204.888) (-3196.655) -- 0:01:49 557000 -- (-3195.473) (-3201.577) (-3199.876) [-3198.747] * [-3197.361] (-3197.618) (-3208.884) (-3199.622) -- 0:01:48 557500 -- (-3198.970) (-3197.229) [-3200.435] (-3200.541) * (-3198.355) [-3206.246] (-3198.742) (-3206.669) -- 0:01:49 558000 -- (-3197.693) (-3202.382) (-3196.602) [-3195.991] * (-3201.884) (-3199.575) [-3199.708] (-3200.814) -- 0:01:49 558500 -- (-3200.511) (-3203.068) [-3197.152] (-3203.849) * [-3202.639] (-3195.493) (-3197.584) (-3203.461) -- 0:01:49 559000 -- (-3194.997) (-3200.593) (-3201.179) [-3208.912] * (-3196.248) (-3198.266) [-3199.511] (-3200.830) -- 0:01:48 559500 -- (-3198.882) (-3193.986) (-3202.587) [-3204.618] * (-3196.676) [-3203.936] (-3202.162) (-3199.249) -- 0:01:48 560000 -- [-3196.843] (-3199.108) (-3198.517) (-3201.464) * (-3197.151) (-3197.067) [-3197.242] (-3199.758) -- 0:01:48 Average standard deviation of split frequencies: 0.001261 560500 -- (-3203.522) (-3203.316) (-3201.833) [-3203.832] * (-3199.199) (-3199.540) [-3196.016] (-3198.357) -- 0:01:48 561000 -- (-3201.561) (-3200.812) (-3204.633) [-3198.005] * (-3200.291) [-3200.083] (-3197.105) (-3200.199) -- 0:01:47 561500 -- [-3201.031] (-3202.203) (-3197.298) (-3197.239) * (-3201.951) (-3198.413) [-3201.957] (-3200.604) -- 0:01:48 562000 -- [-3198.198] (-3199.216) (-3200.414) (-3206.995) * (-3194.764) (-3199.867) (-3202.453) [-3198.532] -- 0:01:48 562500 -- (-3199.004) (-3204.071) [-3197.978] (-3206.458) * (-3199.564) [-3196.108] (-3195.675) (-3200.998) -- 0:01:48 563000 -- (-3199.028) [-3203.427] (-3202.389) (-3199.598) * (-3199.622) (-3198.224) [-3202.080] (-3197.910) -- 0:01:47 563500 -- (-3207.074) (-3199.217) (-3200.382) [-3195.563] * (-3197.823) (-3199.339) [-3200.878] (-3200.724) -- 0:01:47 564000 -- (-3208.247) (-3198.629) (-3195.300) [-3199.907] * (-3196.359) (-3199.213) (-3200.807) [-3200.785] -- 0:01:47 564500 -- (-3199.296) (-3208.449) [-3204.267] (-3204.341) * (-3198.953) (-3204.640) [-3196.752] (-3198.343) -- 0:01:47 565000 -- (-3198.466) [-3200.081] (-3199.555) (-3209.668) * (-3204.903) [-3201.467] (-3202.963) (-3197.132) -- 0:01:47 Average standard deviation of split frequencies: 0.001249 565500 -- [-3200.042] (-3198.412) (-3199.105) (-3200.198) * (-3201.880) [-3196.487] (-3197.399) (-3195.343) -- 0:01:47 566000 -- [-3197.357] (-3201.725) (-3201.813) (-3210.133) * (-3207.060) (-3203.004) [-3200.391] (-3205.888) -- 0:01:47 566500 -- (-3203.363) [-3197.637] (-3206.834) (-3201.266) * (-3202.849) (-3199.944) (-3195.868) [-3200.403] -- 0:01:47 567000 -- (-3202.942) (-3200.698) [-3197.248] (-3199.286) * (-3200.491) (-3202.552) (-3200.693) [-3197.061] -- 0:01:46 567500 -- (-3197.419) [-3197.708] (-3197.058) (-3209.048) * (-3211.754) [-3197.898] (-3199.070) (-3202.493) -- 0:01:46 568000 -- [-3196.311] (-3195.983) (-3196.147) (-3203.084) * (-3197.734) (-3200.648) [-3198.661] (-3205.074) -- 0:01:46 568500 -- [-3200.649] (-3199.717) (-3204.746) (-3195.235) * (-3197.612) (-3202.083) [-3198.619] (-3204.393) -- 0:01:46 569000 -- (-3196.684) [-3205.776] (-3202.495) (-3201.359) * (-3197.548) [-3206.488] (-3201.510) (-3203.504) -- 0:01:46 569500 -- (-3195.278) [-3198.653] (-3201.717) (-3195.474) * (-3202.770) [-3200.189] (-3197.305) (-3210.874) -- 0:01:45 570000 -- (-3202.996) (-3197.019) (-3199.481) [-3202.817] * (-3205.483) (-3207.116) [-3198.994] (-3219.472) -- 0:01:46 Average standard deviation of split frequencies: 0.001239 570500 -- [-3197.516] (-3202.430) (-3198.119) (-3199.220) * [-3203.972] (-3197.584) (-3199.367) (-3205.088) -- 0:01:46 571000 -- [-3194.498] (-3204.679) (-3197.388) (-3198.463) * (-3204.245) (-3202.624) (-3205.838) [-3201.293] -- 0:01:45 571500 -- (-3198.427) (-3204.512) [-3196.600] (-3198.124) * [-3194.043] (-3205.043) (-3201.824) (-3205.684) -- 0:01:45 572000 -- (-3199.494) (-3203.050) [-3199.874] (-3200.021) * [-3201.245] (-3205.662) (-3196.085) (-3197.262) -- 0:01:45 572500 -- (-3202.007) (-3195.600) [-3200.930] (-3204.554) * [-3194.989] (-3202.743) (-3197.166) (-3201.140) -- 0:01:45 573000 -- (-3202.744) (-3201.307) [-3201.691] (-3204.196) * (-3196.228) (-3204.112) (-3197.861) [-3200.749] -- 0:01:45 573500 -- (-3202.761) (-3198.235) (-3209.253) [-3200.790] * (-3198.363) (-3200.084) (-3197.527) [-3202.741] -- 0:01:44 574000 -- (-3204.831) [-3198.295] (-3214.018) (-3202.110) * (-3200.133) [-3196.474] (-3206.686) (-3194.421) -- 0:01:45 574500 -- [-3196.786] (-3214.221) (-3199.543) (-3201.718) * (-3212.364) (-3200.551) (-3198.395) [-3195.950] -- 0:01:45 575000 -- (-3193.986) [-3200.020] (-3200.303) (-3198.690) * (-3201.547) [-3198.863] (-3202.047) (-3200.792) -- 0:01:44 Average standard deviation of split frequencies: 0.001228 575500 -- (-3199.590) (-3200.732) [-3204.778] (-3197.372) * (-3200.403) [-3198.100] (-3196.984) (-3206.396) -- 0:01:44 576000 -- (-3197.649) (-3199.692) (-3195.848) [-3194.870] * (-3199.332) (-3199.243) [-3195.557] (-3209.777) -- 0:01:44 576500 -- (-3209.006) [-3197.535] (-3199.537) (-3197.878) * (-3197.627) (-3203.745) (-3192.978) [-3204.078] -- 0:01:44 577000 -- (-3205.363) [-3198.581] (-3200.518) (-3200.171) * [-3199.206] (-3206.792) (-3204.456) (-3203.365) -- 0:01:44 577500 -- (-3202.231) (-3202.861) [-3199.660] (-3207.062) * (-3202.868) (-3200.577) [-3199.007] (-3201.564) -- 0:01:43 578000 -- (-3199.351) [-3197.409] (-3202.591) (-3192.403) * (-3200.270) (-3198.621) (-3201.905) [-3203.356] -- 0:01:44 578500 -- [-3197.718] (-3199.227) (-3196.003) (-3205.483) * (-3199.643) [-3205.499] (-3202.709) (-3199.340) -- 0:01:44 579000 -- (-3199.070) [-3204.461] (-3199.010) (-3207.407) * (-3206.009) [-3196.036] (-3197.901) (-3201.123) -- 0:01:43 579500 -- (-3199.230) (-3198.772) [-3197.128] (-3201.524) * (-3203.361) (-3200.348) (-3200.521) [-3196.824] -- 0:01:43 580000 -- (-3200.496) (-3206.216) (-3200.504) [-3204.813] * (-3204.313) (-3204.437) (-3202.412) [-3197.702] -- 0:01:43 Average standard deviation of split frequencies: 0.001218 580500 -- (-3205.457) [-3195.738] (-3201.033) (-3196.064) * (-3199.678) [-3199.044] (-3198.291) (-3204.186) -- 0:01:43 581000 -- (-3210.083) (-3197.605) (-3202.094) [-3200.308] * [-3195.426] (-3198.236) (-3199.584) (-3193.886) -- 0:01:43 581500 -- (-3206.355) (-3200.194) [-3199.513] (-3197.049) * [-3198.123] (-3201.289) (-3203.304) (-3202.490) -- 0:01:42 582000 -- (-3201.585) (-3201.487) [-3197.432] (-3198.734) * (-3196.400) [-3200.631] (-3200.132) (-3207.678) -- 0:01:43 582500 -- (-3196.715) (-3200.354) [-3199.146] (-3207.641) * (-3202.286) (-3195.261) [-3194.037] (-3204.590) -- 0:01:43 583000 -- [-3200.234] (-3196.511) (-3197.816) (-3199.406) * (-3200.106) [-3199.038] (-3197.153) (-3199.312) -- 0:01:42 583500 -- (-3201.256) [-3196.363] (-3203.441) (-3199.837) * (-3198.434) (-3202.372) [-3207.018] (-3204.780) -- 0:01:42 584000 -- [-3199.272] (-3198.151) (-3202.712) (-3197.742) * [-3203.364] (-3208.459) (-3206.775) (-3196.021) -- 0:01:42 584500 -- (-3196.708) [-3196.885] (-3202.855) (-3201.194) * (-3197.818) (-3197.103) (-3198.821) [-3197.324] -- 0:01:42 585000 -- (-3193.873) [-3198.363] (-3197.135) (-3203.993) * (-3202.185) (-3203.773) (-3200.494) [-3193.506] -- 0:01:42 Average standard deviation of split frequencies: 0.001207 585500 -- (-3197.663) (-3212.330) [-3199.250] (-3199.843) * (-3199.983) (-3205.246) (-3200.484) [-3196.610] -- 0:01:41 586000 -- (-3201.364) (-3203.125) (-3204.498) [-3200.119] * (-3196.952) (-3203.512) (-3204.064) [-3196.401] -- 0:01:41 586500 -- (-3200.984) (-3200.881) (-3207.474) [-3198.210] * (-3197.384) [-3197.242] (-3194.677) (-3205.208) -- 0:01:42 587000 -- [-3197.085] (-3201.617) (-3200.347) (-3206.893) * (-3204.193) [-3200.322] (-3204.955) (-3206.243) -- 0:01:42 587500 -- [-3198.806] (-3194.836) (-3196.443) (-3207.567) * (-3200.012) [-3196.794] (-3200.746) (-3200.848) -- 0:01:41 588000 -- [-3199.597] (-3203.790) (-3203.728) (-3205.084) * (-3198.799) [-3202.704] (-3200.780) (-3201.395) -- 0:01:41 588500 -- (-3197.897) [-3195.198] (-3197.883) (-3202.781) * (-3199.583) (-3201.322) (-3203.051) [-3197.739] -- 0:01:41 589000 -- (-3196.722) (-3197.299) (-3197.929) [-3201.373] * (-3201.099) [-3201.221] (-3198.114) (-3197.466) -- 0:01:41 589500 -- (-3198.971) [-3195.177] (-3197.415) (-3205.527) * (-3198.546) [-3197.221] (-3201.531) (-3201.937) -- 0:01:40 590000 -- (-3198.140) (-3197.427) [-3197.708] (-3195.517) * (-3200.356) [-3197.248] (-3203.371) (-3204.231) -- 0:01:40 Average standard deviation of split frequencies: 0.001197 590500 -- (-3202.585) (-3206.140) (-3195.543) [-3198.119] * (-3197.508) [-3197.186] (-3197.123) (-3204.743) -- 0:01:41 591000 -- (-3196.095) (-3197.211) (-3202.825) [-3202.586] * [-3197.648] (-3200.930) (-3204.003) (-3203.083) -- 0:01:41 591500 -- [-3197.327] (-3204.461) (-3200.823) (-3209.874) * (-3201.141) [-3197.244] (-3202.354) (-3196.008) -- 0:01:40 592000 -- (-3197.828) (-3204.326) (-3196.007) [-3201.100] * (-3202.712) (-3200.469) (-3205.843) [-3198.703] -- 0:01:40 592500 -- (-3203.579) (-3198.233) (-3203.566) [-3199.898] * [-3196.043] (-3196.926) (-3205.541) (-3201.082) -- 0:01:40 593000 -- (-3195.413) (-3199.187) [-3199.013] (-3203.307) * (-3206.989) [-3199.129] (-3200.263) (-3202.231) -- 0:01:40 593500 -- (-3199.726) [-3202.122] (-3199.080) (-3203.682) * (-3201.222) (-3199.689) [-3204.119] (-3204.412) -- 0:01:39 594000 -- (-3205.098) [-3193.756] (-3201.388) (-3196.551) * (-3196.011) [-3201.451] (-3199.897) (-3201.836) -- 0:01:39 594500 -- (-3208.760) (-3200.493) (-3204.564) [-3200.059] * [-3201.269] (-3198.757) (-3198.763) (-3193.769) -- 0:01:40 595000 -- (-3204.879) [-3200.049] (-3204.369) (-3202.171) * (-3201.157) [-3194.683] (-3202.920) (-3196.894) -- 0:01:40 Average standard deviation of split frequencies: 0.001186 595500 -- [-3199.899] (-3202.627) (-3202.099) (-3197.650) * (-3197.071) (-3207.600) [-3198.975] (-3198.110) -- 0:01:39 596000 -- (-3197.589) (-3202.472) (-3201.014) [-3199.972] * (-3201.964) (-3200.592) (-3201.889) [-3200.017] -- 0:01:39 596500 -- (-3199.938) (-3197.010) [-3200.719] (-3201.591) * (-3199.966) (-3201.932) (-3199.264) [-3203.069] -- 0:01:39 597000 -- (-3201.498) [-3203.262] (-3205.715) (-3200.149) * [-3198.862] (-3201.307) (-3209.054) (-3204.736) -- 0:01:39 597500 -- (-3208.341) [-3197.624] (-3203.251) (-3198.497) * (-3202.564) (-3200.866) [-3204.551] (-3203.947) -- 0:01:39 598000 -- [-3198.476] (-3199.196) (-3194.083) (-3203.715) * (-3202.680) (-3202.877) (-3202.141) [-3195.753] -- 0:01:38 598500 -- (-3196.999) [-3200.097] (-3200.105) (-3207.970) * (-3200.659) (-3201.654) (-3200.462) [-3202.115] -- 0:01:39 599000 -- (-3197.515) (-3203.281) [-3199.494] (-3199.344) * [-3195.375] (-3203.626) (-3194.389) (-3205.961) -- 0:01:39 599500 -- (-3197.893) (-3201.655) (-3198.895) [-3200.022] * (-3204.174) (-3206.009) (-3197.458) [-3192.534] -- 0:01:38 600000 -- (-3203.381) [-3199.608] (-3197.334) (-3193.849) * (-3206.732) [-3196.310] (-3200.260) (-3198.834) -- 0:01:38 Average standard deviation of split frequencies: 0.001177 600500 -- [-3206.553] (-3207.356) (-3199.111) (-3196.908) * (-3211.849) [-3196.278] (-3196.797) (-3200.705) -- 0:01:38 601000 -- (-3196.377) [-3198.165] (-3199.066) (-3202.647) * (-3201.451) (-3206.022) [-3196.791] (-3197.247) -- 0:01:38 601500 -- (-3198.766) (-3200.007) (-3197.380) [-3199.793] * (-3200.193) (-3196.601) (-3198.186) [-3200.349] -- 0:01:38 602000 -- [-3200.770] (-3196.698) (-3199.874) (-3208.584) * (-3197.483) (-3196.075) (-3197.744) [-3200.229] -- 0:01:37 602500 -- [-3193.080] (-3202.078) (-3197.328) (-3198.462) * (-3203.703) [-3203.011] (-3195.370) (-3197.951) -- 0:01:37 603000 -- (-3199.901) (-3200.980) [-3204.993] (-3199.132) * (-3207.215) (-3202.194) [-3199.872] (-3203.070) -- 0:01:38 603500 -- (-3202.703) [-3202.010] (-3203.334) (-3196.991) * (-3206.195) [-3198.048] (-3213.424) (-3199.932) -- 0:01:37 604000 -- [-3204.732] (-3208.213) (-3198.760) (-3199.971) * (-3199.374) (-3198.821) [-3207.090] (-3196.384) -- 0:01:37 604500 -- (-3205.558) (-3197.426) (-3194.797) [-3201.140] * (-3200.646) [-3200.868] (-3202.708) (-3199.679) -- 0:01:37 605000 -- (-3209.414) (-3202.066) [-3196.099] (-3200.870) * (-3199.658) [-3199.393] (-3204.187) (-3198.582) -- 0:01:37 Average standard deviation of split frequencies: 0.001167 605500 -- (-3203.009) (-3198.142) [-3202.636] (-3198.060) * (-3204.701) (-3200.353) [-3197.153] (-3197.546) -- 0:01:37 606000 -- (-3204.745) (-3198.305) [-3202.282] (-3198.561) * (-3198.671) (-3200.428) (-3198.836) [-3201.052] -- 0:01:36 606500 -- (-3202.202) (-3201.619) [-3203.473] (-3198.335) * (-3204.887) (-3198.988) [-3198.613] (-3199.566) -- 0:01:36 607000 -- (-3194.334) [-3198.235] (-3202.664) (-3197.778) * [-3199.310] (-3196.815) (-3207.998) (-3197.930) -- 0:01:37 607500 -- [-3197.204] (-3202.292) (-3207.813) (-3200.662) * (-3205.959) [-3196.890] (-3201.190) (-3203.737) -- 0:01:36 608000 -- (-3196.048) (-3196.480) (-3199.635) [-3202.768] * (-3198.373) (-3198.435) (-3202.309) [-3204.779] -- 0:01:36 608500 -- (-3201.352) (-3197.461) [-3201.656] (-3197.695) * (-3201.518) (-3200.496) (-3206.983) [-3201.464] -- 0:01:36 609000 -- [-3199.352] (-3198.092) (-3206.048) (-3195.698) * (-3199.204) (-3198.851) [-3204.092] (-3208.384) -- 0:01:36 609500 -- (-3200.237) [-3198.430] (-3197.692) (-3196.584) * (-3204.650) [-3200.657] (-3195.290) (-3205.740) -- 0:01:36 610000 -- [-3202.614] (-3200.000) (-3204.501) (-3198.402) * (-3205.083) (-3201.056) [-3199.047] (-3206.261) -- 0:01:35 Average standard deviation of split frequencies: 0.001158 610500 -- (-3202.756) [-3203.669] (-3207.488) (-3198.778) * (-3201.200) [-3196.061] (-3201.629) (-3197.825) -- 0:01:35 611000 -- (-3199.699) (-3197.939) (-3201.104) [-3195.202] * (-3198.467) (-3205.832) [-3199.438] (-3203.715) -- 0:01:36 611500 -- (-3201.998) (-3205.640) (-3205.081) [-3196.022] * (-3199.465) (-3204.561) (-3197.544) [-3199.245] -- 0:01:35 612000 -- (-3202.740) (-3199.478) [-3200.941] (-3202.026) * (-3198.271) [-3197.943] (-3205.262) (-3197.985) -- 0:01:35 612500 -- [-3200.299] (-3206.513) (-3201.536) (-3209.729) * [-3196.211] (-3201.185) (-3204.021) (-3201.917) -- 0:01:35 613000 -- (-3195.143) (-3203.059) [-3202.355] (-3213.533) * (-3198.152) [-3195.447] (-3199.216) (-3199.022) -- 0:01:35 613500 -- [-3201.666] (-3197.706) (-3197.572) (-3197.682) * [-3200.582] (-3193.271) (-3203.580) (-3197.424) -- 0:01:35 614000 -- (-3197.737) (-3195.348) [-3199.051] (-3203.432) * (-3195.761) (-3205.423) [-3206.345] (-3199.196) -- 0:01:34 614500 -- [-3195.830] (-3196.616) (-3196.188) (-3198.695) * (-3201.469) (-3202.084) [-3200.824] (-3208.366) -- 0:01:34 615000 -- [-3197.377] (-3194.838) (-3195.611) (-3197.294) * (-3201.167) (-3202.618) (-3206.088) [-3200.311] -- 0:01:35 Average standard deviation of split frequencies: 0.001148 615500 -- (-3195.793) (-3200.094) (-3197.565) [-3199.850] * (-3198.618) (-3196.645) [-3198.344] (-3208.381) -- 0:01:34 616000 -- (-3195.776) (-3203.863) (-3199.041) [-3196.779] * (-3198.973) [-3201.881] (-3198.377) (-3196.274) -- 0:01:34 616500 -- (-3204.452) [-3201.422] (-3205.501) (-3199.993) * (-3199.683) (-3200.784) [-3197.712] (-3204.448) -- 0:01:34 617000 -- [-3198.891] (-3199.676) (-3202.510) (-3198.977) * [-3198.529] (-3194.918) (-3210.517) (-3203.915) -- 0:01:34 617500 -- (-3199.266) (-3198.848) [-3199.335] (-3196.293) * (-3203.436) [-3198.192] (-3203.301) (-3201.006) -- 0:01:34 618000 -- [-3199.382] (-3195.839) (-3210.608) (-3204.552) * (-3199.596) [-3203.984] (-3196.170) (-3200.322) -- 0:01:33 618500 -- (-3203.414) (-3203.267) (-3195.196) [-3200.022] * (-3198.219) [-3200.115] (-3201.496) (-3195.635) -- 0:01:33 619000 -- (-3205.645) [-3200.183] (-3197.457) (-3201.202) * (-3195.369) [-3200.526] (-3207.881) (-3201.020) -- 0:01:33 619500 -- (-3198.238) (-3206.313) [-3198.753] (-3194.922) * (-3196.720) (-3201.173) (-3202.024) [-3196.292] -- 0:01:33 620000 -- (-3204.856) [-3197.408] (-3197.082) (-3202.254) * (-3198.211) (-3195.514) [-3201.219] (-3202.636) -- 0:01:33 Average standard deviation of split frequencies: 0.001139 620500 -- (-3204.060) (-3204.871) [-3197.970] (-3198.645) * (-3201.484) (-3199.333) [-3198.223] (-3200.342) -- 0:01:33 621000 -- (-3200.627) [-3194.615] (-3198.879) (-3199.870) * [-3197.640] (-3203.056) (-3200.013) (-3199.849) -- 0:01:33 621500 -- (-3203.401) (-3196.715) [-3196.680] (-3195.089) * (-3202.407) (-3197.206) (-3202.916) [-3200.734] -- 0:01:33 622000 -- (-3197.681) (-3207.944) [-3198.870] (-3197.883) * (-3205.775) (-3200.314) [-3196.352] (-3195.400) -- 0:01:32 622500 -- [-3195.433] (-3196.316) (-3200.649) (-3201.583) * (-3203.412) (-3204.825) (-3196.110) [-3195.864] -- 0:01:32 623000 -- (-3199.192) [-3198.190] (-3201.381) (-3199.451) * (-3203.791) (-3199.904) [-3196.570] (-3196.308) -- 0:01:32 623500 -- (-3195.815) [-3195.027] (-3201.373) (-3198.030) * [-3197.755] (-3203.406) (-3201.047) (-3199.613) -- 0:01:32 624000 -- (-3203.282) [-3196.617] (-3201.335) (-3205.256) * (-3198.849) (-3207.680) (-3199.234) [-3194.625] -- 0:01:32 624500 -- (-3199.341) (-3200.071) (-3198.530) [-3200.621] * (-3201.648) (-3200.370) [-3199.364] (-3200.080) -- 0:01:32 625000 -- [-3202.453] (-3207.051) (-3198.296) (-3198.982) * [-3196.165] (-3196.921) (-3199.785) (-3196.773) -- 0:01:32 Average standard deviation of split frequencies: 0.001130 625500 -- (-3201.157) (-3201.914) [-3197.215] (-3203.949) * (-3202.756) [-3196.388] (-3201.119) (-3198.272) -- 0:01:32 626000 -- [-3198.621] (-3208.346) (-3211.209) (-3199.721) * (-3209.790) (-3197.580) (-3198.272) [-3195.660] -- 0:01:32 626500 -- (-3203.549) (-3202.867) [-3195.227] (-3199.618) * (-3199.245) (-3196.631) (-3200.991) [-3195.664] -- 0:01:31 627000 -- (-3200.196) [-3198.379] (-3201.633) (-3201.192) * (-3199.512) (-3200.927) [-3201.148] (-3198.242) -- 0:01:31 627500 -- (-3211.906) (-3199.052) [-3198.074] (-3209.183) * (-3197.968) (-3202.818) [-3197.827] (-3206.102) -- 0:01:32 628000 -- (-3196.570) (-3196.081) [-3199.498] (-3201.615) * (-3204.521) (-3199.975) (-3196.756) [-3202.736] -- 0:01:31 628500 -- (-3199.551) (-3203.736) [-3197.231] (-3198.014) * (-3201.218) (-3207.115) [-3195.460] (-3206.177) -- 0:01:31 629000 -- (-3209.363) (-3199.491) [-3200.248] (-3198.505) * (-3197.881) (-3201.808) [-3197.709] (-3199.628) -- 0:01:31 629500 -- (-3196.435) (-3194.924) [-3199.701] (-3205.285) * (-3199.804) [-3196.301] (-3199.023) (-3199.628) -- 0:01:31 630000 -- (-3198.131) [-3197.440] (-3200.470) (-3196.931) * (-3199.979) (-3204.758) (-3201.313) [-3201.269] -- 0:01:31 Average standard deviation of split frequencies: 0.001121 630500 -- [-3198.477] (-3200.741) (-3199.077) (-3204.051) * (-3199.615) (-3201.728) (-3198.436) [-3203.984] -- 0:01:30 631000 -- (-3207.675) (-3200.049) (-3192.830) [-3196.281] * [-3198.968] (-3196.025) (-3203.861) (-3206.204) -- 0:01:30 631500 -- (-3203.747) [-3203.261] (-3212.133) (-3200.266) * [-3197.022] (-3198.843) (-3200.784) (-3205.178) -- 0:01:31 632000 -- (-3195.838) (-3200.191) (-3204.951) [-3196.139] * (-3200.617) [-3201.406] (-3203.341) (-3199.068) -- 0:01:30 632500 -- (-3197.239) (-3201.656) (-3200.005) [-3199.590] * [-3197.069] (-3208.786) (-3197.160) (-3203.082) -- 0:01:30 633000 -- [-3198.633] (-3200.872) (-3197.355) (-3202.405) * (-3203.194) [-3198.616] (-3194.922) (-3198.186) -- 0:01:30 633500 -- (-3196.140) (-3196.730) (-3197.379) [-3203.978] * (-3206.669) (-3195.656) (-3204.618) [-3195.758] -- 0:01:30 634000 -- (-3201.318) [-3200.524] (-3196.753) (-3205.247) * (-3206.346) [-3198.588] (-3199.438) (-3204.187) -- 0:01:30 634500 -- (-3206.500) (-3198.069) [-3197.699] (-3198.847) * (-3201.599) [-3200.151] (-3197.660) (-3198.669) -- 0:01:29 635000 -- (-3205.418) [-3200.655] (-3208.864) (-3201.938) * (-3205.153) [-3198.243] (-3199.242) (-3198.511) -- 0:01:29 Average standard deviation of split frequencies: 0.001112 635500 -- [-3198.312] (-3200.554) (-3198.931) (-3202.310) * (-3200.920) (-3199.682) (-3197.227) [-3199.943] -- 0:01:30 636000 -- [-3196.278] (-3197.402) (-3200.151) (-3200.724) * (-3201.872) [-3199.597] (-3202.878) (-3205.990) -- 0:01:29 636500 -- (-3199.379) [-3194.570] (-3199.069) (-3204.335) * (-3203.890) [-3195.828] (-3193.828) (-3203.099) -- 0:01:29 637000 -- (-3202.950) [-3200.843] (-3202.006) (-3201.484) * (-3207.405) (-3199.843) (-3198.212) [-3204.474] -- 0:01:29 637500 -- [-3201.894] (-3193.875) (-3198.082) (-3202.058) * (-3203.770) [-3202.840] (-3199.344) (-3201.824) -- 0:01:29 638000 -- (-3200.954) (-3195.093) [-3195.152] (-3202.412) * [-3200.361] (-3202.397) (-3198.639) (-3203.008) -- 0:01:29 638500 -- (-3199.732) (-3201.968) [-3196.474] (-3198.745) * (-3199.490) [-3199.062] (-3199.963) (-3201.683) -- 0:01:28 639000 -- (-3198.520) [-3199.274] (-3197.741) (-3201.093) * (-3201.467) [-3204.671] (-3197.881) (-3203.629) -- 0:01:28 639500 -- [-3201.844] (-3208.428) (-3200.793) (-3202.631) * [-3198.040] (-3206.916) (-3200.013) (-3194.828) -- 0:01:28 640000 -- (-3198.584) (-3209.366) [-3206.958] (-3198.050) * (-3198.989) (-3197.394) (-3206.366) [-3197.682] -- 0:01:28 Average standard deviation of split frequencies: 0.001104 640500 -- (-3198.539) (-3203.121) (-3202.134) [-3197.856] * [-3200.497] (-3199.384) (-3205.665) (-3200.743) -- 0:01:28 641000 -- (-3201.796) (-3205.303) [-3194.131] (-3202.031) * (-3197.414) [-3198.160] (-3209.984) (-3199.977) -- 0:01:28 641500 -- (-3210.249) (-3201.742) (-3195.478) [-3196.205] * (-3206.372) [-3198.977] (-3206.182) (-3201.660) -- 0:01:28 642000 -- (-3202.617) (-3202.214) (-3201.595) [-3195.929] * (-3204.060) (-3200.244) (-3211.537) [-3195.726] -- 0:01:28 642500 -- (-3205.005) (-3199.144) [-3199.137] (-3195.480) * (-3198.306) (-3203.002) (-3208.628) [-3198.476] -- 0:01:27 643000 -- [-3204.199] (-3198.434) (-3200.109) (-3196.351) * (-3195.107) (-3199.724) (-3199.559) [-3202.629] -- 0:01:27 643500 -- [-3200.855] (-3194.323) (-3195.951) (-3195.240) * [-3198.617] (-3202.110) (-3204.272) (-3200.312) -- 0:01:27 644000 -- (-3199.345) (-3199.296) (-3201.984) [-3200.150] * [-3197.384] (-3199.262) (-3203.924) (-3197.841) -- 0:01:27 644500 -- [-3196.205] (-3198.920) (-3197.182) (-3201.468) * (-3201.313) [-3197.416] (-3206.631) (-3199.228) -- 0:01:27 645000 -- (-3202.761) [-3207.023] (-3203.386) (-3201.166) * (-3199.856) [-3194.602] (-3200.882) (-3200.962) -- 0:01:27 Average standard deviation of split frequencies: 0.001095 645500 -- [-3202.047] (-3196.994) (-3199.937) (-3196.632) * [-3197.603] (-3205.473) (-3208.711) (-3199.908) -- 0:01:27 646000 -- [-3203.296] (-3196.689) (-3197.987) (-3207.682) * (-3204.126) (-3200.310) (-3201.940) [-3201.004] -- 0:01:27 646500 -- (-3201.238) [-3198.868] (-3202.629) (-3207.444) * [-3196.501] (-3196.332) (-3199.219) (-3199.077) -- 0:01:26 647000 -- (-3201.438) (-3200.407) (-3203.458) [-3203.724] * (-3197.510) (-3198.218) (-3199.899) [-3198.944] -- 0:01:26 647500 -- [-3201.464] (-3195.649) (-3198.458) (-3207.743) * [-3198.969] (-3199.948) (-3202.885) (-3203.782) -- 0:01:26 648000 -- (-3202.926) [-3197.402] (-3199.594) (-3197.206) * (-3198.148) [-3196.055] (-3207.170) (-3197.435) -- 0:01:26 648500 -- [-3198.094] (-3199.274) (-3205.944) (-3205.318) * (-3204.009) [-3200.899] (-3203.253) (-3198.294) -- 0:01:26 649000 -- [-3198.025] (-3201.931) (-3199.710) (-3207.025) * (-3199.712) (-3202.145) [-3202.077] (-3199.552) -- 0:01:26 649500 -- (-3197.558) (-3199.707) (-3200.422) [-3200.070] * (-3204.442) (-3199.400) [-3198.124] (-3199.795) -- 0:01:26 650000 -- (-3199.875) (-3199.177) (-3201.131) [-3200.966] * (-3198.167) (-3205.779) (-3200.733) [-3198.659] -- 0:01:26 Average standard deviation of split frequencies: 0.001087 650500 -- [-3195.182] (-3195.372) (-3197.495) (-3202.253) * (-3200.227) [-3197.351] (-3198.440) (-3199.650) -- 0:01:25 651000 -- [-3201.578] (-3199.369) (-3205.641) (-3199.485) * [-3199.250] (-3201.653) (-3195.167) (-3200.394) -- 0:01:25 651500 -- (-3197.025) (-3200.329) (-3197.420) [-3196.826] * (-3196.060) (-3196.963) [-3194.142] (-3201.105) -- 0:01:25 652000 -- (-3200.561) (-3197.033) [-3195.747] (-3197.122) * (-3196.942) (-3199.456) [-3195.406] (-3203.767) -- 0:01:25 652500 -- (-3203.288) (-3204.551) [-3197.270] (-3202.242) * (-3201.554) (-3204.523) [-3197.517] (-3201.993) -- 0:01:25 653000 -- [-3203.292] (-3197.870) (-3198.079) (-3198.536) * [-3198.973] (-3194.964) (-3199.292) (-3204.500) -- 0:01:25 653500 -- (-3199.949) (-3201.154) [-3199.063] (-3201.242) * (-3199.844) [-3199.015] (-3199.233) (-3194.589) -- 0:01:25 654000 -- (-3200.603) [-3199.204] (-3201.595) (-3203.903) * (-3196.514) (-3203.046) (-3193.629) [-3193.774] -- 0:01:25 654500 -- [-3197.108] (-3201.643) (-3196.269) (-3199.724) * [-3195.766] (-3200.995) (-3195.996) (-3204.572) -- 0:01:24 655000 -- (-3199.932) (-3198.764) [-3194.537] (-3207.753) * (-3202.521) (-3208.092) (-3200.369) [-3199.296] -- 0:01:24 Average standard deviation of split frequencies: 0.001078 655500 -- (-3199.679) (-3199.954) (-3194.385) [-3205.989] * (-3201.043) (-3210.207) (-3198.502) [-3205.255] -- 0:01:24 656000 -- (-3200.403) (-3208.986) [-3201.232] (-3208.708) * (-3199.844) (-3208.709) [-3199.947] (-3196.061) -- 0:01:24 656500 -- (-3200.186) (-3197.600) (-3206.887) [-3197.805] * (-3206.487) [-3203.242] (-3201.604) (-3195.157) -- 0:01:24 657000 -- (-3199.326) (-3198.807) (-3197.935) [-3195.051] * (-3200.116) [-3196.027] (-3206.005) (-3197.588) -- 0:01:24 657500 -- (-3198.248) [-3202.107] (-3200.420) (-3199.891) * [-3201.713] (-3202.845) (-3203.527) (-3197.967) -- 0:01:24 658000 -- [-3200.683] (-3203.540) (-3205.803) (-3201.455) * (-3204.213) [-3196.162] (-3197.852) (-3203.064) -- 0:01:24 658500 -- [-3202.545] (-3199.384) (-3206.676) (-3197.350) * (-3212.195) (-3206.707) (-3196.619) [-3199.352] -- 0:01:24 659000 -- [-3201.048] (-3203.928) (-3199.374) (-3198.040) * (-3204.865) [-3198.848] (-3203.628) (-3193.860) -- 0:01:23 659500 -- [-3202.257] (-3197.663) (-3209.719) (-3194.895) * (-3203.105) (-3209.504) (-3197.059) [-3198.566] -- 0:01:23 660000 -- [-3198.927] (-3203.049) (-3204.905) (-3196.014) * (-3202.346) (-3201.443) [-3198.412] (-3199.189) -- 0:01:23 Average standard deviation of split frequencies: 0.001070 660500 -- (-3201.614) (-3202.946) [-3205.533] (-3202.020) * [-3197.906] (-3202.549) (-3201.089) (-3201.216) -- 0:01:23 661000 -- [-3198.273] (-3197.928) (-3197.603) (-3200.479) * (-3198.245) (-3196.589) [-3199.093] (-3199.299) -- 0:01:23 661500 -- (-3198.610) (-3194.648) [-3195.006] (-3206.939) * (-3202.791) [-3197.502] (-3198.165) (-3203.481) -- 0:01:23 662000 -- [-3202.229] (-3197.608) (-3199.706) (-3203.596) * (-3202.822) (-3202.028) (-3197.734) [-3203.322] -- 0:01:23 662500 -- (-3201.896) (-3197.831) [-3195.160] (-3203.989) * (-3202.303) [-3205.979] (-3201.525) (-3201.525) -- 0:01:23 663000 -- (-3201.867) (-3199.916) [-3197.979] (-3201.777) * (-3197.710) [-3196.963] (-3203.328) (-3202.044) -- 0:01:22 663500 -- (-3205.034) (-3201.303) [-3201.075] (-3196.523) * (-3194.799) (-3202.219) [-3193.850] (-3200.215) -- 0:01:22 664000 -- (-3197.976) (-3201.008) (-3205.834) [-3200.196] * [-3204.210] (-3207.212) (-3198.114) (-3204.053) -- 0:01:22 664500 -- (-3198.285) (-3197.607) (-3197.995) [-3199.044] * (-3201.521) (-3198.045) (-3197.829) [-3197.323] -- 0:01:22 665000 -- (-3193.997) (-3198.291) [-3195.802] (-3201.400) * (-3200.877) [-3197.238] (-3204.270) (-3199.446) -- 0:01:22 Average standard deviation of split frequencies: 0.001062 665500 -- [-3200.693] (-3205.927) (-3197.758) (-3205.716) * (-3200.398) (-3203.573) (-3198.497) [-3195.443] -- 0:01:22 666000 -- (-3197.322) [-3206.653] (-3205.977) (-3207.794) * (-3199.591) (-3197.727) [-3197.959] (-3202.949) -- 0:01:22 666500 -- [-3202.530] (-3199.225) (-3202.463) (-3208.591) * (-3197.779) (-3200.347) (-3200.351) [-3195.875] -- 0:01:22 667000 -- (-3201.856) (-3202.160) (-3197.833) [-3197.596] * [-3204.029] (-3207.827) (-3204.449) (-3196.894) -- 0:01:21 667500 -- (-3203.272) (-3199.353) [-3204.853] (-3199.663) * [-3199.773] (-3201.783) (-3198.527) (-3197.373) -- 0:01:21 668000 -- (-3200.181) [-3197.243] (-3202.450) (-3209.385) * (-3201.201) (-3204.490) [-3197.673] (-3196.642) -- 0:01:21 668500 -- [-3197.014] (-3201.089) (-3205.101) (-3198.294) * [-3199.754] (-3195.497) (-3198.899) (-3202.558) -- 0:01:21 669000 -- [-3198.848] (-3205.418) (-3198.300) (-3198.226) * (-3202.088) (-3202.196) (-3200.396) [-3195.682] -- 0:01:21 669500 -- (-3201.505) (-3204.222) (-3203.385) [-3193.514] * (-3204.960) [-3194.522] (-3200.236) (-3198.171) -- 0:01:21 670000 -- [-3196.273] (-3196.518) (-3197.231) (-3197.315) * (-3201.256) (-3195.403) (-3198.756) [-3199.974] -- 0:01:21 Average standard deviation of split frequencies: 0.001054 670500 -- [-3199.391] (-3197.074) (-3203.389) (-3205.171) * (-3201.077) (-3195.225) [-3202.131] (-3201.132) -- 0:01:21 671000 -- [-3199.222] (-3199.015) (-3195.752) (-3204.689) * (-3199.868) (-3200.228) (-3206.346) [-3203.751] -- 0:01:20 671500 -- (-3196.300) [-3198.572] (-3213.385) (-3203.885) * (-3199.766) (-3200.671) [-3196.960] (-3201.383) -- 0:01:20 672000 -- (-3201.435) [-3201.765] (-3204.684) (-3197.594) * (-3198.179) (-3209.081) [-3200.081] (-3203.726) -- 0:01:20 672500 -- [-3197.038] (-3198.376) (-3196.264) (-3202.250) * (-3197.883) (-3202.249) (-3210.096) [-3203.995] -- 0:01:20 673000 -- (-3197.199) (-3203.037) (-3196.226) [-3198.114] * (-3198.502) (-3199.023) (-3202.922) [-3198.798] -- 0:01:20 673500 -- (-3199.651) [-3204.587] (-3202.293) (-3210.042) * (-3194.308) (-3199.384) [-3198.426] (-3204.616) -- 0:01:20 674000 -- (-3205.889) (-3198.955) (-3199.147) [-3204.591] * [-3199.666] (-3200.803) (-3200.205) (-3198.955) -- 0:01:20 674500 -- [-3200.485] (-3194.320) (-3198.722) (-3205.990) * (-3202.208) [-3203.581] (-3198.377) (-3209.485) -- 0:01:20 675000 -- (-3198.839) (-3195.046) (-3197.722) [-3201.297] * [-3202.222] (-3203.952) (-3196.165) (-3200.778) -- 0:01:19 Average standard deviation of split frequencies: 0.001046 675500 -- (-3201.040) (-3197.355) (-3196.899) [-3199.536] * [-3201.988] (-3196.880) (-3208.785) (-3204.921) -- 0:01:19 676000 -- [-3195.639] (-3204.603) (-3200.742) (-3198.818) * (-3201.297) (-3199.065) (-3196.003) [-3200.723] -- 0:01:19 676500 -- [-3195.456] (-3201.351) (-3208.191) (-3197.173) * [-3206.363] (-3200.269) (-3196.865) (-3204.978) -- 0:01:19 677000 -- (-3200.039) (-3210.907) (-3202.645) [-3201.208] * (-3202.973) [-3204.120] (-3196.572) (-3207.444) -- 0:01:19 677500 -- [-3201.338] (-3205.117) (-3199.402) (-3206.103) * (-3204.350) (-3201.277) [-3203.140] (-3208.268) -- 0:01:19 678000 -- (-3199.096) (-3206.231) (-3199.518) [-3197.291] * (-3201.152) [-3197.944] (-3209.064) (-3207.687) -- 0:01:19 678500 -- (-3199.252) (-3206.323) (-3198.933) [-3198.061] * (-3211.803) [-3195.290] (-3199.161) (-3213.191) -- 0:01:19 679000 -- (-3209.966) (-3201.582) [-3196.698] (-3199.349) * (-3197.850) (-3196.910) (-3198.839) [-3195.764] -- 0:01:18 679500 -- (-3202.832) (-3200.455) (-3200.138) [-3194.154] * (-3200.997) (-3200.570) [-3194.767] (-3207.314) -- 0:01:18 680000 -- (-3197.720) (-3203.609) (-3199.026) [-3199.872] * (-3202.667) [-3201.275] (-3202.190) (-3198.629) -- 0:01:18 Average standard deviation of split frequencies: 0.001039 680500 -- (-3200.237) (-3203.774) [-3202.183] (-3200.057) * (-3198.175) [-3205.522] (-3201.042) (-3200.069) -- 0:01:18 681000 -- (-3206.065) [-3201.349] (-3203.852) (-3197.028) * (-3201.488) [-3205.188] (-3195.576) (-3201.460) -- 0:01:18 681500 -- [-3197.806] (-3203.590) (-3200.461) (-3198.369) * [-3199.189] (-3205.777) (-3196.038) (-3204.686) -- 0:01:18 682000 -- (-3195.693) (-3195.571) (-3209.106) [-3199.119] * (-3207.900) (-3198.385) [-3194.898] (-3204.429) -- 0:01:18 682500 -- (-3198.716) [-3201.711] (-3206.389) (-3199.120) * (-3204.386) (-3198.310) (-3206.916) [-3199.685] -- 0:01:18 683000 -- (-3203.434) (-3198.656) (-3201.981) [-3196.067] * (-3201.219) (-3195.351) (-3203.300) [-3203.546] -- 0:01:17 683500 -- (-3201.239) (-3195.178) (-3207.646) [-3202.633] * [-3198.315] (-3208.550) (-3200.812) (-3195.172) -- 0:01:17 684000 -- (-3197.917) (-3198.797) [-3204.363] (-3200.527) * [-3197.103] (-3201.145) (-3201.397) (-3199.478) -- 0:01:17 684500 -- (-3202.058) (-3201.559) (-3198.621) [-3196.900] * (-3199.274) (-3202.489) [-3198.029] (-3194.090) -- 0:01:17 685000 -- [-3201.016] (-3199.058) (-3200.467) (-3206.421) * (-3201.321) [-3201.411] (-3203.151) (-3196.912) -- 0:01:17 Average standard deviation of split frequencies: 0.001031 685500 -- (-3201.988) [-3202.363] (-3196.194) (-3200.715) * (-3205.501) (-3198.274) [-3197.843] (-3195.726) -- 0:01:17 686000 -- (-3199.235) (-3197.118) [-3202.161] (-3198.528) * [-3197.068] (-3198.289) (-3200.411) (-3206.372) -- 0:01:17 686500 -- (-3202.235) (-3200.046) [-3206.418] (-3196.068) * (-3196.738) [-3204.621] (-3202.678) (-3201.089) -- 0:01:17 687000 -- (-3205.982) [-3198.915] (-3201.585) (-3204.044) * (-3195.858) [-3199.236] (-3198.211) (-3206.256) -- 0:01:16 687500 -- (-3200.217) (-3207.058) (-3195.750) [-3198.960] * [-3197.984] (-3203.595) (-3199.777) (-3205.909) -- 0:01:16 688000 -- (-3204.012) (-3207.231) [-3197.458] (-3199.021) * [-3196.633] (-3202.806) (-3205.812) (-3199.754) -- 0:01:16 688500 -- (-3195.069) [-3204.166] (-3198.535) (-3198.679) * (-3197.075) (-3199.083) (-3199.847) [-3203.019] -- 0:01:16 689000 -- [-3197.741] (-3198.632) (-3193.965) (-3207.414) * (-3195.398) (-3201.855) (-3205.616) [-3194.828] -- 0:01:16 689500 -- (-3196.389) [-3198.701] (-3199.983) (-3196.151) * (-3200.307) (-3198.907) [-3200.799] (-3197.125) -- 0:01:16 690000 -- (-3201.235) (-3205.983) [-3198.728] (-3207.173) * (-3199.004) [-3205.540] (-3198.932) (-3200.906) -- 0:01:16 Average standard deviation of split frequencies: 0.001024 690500 -- (-3196.961) (-3206.328) (-3204.484) [-3200.316] * (-3191.670) (-3208.381) [-3197.145] (-3202.214) -- 0:01:16 691000 -- [-3198.367] (-3207.169) (-3206.441) (-3200.721) * (-3195.745) (-3200.987) [-3198.195] (-3202.510) -- 0:01:16 691500 -- (-3201.377) (-3204.540) [-3204.026] (-3207.552) * (-3197.745) (-3201.109) [-3200.881] (-3196.571) -- 0:01:15 692000 -- (-3200.956) (-3202.301) (-3203.530) [-3198.080] * (-3198.455) (-3202.586) [-3199.631] (-3194.462) -- 0:01:15 692500 -- (-3199.501) (-3207.524) (-3207.949) [-3197.184] * (-3203.850) (-3198.170) (-3199.401) [-3201.817] -- 0:01:15 693000 -- [-3197.327] (-3207.612) (-3198.673) (-3195.089) * (-3194.929) (-3198.714) (-3200.516) [-3198.876] -- 0:01:15 693500 -- (-3201.899) (-3203.278) (-3197.720) [-3202.758] * (-3200.155) (-3198.277) (-3195.762) [-3194.765] -- 0:01:15 694000 -- (-3202.460) (-3200.418) (-3198.325) [-3200.786] * [-3199.294] (-3204.209) (-3201.339) (-3199.634) -- 0:01:15 694500 -- (-3196.131) (-3198.579) [-3200.650] (-3205.460) * (-3198.383) [-3208.602] (-3197.163) (-3202.657) -- 0:01:15 695000 -- [-3204.602] (-3194.546) (-3198.844) (-3198.825) * [-3194.625] (-3205.093) (-3196.081) (-3197.864) -- 0:01:15 Average standard deviation of split frequencies: 0.001016 695500 -- (-3204.106) [-3198.306] (-3196.884) (-3195.813) * (-3197.362) [-3209.786] (-3200.263) (-3199.131) -- 0:01:14 696000 -- (-3201.014) [-3197.657] (-3195.973) (-3205.740) * (-3192.771) (-3199.904) [-3199.174] (-3198.428) -- 0:01:14 696500 -- (-3198.937) (-3209.040) (-3195.326) [-3201.502] * [-3196.142] (-3205.424) (-3205.122) (-3202.604) -- 0:01:14 697000 -- (-3201.999) [-3198.645] (-3207.114) (-3203.227) * (-3205.136) (-3208.752) (-3197.459) [-3202.980] -- 0:01:14 697500 -- (-3196.383) (-3195.199) [-3198.395] (-3202.762) * (-3196.019) (-3199.704) (-3200.821) [-3203.062] -- 0:01:14 698000 -- (-3206.637) [-3196.472] (-3199.023) (-3204.080) * (-3197.734) (-3208.693) (-3201.137) [-3200.593] -- 0:01:14 698500 -- (-3207.613) [-3198.740] (-3199.221) (-3204.278) * (-3199.030) [-3195.997] (-3207.413) (-3199.049) -- 0:01:14 699000 -- (-3200.470) (-3200.131) [-3199.464] (-3197.779) * (-3204.709) (-3200.702) (-3206.753) [-3196.361] -- 0:01:14 699500 -- (-3201.321) [-3198.375] (-3198.786) (-3201.857) * (-3200.945) (-3203.535) (-3200.272) [-3195.167] -- 0:01:13 700000 -- (-3201.435) (-3198.650) (-3198.344) [-3196.348] * (-3201.273) [-3202.113] (-3200.301) (-3196.281) -- 0:01:13 Average standard deviation of split frequencies: 0.001009 700500 -- [-3198.551] (-3198.583) (-3197.959) (-3198.647) * (-3201.426) (-3205.115) (-3204.290) [-3199.700] -- 0:01:13 701000 -- (-3195.765) [-3192.665] (-3199.909) (-3203.682) * (-3197.603) (-3200.176) (-3202.650) [-3200.097] -- 0:01:13 701500 -- (-3199.685) [-3197.883] (-3199.656) (-3201.292) * [-3195.700] (-3202.512) (-3201.257) (-3199.621) -- 0:01:13 702000 -- (-3198.380) [-3200.246] (-3204.491) (-3198.630) * (-3195.987) [-3199.115] (-3201.554) (-3204.681) -- 0:01:13 702500 -- (-3198.210) [-3200.391] (-3199.664) (-3197.694) * [-3201.406] (-3208.252) (-3201.766) (-3200.157) -- 0:01:13 703000 -- (-3199.555) [-3199.867] (-3205.005) (-3197.899) * [-3198.202] (-3197.350) (-3200.352) (-3203.073) -- 0:01:13 703500 -- (-3199.941) (-3195.533) [-3204.938] (-3199.396) * (-3205.803) (-3197.998) [-3200.586] (-3197.369) -- 0:01:12 704000 -- (-3199.135) (-3196.959) (-3201.052) [-3203.627] * (-3204.181) (-3201.397) (-3205.132) [-3199.621] -- 0:01:12 704500 -- (-3199.830) (-3199.401) [-3196.217] (-3204.741) * (-3197.716) [-3196.575] (-3204.095) (-3203.488) -- 0:01:12 705000 -- [-3198.996] (-3204.430) (-3202.656) (-3196.879) * [-3195.001] (-3201.599) (-3198.419) (-3198.516) -- 0:01:12 Average standard deviation of split frequencies: 0.001002 705500 -- [-3196.750] (-3207.321) (-3196.455) (-3200.628) * (-3205.587) [-3198.899] (-3202.678) (-3212.307) -- 0:01:12 706000 -- [-3200.171] (-3209.182) (-3198.671) (-3197.131) * [-3200.645] (-3197.089) (-3199.781) (-3203.871) -- 0:01:12 706500 -- [-3207.891] (-3203.253) (-3193.947) (-3199.707) * (-3205.974) (-3199.168) [-3196.789] (-3201.310) -- 0:01:12 707000 -- (-3196.980) (-3199.665) [-3199.219] (-3197.281) * [-3203.219] (-3198.254) (-3202.870) (-3198.160) -- 0:01:12 707500 -- [-3198.988] (-3203.224) (-3200.291) (-3202.726) * [-3199.666] (-3196.494) (-3207.934) (-3209.808) -- 0:01:11 708000 -- [-3197.545] (-3193.461) (-3214.803) (-3204.492) * (-3196.273) (-3209.153) (-3201.845) [-3201.706] -- 0:01:11 708500 -- (-3199.163) [-3200.767] (-3203.110) (-3194.510) * (-3199.126) (-3205.623) [-3209.501] (-3202.865) -- 0:01:11 709000 -- (-3194.859) (-3198.368) (-3207.213) [-3199.283] * (-3201.611) [-3204.471] (-3201.398) (-3210.314) -- 0:01:11 709500 -- (-3196.769) (-3200.557) [-3200.424] (-3212.990) * [-3207.606] (-3200.779) (-3212.356) (-3206.528) -- 0:01:11 710000 -- [-3203.353] (-3206.296) (-3199.019) (-3201.107) * (-3196.056) [-3197.257] (-3199.817) (-3199.279) -- 0:01:11 Average standard deviation of split frequencies: 0.000995 710500 -- (-3208.952) (-3200.787) [-3199.402] (-3198.922) * (-3203.920) [-3200.278] (-3203.975) (-3196.242) -- 0:01:11 711000 -- (-3205.639) (-3199.344) (-3204.497) [-3198.040] * (-3199.085) (-3201.020) (-3202.985) [-3199.755] -- 0:01:11 711500 -- [-3201.165] (-3203.723) (-3194.678) (-3197.600) * (-3196.166) [-3196.351] (-3209.983) (-3202.199) -- 0:01:10 712000 -- [-3200.390] (-3198.155) (-3206.995) (-3206.653) * (-3198.371) [-3196.389] (-3194.847) (-3202.625) -- 0:01:10 712500 -- [-3200.949] (-3212.606) (-3199.090) (-3203.397) * (-3203.713) (-3207.503) [-3195.090] (-3198.187) -- 0:01:10 713000 -- [-3204.935] (-3199.075) (-3200.048) (-3203.051) * (-3198.459) [-3200.836] (-3205.259) (-3201.617) -- 0:01:10 713500 -- (-3204.249) [-3203.523] (-3193.120) (-3201.968) * (-3197.763) [-3200.163] (-3204.361) (-3203.519) -- 0:01:10 714000 -- (-3202.604) (-3209.098) [-3197.792] (-3201.688) * (-3199.172) (-3198.954) [-3198.601] (-3201.355) -- 0:01:10 714500 -- (-3201.577) [-3201.847] (-3199.608) (-3196.292) * (-3204.281) [-3198.438] (-3194.269) (-3196.488) -- 0:01:10 715000 -- (-3210.129) (-3202.711) [-3198.986] (-3198.187) * (-3193.885) [-3203.924] (-3195.756) (-3197.249) -- 0:01:10 Average standard deviation of split frequencies: 0.000988 715500 -- [-3199.649] (-3201.468) (-3202.160) (-3195.789) * (-3203.520) (-3204.165) [-3199.849] (-3196.408) -- 0:01:09 716000 -- (-3207.303) (-3198.232) [-3196.956] (-3199.043) * (-3200.930) (-3203.623) (-3201.116) [-3194.910] -- 0:01:09 716500 -- (-3199.137) (-3198.992) [-3200.546] (-3196.868) * (-3199.878) (-3197.440) [-3200.853] (-3200.192) -- 0:01:09 717000 -- (-3203.810) (-3199.939) [-3196.005] (-3201.362) * [-3194.957] (-3200.445) (-3203.830) (-3196.901) -- 0:01:09 717500 -- [-3197.655] (-3198.253) (-3198.926) (-3197.695) * (-3196.942) (-3202.365) (-3203.478) [-3199.933] -- 0:01:09 718000 -- (-3199.163) [-3197.548] (-3207.579) (-3202.371) * (-3199.414) (-3202.854) (-3200.684) [-3198.640] -- 0:01:09 718500 -- (-3205.195) (-3196.637) [-3198.357] (-3200.520) * [-3197.304] (-3203.154) (-3201.515) (-3203.065) -- 0:01:09 719000 -- (-3204.114) (-3200.149) (-3202.905) [-3201.284] * [-3201.606] (-3206.359) (-3202.934) (-3206.326) -- 0:01:09 719500 -- (-3199.054) [-3198.055] (-3200.265) (-3199.065) * (-3204.323) [-3197.812] (-3197.188) (-3197.904) -- 0:01:09 720000 -- (-3207.358) (-3202.435) (-3208.454) [-3195.023] * [-3199.934] (-3198.825) (-3200.691) (-3201.784) -- 0:01:08 Average standard deviation of split frequencies: 0.000981 720500 -- (-3206.772) [-3206.028] (-3201.309) (-3198.028) * (-3194.662) (-3197.681) [-3194.169] (-3209.119) -- 0:01:08 721000 -- (-3201.605) (-3202.634) (-3199.090) [-3196.168] * (-3204.423) [-3197.992] (-3199.501) (-3202.904) -- 0:01:08 721500 -- (-3199.076) (-3193.703) [-3197.762] (-3204.947) * (-3207.425) (-3194.344) [-3197.065] (-3202.939) -- 0:01:08 722000 -- (-3197.529) (-3204.860) [-3201.888] (-3198.808) * (-3201.230) (-3199.590) [-3203.411] (-3198.704) -- 0:01:08 722500 -- (-3198.710) (-3210.710) [-3199.148] (-3200.835) * (-3205.949) (-3198.758) [-3204.799] (-3199.855) -- 0:01:08 723000 -- (-3207.565) (-3200.499) [-3196.613] (-3199.133) * [-3197.010] (-3198.759) (-3204.262) (-3197.944) -- 0:01:08 723500 -- [-3198.365] (-3200.850) (-3203.837) (-3197.520) * (-3203.239) (-3198.007) [-3199.254] (-3203.974) -- 0:01:08 724000 -- (-3196.532) [-3201.567] (-3207.617) (-3199.808) * (-3199.738) [-3199.172] (-3195.520) (-3208.877) -- 0:01:07 724500 -- (-3205.424) [-3198.724] (-3205.044) (-3198.878) * (-3216.797) (-3200.535) [-3198.741] (-3208.476) -- 0:01:07 725000 -- (-3197.187) (-3202.570) (-3199.682) [-3198.440] * (-3196.879) (-3197.508) [-3199.876] (-3198.462) -- 0:01:07 Average standard deviation of split frequencies: 0.000974 725500 -- [-3197.744] (-3199.845) (-3200.488) (-3200.132) * (-3195.995) (-3202.606) [-3197.790] (-3206.227) -- 0:01:07 726000 -- [-3194.043] (-3197.866) (-3204.745) (-3200.628) * (-3198.127) (-3199.137) [-3200.281] (-3203.895) -- 0:01:07 726500 -- [-3193.930] (-3207.705) (-3201.995) (-3197.755) * (-3214.496) (-3203.829) [-3197.076] (-3197.767) -- 0:01:07 727000 -- [-3193.717] (-3199.856) (-3196.870) (-3192.807) * (-3201.018) (-3202.354) (-3201.472) [-3200.838] -- 0:01:07 727500 -- [-3203.023] (-3201.108) (-3206.154) (-3203.119) * (-3201.474) (-3199.063) [-3198.729] (-3199.092) -- 0:01:07 728000 -- (-3194.925) (-3199.939) (-3201.966) [-3201.842] * (-3202.597) (-3211.586) (-3204.041) [-3197.029] -- 0:01:06 728500 -- (-3199.180) (-3203.627) (-3196.276) [-3204.789] * (-3198.834) (-3209.655) [-3197.907] (-3209.599) -- 0:01:06 729000 -- (-3195.653) [-3196.167] (-3197.981) (-3210.777) * (-3199.934) [-3197.462] (-3199.657) (-3203.711) -- 0:01:06 729500 -- (-3197.273) (-3194.795) [-3199.747] (-3200.909) * (-3202.586) [-3197.593] (-3198.177) (-3198.140) -- 0:01:06 730000 -- (-3204.996) [-3197.750] (-3201.274) (-3204.282) * (-3201.128) (-3197.148) (-3206.219) [-3200.240] -- 0:01:06 Average standard deviation of split frequencies: 0.000968 730500 -- [-3202.509] (-3200.903) (-3197.847) (-3206.366) * (-3207.676) [-3195.491] (-3202.486) (-3201.121) -- 0:01:06 731000 -- (-3207.516) [-3200.391] (-3198.840) (-3199.260) * (-3202.002) (-3205.458) (-3199.993) [-3200.375] -- 0:01:06 731500 -- (-3214.650) [-3198.182] (-3205.053) (-3204.890) * (-3198.256) [-3200.036] (-3203.035) (-3196.116) -- 0:01:06 732000 -- [-3199.740] (-3200.799) (-3199.098) (-3202.440) * (-3202.820) (-3199.959) [-3198.899] (-3199.576) -- 0:01:05 732500 -- (-3199.509) (-3203.779) (-3194.086) [-3199.901] * (-3204.185) (-3199.069) (-3197.937) [-3191.937] -- 0:01:05 733000 -- (-3201.794) (-3199.602) (-3203.607) [-3202.108] * (-3205.372) (-3203.690) (-3198.894) [-3194.515] -- 0:01:05 733500 -- [-3197.338] (-3199.818) (-3205.462) (-3196.973) * (-3202.391) (-3199.796) (-3210.990) [-3196.690] -- 0:01:05 734000 -- (-3212.866) (-3205.255) [-3197.769] (-3197.646) * (-3199.627) (-3201.895) (-3199.099) [-3199.506] -- 0:01:05 734500 -- (-3207.371) (-3202.242) [-3201.614] (-3197.016) * (-3196.384) [-3209.013] (-3201.490) (-3200.325) -- 0:01:05 735000 -- (-3199.072) (-3200.032) (-3198.382) [-3199.320] * [-3198.080] (-3199.305) (-3193.978) (-3204.444) -- 0:01:05 Average standard deviation of split frequencies: 0.000961 735500 -- (-3204.368) [-3202.220] (-3199.734) (-3200.899) * (-3196.929) (-3201.180) (-3197.745) [-3201.798] -- 0:01:05 736000 -- (-3197.958) (-3197.517) (-3200.237) [-3202.618] * (-3198.228) (-3201.079) (-3201.173) [-3196.663] -- 0:01:04 736500 -- [-3209.785] (-3200.489) (-3198.543) (-3200.990) * [-3197.010] (-3195.354) (-3214.826) (-3196.084) -- 0:01:04 737000 -- (-3199.811) (-3198.612) (-3200.308) [-3197.909] * (-3201.014) [-3199.778] (-3202.773) (-3200.127) -- 0:01:04 737500 -- (-3202.053) [-3199.019] (-3203.979) (-3197.018) * (-3202.529) [-3196.047] (-3203.586) (-3201.492) -- 0:01:04 738000 -- (-3202.319) (-3195.050) [-3197.441] (-3199.879) * (-3195.911) (-3197.611) [-3201.916] (-3200.696) -- 0:01:04 738500 -- [-3203.733] (-3197.723) (-3198.550) (-3202.415) * (-3198.125) (-3199.412) (-3202.758) [-3203.030] -- 0:01:04 739000 -- (-3204.692) (-3202.014) [-3202.817] (-3207.238) * (-3197.376) (-3196.295) (-3205.928) [-3200.699] -- 0:01:04 739500 -- (-3209.030) [-3197.876] (-3206.401) (-3197.796) * [-3204.959] (-3199.528) (-3201.160) (-3205.648) -- 0:01:04 740000 -- (-3203.271) (-3206.286) (-3196.418) [-3202.370] * (-3200.762) (-3200.120) [-3201.158] (-3207.822) -- 0:01:03 Average standard deviation of split frequencies: 0.000955 740500 -- (-3204.506) (-3205.661) (-3196.549) [-3205.424] * [-3197.897] (-3199.780) (-3202.374) (-3203.060) -- 0:01:03 741000 -- (-3201.770) (-3199.763) [-3201.182] (-3202.087) * (-3204.133) [-3205.424] (-3202.382) (-3202.363) -- 0:01:03 741500 -- (-3205.276) (-3204.499) (-3196.210) [-3196.389] * [-3201.455] (-3199.575) (-3201.645) (-3200.937) -- 0:01:03 742000 -- (-3200.667) (-3201.076) (-3206.015) [-3198.877] * [-3204.181] (-3197.738) (-3197.606) (-3198.052) -- 0:01:03 742500 -- (-3198.192) (-3204.480) (-3203.932) [-3199.681] * (-3207.736) (-3199.545) (-3202.760) [-3195.720] -- 0:01:03 743000 -- (-3198.467) [-3201.915] (-3201.671) (-3203.924) * [-3196.547] (-3199.131) (-3197.348) (-3197.525) -- 0:01:03 743500 -- [-3199.357] (-3205.658) (-3206.055) (-3210.672) * [-3193.879] (-3201.783) (-3198.488) (-3198.350) -- 0:01:03 744000 -- [-3201.629] (-3203.372) (-3207.556) (-3209.997) * [-3199.329] (-3202.868) (-3206.362) (-3203.828) -- 0:01:02 744500 -- (-3200.779) [-3202.225] (-3199.837) (-3206.173) * [-3205.400] (-3193.885) (-3203.066) (-3198.537) -- 0:01:02 745000 -- (-3199.219) [-3200.143] (-3192.088) (-3199.847) * [-3202.182] (-3196.374) (-3203.248) (-3198.081) -- 0:01:02 Average standard deviation of split frequencies: 0.000948 745500 -- (-3202.577) (-3207.811) [-3196.739] (-3199.554) * [-3199.881] (-3204.183) (-3199.356) (-3202.286) -- 0:01:02 746000 -- (-3198.757) [-3198.381] (-3200.467) (-3206.705) * [-3195.992] (-3204.680) (-3198.652) (-3200.928) -- 0:01:02 746500 -- [-3208.971] (-3202.719) (-3206.800) (-3205.907) * (-3198.683) (-3209.684) (-3201.207) [-3205.413] -- 0:01:02 747000 -- (-3200.637) (-3206.146) (-3196.740) [-3207.595] * (-3197.798) (-3201.437) [-3201.493] (-3204.906) -- 0:01:02 747500 -- (-3202.693) [-3205.295] (-3195.903) (-3200.135) * [-3195.842] (-3202.727) (-3197.463) (-3202.313) -- 0:01:02 748000 -- [-3198.086] (-3199.682) (-3198.640) (-3199.749) * [-3200.529] (-3201.704) (-3205.043) (-3199.429) -- 0:01:01 748500 -- (-3197.848) (-3203.924) (-3200.218) [-3199.931] * [-3196.338] (-3201.081) (-3199.484) (-3200.483) -- 0:01:01 749000 -- [-3194.856] (-3198.340) (-3194.747) (-3203.038) * (-3200.534) (-3203.249) [-3195.607] (-3199.702) -- 0:01:01 749500 -- (-3201.949) [-3201.960] (-3196.603) (-3198.258) * (-3204.561) (-3202.224) [-3198.947] (-3202.928) -- 0:01:01 750000 -- (-3202.753) [-3199.325] (-3204.081) (-3204.564) * [-3200.309] (-3204.127) (-3203.898) (-3199.636) -- 0:01:01 Average standard deviation of split frequencies: 0.000942 750500 -- [-3197.213] (-3205.107) (-3197.227) (-3197.950) * (-3197.173) (-3201.563) (-3200.262) [-3201.712] -- 0:01:01 751000 -- (-3202.126) (-3202.609) (-3206.881) [-3198.556] * (-3203.218) (-3202.187) (-3200.360) [-3206.641] -- 0:01:01 751500 -- (-3204.027) [-3195.461] (-3200.251) (-3201.075) * (-3200.802) (-3204.328) [-3200.330] (-3207.917) -- 0:01:01 752000 -- (-3197.457) (-3197.134) [-3205.528] (-3199.506) * [-3195.103] (-3200.761) (-3201.837) (-3203.066) -- 0:01:01 752500 -- [-3198.672] (-3198.177) (-3196.844) (-3201.455) * [-3198.824] (-3198.673) (-3200.373) (-3207.428) -- 0:01:00 753000 -- (-3200.155) (-3203.349) [-3193.912] (-3209.382) * (-3201.339) (-3203.607) [-3198.275] (-3197.498) -- 0:01:00 753500 -- (-3200.566) [-3200.292] (-3196.835) (-3206.792) * (-3200.460) (-3205.212) (-3199.929) [-3200.784] -- 0:01:00 754000 -- [-3195.657] (-3201.001) (-3196.621) (-3201.965) * [-3197.231] (-3202.660) (-3195.492) (-3200.421) -- 0:01:00 754500 -- (-3197.714) (-3199.956) [-3201.347] (-3198.204) * (-3201.928) (-3210.814) (-3200.171) [-3200.188] -- 0:01:00 755000 -- (-3193.000) (-3202.901) [-3198.508] (-3208.994) * (-3197.417) (-3201.712) [-3201.291] (-3199.910) -- 0:01:00 Average standard deviation of split frequencies: 0.000935 755500 -- (-3196.138) (-3197.879) [-3202.908] (-3208.267) * (-3201.452) (-3202.246) (-3200.315) [-3196.770] -- 0:01:00 756000 -- [-3199.029] (-3199.008) (-3199.041) (-3213.802) * (-3200.289) (-3205.856) (-3200.144) [-3198.725] -- 0:01:00 756500 -- (-3198.521) (-3210.746) [-3196.790] (-3197.498) * [-3197.080] (-3204.721) (-3202.674) (-3200.931) -- 0:00:59 757000 -- (-3205.068) (-3197.710) (-3195.458) [-3203.046] * (-3197.902) (-3198.444) (-3206.435) [-3203.582] -- 0:00:59 757500 -- [-3200.162] (-3201.731) (-3203.531) (-3202.146) * [-3203.029] (-3197.350) (-3212.169) (-3203.708) -- 0:00:59 758000 -- (-3203.381) (-3206.752) [-3200.233] (-3199.245) * [-3196.706] (-3202.350) (-3199.312) (-3197.219) -- 0:00:59 758500 -- [-3198.552] (-3199.293) (-3207.756) (-3197.691) * (-3204.870) (-3203.042) [-3198.707] (-3201.877) -- 0:00:59 759000 -- [-3201.508] (-3203.714) (-3208.167) (-3197.078) * [-3197.277] (-3196.157) (-3205.716) (-3192.170) -- 0:00:59 759500 -- (-3198.717) (-3194.745) [-3205.831] (-3202.336) * (-3197.094) [-3202.576] (-3210.197) (-3207.136) -- 0:00:59 760000 -- (-3198.634) (-3198.191) (-3209.741) [-3197.818] * (-3200.052) (-3198.261) [-3200.727] (-3208.634) -- 0:00:59 Average standard deviation of split frequencies: 0.000930 760500 -- (-3200.628) (-3196.185) (-3197.060) [-3196.620] * [-3199.217] (-3199.729) (-3204.285) (-3200.104) -- 0:00:58 761000 -- [-3195.421] (-3207.609) (-3202.595) (-3196.669) * (-3204.235) (-3199.771) (-3210.486) [-3203.852] -- 0:00:58 761500 -- (-3198.802) (-3198.987) (-3199.021) [-3194.259] * [-3203.309] (-3195.603) (-3214.670) (-3201.291) -- 0:00:58 762000 -- (-3201.161) [-3198.322] (-3199.421) (-3204.875) * (-3199.299) [-3201.539] (-3207.646) (-3203.299) -- 0:00:58 762500 -- (-3201.525) [-3201.006] (-3214.103) (-3207.407) * [-3199.221] (-3205.743) (-3207.871) (-3202.595) -- 0:00:58 763000 -- (-3195.195) (-3205.217) [-3203.641] (-3199.624) * (-3194.706) [-3195.498] (-3208.074) (-3201.954) -- 0:00:58 763500 -- (-3201.898) [-3196.267] (-3197.858) (-3200.339) * (-3200.839) [-3194.652] (-3196.962) (-3208.017) -- 0:00:58 764000 -- (-3202.874) (-3202.911) (-3206.330) [-3203.653] * (-3199.931) [-3197.027] (-3207.489) (-3206.716) -- 0:00:58 764500 -- (-3201.822) [-3198.723] (-3212.114) (-3198.069) * [-3198.450] (-3197.386) (-3200.220) (-3201.614) -- 0:00:57 765000 -- [-3200.758] (-3205.266) (-3197.357) (-3199.817) * (-3201.572) (-3200.359) (-3202.512) [-3203.916] -- 0:00:57 Average standard deviation of split frequencies: 0.000923 765500 -- (-3198.447) (-3195.703) (-3205.532) [-3194.681] * (-3197.528) [-3194.247] (-3204.471) (-3196.216) -- 0:00:57 766000 -- [-3193.184] (-3198.264) (-3199.367) (-3199.352) * (-3200.598) (-3202.456) [-3199.202] (-3199.900) -- 0:00:57 766500 -- (-3195.947) [-3194.497] (-3202.113) (-3202.625) * [-3201.883] (-3196.547) (-3200.535) (-3194.912) -- 0:00:57 767000 -- (-3199.938) (-3199.092) (-3199.431) [-3200.310] * (-3206.157) (-3202.584) [-3197.099] (-3201.126) -- 0:00:57 767500 -- (-3199.284) [-3196.715] (-3200.735) (-3193.197) * [-3201.284] (-3205.092) (-3200.551) (-3204.385) -- 0:00:57 768000 -- (-3196.098) (-3197.331) (-3207.634) [-3201.136] * [-3201.650] (-3199.101) (-3196.055) (-3200.331) -- 0:00:57 768500 -- [-3195.241] (-3203.952) (-3204.674) (-3200.432) * (-3205.864) (-3196.964) [-3200.061] (-3202.926) -- 0:00:56 769000 -- (-3205.189) (-3201.697) (-3200.507) [-3200.691] * (-3197.419) (-3195.472) (-3196.303) [-3201.715] -- 0:00:56 769500 -- (-3198.236) (-3201.127) [-3192.706] (-3201.480) * (-3198.967) (-3200.238) (-3198.637) [-3195.409] -- 0:00:56 770000 -- (-3202.253) [-3194.655] (-3204.718) (-3198.261) * (-3194.855) (-3198.553) (-3201.220) [-3206.335] -- 0:00:56 Average standard deviation of split frequencies: 0.000918 770500 -- (-3205.464) [-3201.441] (-3196.970) (-3200.940) * (-3205.243) (-3198.415) [-3197.050] (-3199.606) -- 0:00:56 771000 -- (-3195.953) [-3199.250] (-3201.037) (-3202.157) * (-3200.395) [-3196.856] (-3196.280) (-3199.074) -- 0:00:56 771500 -- [-3201.284] (-3202.250) (-3197.102) (-3198.751) * (-3199.385) (-3199.393) [-3200.925] (-3202.534) -- 0:00:56 772000 -- [-3204.373] (-3197.634) (-3198.367) (-3197.499) * (-3203.777) [-3194.406] (-3202.864) (-3197.875) -- 0:00:56 772500 -- (-3201.756) (-3202.975) (-3198.068) [-3196.073] * (-3200.722) (-3195.567) [-3196.072] (-3200.259) -- 0:00:55 773000 -- (-3204.107) [-3194.416] (-3197.217) (-3204.385) * (-3208.579) (-3202.390) [-3199.321] (-3202.330) -- 0:00:55 773500 -- (-3203.563) (-3198.415) [-3195.620] (-3200.956) * (-3200.942) (-3196.518) [-3201.896] (-3203.695) -- 0:00:55 774000 -- (-3203.067) [-3198.994] (-3201.331) (-3203.394) * (-3195.746) [-3201.763] (-3197.432) (-3211.755) -- 0:00:55 774500 -- (-3202.336) (-3199.042) (-3203.752) [-3205.045] * [-3197.371] (-3198.629) (-3204.526) (-3207.511) -- 0:00:55 775000 -- (-3203.575) (-3196.859) [-3195.180] (-3199.291) * (-3199.305) (-3194.441) (-3200.775) [-3197.864] -- 0:00:55 Average standard deviation of split frequencies: 0.000911 775500 -- (-3201.356) (-3199.323) [-3199.112] (-3203.228) * (-3196.184) (-3201.238) [-3196.942] (-3204.652) -- 0:00:55 776000 -- (-3201.024) (-3199.030) (-3206.244) [-3198.583] * (-3196.223) (-3201.048) (-3204.485) [-3199.510] -- 0:00:55 776500 -- (-3199.582) (-3195.292) (-3205.054) [-3197.115] * (-3194.859) (-3198.561) [-3199.702] (-3203.846) -- 0:00:54 777000 -- (-3195.198) (-3197.100) [-3199.881] (-3198.245) * [-3195.799] (-3202.625) (-3197.822) (-3200.084) -- 0:00:54 777500 -- [-3199.194] (-3202.293) (-3204.483) (-3200.076) * [-3196.304] (-3200.051) (-3199.534) (-3198.888) -- 0:00:54 778000 -- (-3203.112) (-3198.426) [-3200.823] (-3202.343) * [-3204.795] (-3195.645) (-3201.202) (-3198.048) -- 0:00:54 778500 -- (-3205.416) (-3195.737) [-3200.306] (-3199.203) * (-3196.947) (-3197.735) (-3201.684) [-3195.342] -- 0:00:54 779000 -- (-3198.501) (-3201.419) (-3196.788) [-3196.920] * (-3201.381) [-3196.842] (-3197.971) (-3198.394) -- 0:00:54 779500 -- (-3194.344) (-3199.644) [-3197.566] (-3201.615) * (-3198.379) [-3200.854] (-3200.506) (-3201.858) -- 0:00:54 780000 -- (-3199.732) [-3206.092] (-3198.403) (-3201.787) * (-3199.238) (-3202.050) [-3199.273] (-3209.585) -- 0:00:54 Average standard deviation of split frequencies: 0.000906 780500 -- (-3201.383) (-3202.276) [-3203.581] (-3200.929) * (-3195.093) [-3200.796] (-3195.700) (-3205.665) -- 0:00:53 781000 -- [-3196.951] (-3206.676) (-3202.598) (-3204.418) * (-3199.388) [-3195.148] (-3197.995) (-3202.368) -- 0:00:53 781500 -- (-3196.478) (-3203.106) [-3195.734] (-3197.460) * (-3208.282) (-3199.383) [-3201.469] (-3195.429) -- 0:00:53 782000 -- [-3202.078] (-3199.338) (-3201.834) (-3199.405) * (-3203.379) [-3197.642] (-3204.538) (-3198.235) -- 0:00:53 782500 -- (-3199.567) (-3196.536) (-3200.413) [-3200.860] * (-3207.490) [-3201.227] (-3194.327) (-3197.238) -- 0:00:53 783000 -- (-3201.838) (-3195.578) [-3199.034] (-3195.874) * (-3194.609) (-3205.841) (-3198.608) [-3195.692] -- 0:00:53 783500 -- [-3198.647] (-3196.647) (-3200.512) (-3197.037) * (-3197.715) (-3207.796) [-3200.819] (-3201.760) -- 0:00:53 784000 -- (-3198.953) [-3202.799] (-3196.142) (-3196.157) * (-3199.381) [-3204.725] (-3200.801) (-3197.519) -- 0:00:53 784500 -- [-3204.178] (-3204.724) (-3200.383) (-3201.228) * [-3200.914] (-3201.626) (-3198.182) (-3203.661) -- 0:00:53 785000 -- [-3197.839] (-3206.240) (-3196.098) (-3198.714) * (-3197.365) [-3200.315] (-3193.440) (-3200.710) -- 0:00:52 Average standard deviation of split frequencies: 0.000900 785500 -- (-3204.399) (-3201.073) (-3204.980) [-3205.108] * [-3197.528] (-3204.689) (-3199.542) (-3194.622) -- 0:00:52 786000 -- (-3202.808) (-3197.391) (-3198.450) [-3212.267] * [-3194.801] (-3203.495) (-3211.383) (-3201.029) -- 0:00:52 786500 -- (-3202.227) (-3198.067) (-3200.614) [-3197.182] * (-3195.616) (-3197.306) (-3197.174) [-3198.994] -- 0:00:52 787000 -- (-3199.838) (-3205.915) (-3197.494) [-3196.606] * (-3202.748) (-3198.036) [-3197.810] (-3206.068) -- 0:00:52 787500 -- (-3204.673) (-3202.885) [-3203.501] (-3199.974) * (-3204.079) (-3199.483) [-3196.796] (-3218.270) -- 0:00:52 788000 -- (-3197.044) (-3204.202) [-3196.522] (-3193.063) * (-3198.517) (-3199.335) (-3197.638) [-3195.589] -- 0:00:52 788500 -- (-3196.989) (-3204.922) [-3201.042] (-3202.418) * (-3194.666) (-3197.033) (-3200.146) [-3195.148] -- 0:00:52 789000 -- [-3201.819] (-3201.889) (-3205.489) (-3205.721) * (-3198.923) [-3197.300] (-3201.942) (-3196.507) -- 0:00:51 789500 -- (-3206.984) (-3199.467) [-3195.995] (-3198.161) * (-3197.130) (-3200.704) (-3199.103) [-3197.408] -- 0:00:51 790000 -- (-3203.509) (-3198.974) [-3200.122] (-3201.392) * (-3197.097) [-3195.608] (-3202.292) (-3194.044) -- 0:00:51 Average standard deviation of split frequencies: 0.000894 790500 -- (-3202.374) (-3199.015) (-3200.270) [-3195.921] * (-3203.257) (-3198.582) [-3200.573] (-3194.047) -- 0:00:51 791000 -- (-3193.048) (-3200.652) [-3200.536] (-3197.583) * (-3201.475) (-3202.552) [-3199.328] (-3197.670) -- 0:00:51 791500 -- [-3197.952] (-3203.996) (-3195.654) (-3199.290) * (-3198.277) (-3198.748) [-3199.298] (-3196.234) -- 0:00:51 792000 -- (-3197.686) (-3207.129) (-3206.936) [-3201.438] * (-3193.557) (-3198.959) [-3197.939] (-3198.909) -- 0:00:51 792500 -- (-3201.898) (-3199.622) [-3200.326] (-3201.202) * [-3196.800] (-3198.655) (-3207.550) (-3197.815) -- 0:00:51 793000 -- (-3198.230) (-3194.145) [-3196.680] (-3199.540) * (-3204.131) (-3203.593) [-3199.290] (-3198.340) -- 0:00:50 793500 -- (-3193.955) (-3197.374) [-3199.337] (-3200.461) * (-3202.557) [-3199.353] (-3203.100) (-3198.621) -- 0:00:50 794000 -- (-3199.991) (-3199.318) (-3202.918) [-3200.176] * [-3196.728] (-3199.382) (-3194.453) (-3201.148) -- 0:00:50 794500 -- (-3201.784) (-3206.664) [-3200.315] (-3205.219) * [-3202.756] (-3199.687) (-3194.947) (-3201.345) -- 0:00:50 795000 -- (-3199.102) (-3199.994) (-3198.074) [-3194.451] * (-3193.650) (-3200.667) (-3201.636) [-3201.429] -- 0:00:50 Average standard deviation of split frequencies: 0.000888 795500 -- (-3203.001) [-3197.734] (-3200.718) (-3207.613) * [-3193.017] (-3198.638) (-3204.112) (-3205.892) -- 0:00:50 796000 -- (-3197.530) (-3202.035) (-3198.188) [-3198.098] * [-3199.879] (-3197.789) (-3203.198) (-3205.883) -- 0:00:50 796500 -- [-3196.366] (-3197.781) (-3196.006) (-3199.833) * (-3202.630) [-3199.340] (-3198.192) (-3199.411) -- 0:00:50 797000 -- (-3197.093) (-3197.030) [-3202.536] (-3200.129) * (-3202.319) (-3201.243) (-3198.216) [-3198.419] -- 0:00:49 797500 -- (-3196.950) (-3206.283) (-3199.930) [-3197.398] * (-3203.626) (-3198.089) (-3198.676) [-3198.431] -- 0:00:49 798000 -- (-3195.640) [-3202.509] (-3195.927) (-3202.649) * (-3203.997) (-3196.887) [-3200.611] (-3201.431) -- 0:00:49 798500 -- [-3195.698] (-3210.017) (-3206.604) (-3199.130) * [-3202.007] (-3199.839) (-3201.439) (-3198.273) -- 0:00:49 799000 -- [-3196.163] (-3200.998) (-3201.368) (-3199.065) * (-3201.732) [-3197.957] (-3200.501) (-3202.624) -- 0:00:49 799500 -- [-3197.061] (-3200.291) (-3198.439) (-3194.745) * (-3200.685) (-3203.904) (-3208.862) [-3200.069] -- 0:00:49 800000 -- (-3200.559) (-3198.607) [-3195.473] (-3199.572) * (-3200.964) [-3201.308] (-3214.470) (-3203.098) -- 0:00:49 Average standard deviation of split frequencies: 0.000883 800500 -- [-3202.818] (-3196.200) (-3196.291) (-3210.087) * (-3196.649) (-3199.804) (-3203.971) [-3194.923] -- 0:00:49 801000 -- (-3199.225) (-3197.067) (-3196.246) [-3202.678] * [-3197.480] (-3200.019) (-3203.519) (-3199.385) -- 0:00:48 801500 -- (-3204.069) [-3196.846] (-3199.281) (-3208.886) * [-3200.807] (-3198.968) (-3213.683) (-3197.457) -- 0:00:48 802000 -- (-3198.140) [-3196.595] (-3207.160) (-3206.342) * (-3201.172) (-3204.479) (-3196.298) [-3198.074] -- 0:00:48 802500 -- (-3196.916) [-3200.325] (-3202.950) (-3202.916) * (-3194.179) (-3201.634) (-3202.751) [-3205.665] -- 0:00:48 803000 -- [-3194.760] (-3206.201) (-3204.141) (-3196.932) * [-3199.087] (-3199.790) (-3197.969) (-3199.788) -- 0:00:48 803500 -- [-3193.430] (-3200.628) (-3203.368) (-3206.733) * (-3203.949) (-3203.009) [-3195.639] (-3195.230) -- 0:00:48 804000 -- (-3201.350) [-3200.798] (-3204.487) (-3206.705) * (-3207.504) (-3203.165) (-3209.430) [-3195.508] -- 0:00:48 804500 -- [-3202.393] (-3199.481) (-3196.215) (-3198.950) * (-3199.848) (-3206.036) (-3208.890) [-3193.465] -- 0:00:48 805000 -- (-3203.317) [-3198.694] (-3197.215) (-3201.068) * [-3202.368] (-3203.109) (-3202.560) (-3198.828) -- 0:00:47 Average standard deviation of split frequencies: 0.000877 805500 -- [-3202.548] (-3195.631) (-3202.803) (-3207.547) * (-3203.522) [-3200.995] (-3200.610) (-3205.946) -- 0:00:47 806000 -- (-3201.024) (-3206.085) [-3198.843] (-3202.270) * (-3196.616) (-3207.098) (-3200.825) [-3204.036] -- 0:00:47 806500 -- (-3198.272) [-3198.641] (-3200.230) (-3194.139) * [-3200.651] (-3199.851) (-3205.452) (-3200.917) -- 0:00:47 807000 -- (-3201.434) (-3201.496) [-3194.849] (-3192.908) * (-3198.067) (-3200.775) (-3198.124) [-3194.584] -- 0:00:47 807500 -- (-3199.803) (-3202.147) [-3195.922] (-3200.690) * (-3195.874) (-3198.887) [-3197.281] (-3197.892) -- 0:00:47 808000 -- (-3202.966) [-3199.293] (-3196.443) (-3204.390) * (-3201.744) (-3210.799) (-3196.099) [-3199.069] -- 0:00:47 808500 -- (-3198.999) (-3201.678) [-3196.854] (-3200.452) * (-3199.066) (-3205.937) [-3198.704] (-3197.819) -- 0:00:47 809000 -- (-3203.669) (-3199.264) [-3198.344] (-3196.047) * (-3201.985) (-3205.871) [-3199.572] (-3196.314) -- 0:00:46 809500 -- (-3196.406) (-3198.619) [-3201.547] (-3202.531) * (-3210.839) (-3198.900) [-3200.185] (-3196.395) -- 0:00:46 810000 -- (-3201.939) (-3198.018) (-3197.280) [-3204.725] * [-3198.174] (-3203.999) (-3201.320) (-3197.826) -- 0:00:46 Average standard deviation of split frequencies: 0.000872 810500 -- [-3198.499] (-3195.285) (-3200.373) (-3195.439) * (-3197.467) (-3198.019) (-3198.810) [-3199.077] -- 0:00:46 811000 -- (-3208.323) (-3206.994) (-3203.687) [-3198.637] * [-3193.890] (-3198.814) (-3200.905) (-3194.689) -- 0:00:46 811500 -- (-3198.948) (-3199.496) (-3200.356) [-3199.104] * (-3199.696) (-3197.258) [-3200.689] (-3199.907) -- 0:00:46 812000 -- [-3196.534] (-3207.725) (-3202.234) (-3203.545) * [-3199.255] (-3201.050) (-3199.565) (-3201.777) -- 0:00:46 812500 -- (-3199.826) (-3204.626) (-3199.089) [-3201.546] * [-3203.381] (-3198.261) (-3199.462) (-3199.682) -- 0:00:46 813000 -- (-3200.378) (-3203.456) [-3199.816] (-3200.500) * (-3198.306) [-3201.307] (-3199.899) (-3201.894) -- 0:00:46 813500 -- (-3199.251) (-3200.503) (-3208.465) [-3197.218] * (-3198.034) (-3200.527) [-3200.223] (-3200.917) -- 0:00:45 814000 -- [-3199.568] (-3199.431) (-3195.147) (-3203.647) * (-3198.791) [-3197.720] (-3199.813) (-3195.996) -- 0:00:45 814500 -- [-3198.130] (-3201.905) (-3198.170) (-3200.810) * (-3204.500) (-3198.432) (-3196.123) [-3195.492] -- 0:00:45 815000 -- (-3207.663) (-3199.695) (-3198.566) [-3204.492] * (-3194.337) [-3196.195] (-3210.144) (-3194.456) -- 0:00:45 Average standard deviation of split frequencies: 0.000867 815500 -- (-3206.029) (-3198.785) [-3200.643] (-3198.624) * (-3200.450) (-3200.937) [-3195.016] (-3197.155) -- 0:00:45 816000 -- (-3205.504) (-3199.837) [-3198.871] (-3199.985) * (-3194.925) [-3197.128] (-3197.793) (-3201.322) -- 0:00:45 816500 -- (-3201.684) (-3200.799) [-3200.822] (-3196.139) * (-3200.420) [-3197.867] (-3199.327) (-3199.795) -- 0:00:45 817000 -- (-3203.156) [-3198.830] (-3207.965) (-3203.741) * [-3199.006] (-3198.641) (-3196.345) (-3202.960) -- 0:00:45 817500 -- (-3198.319) (-3201.378) [-3199.696] (-3201.721) * (-3196.800) [-3202.662] (-3195.914) (-3197.702) -- 0:00:44 818000 -- (-3198.030) (-3201.526) [-3199.835] (-3198.547) * (-3200.439) (-3200.131) (-3196.278) [-3201.799] -- 0:00:44 818500 -- (-3198.735) (-3200.690) (-3202.430) [-3198.660] * (-3203.043) (-3202.790) [-3196.513] (-3200.855) -- 0:00:44 819000 -- (-3206.530) [-3204.778] (-3198.953) (-3197.121) * (-3196.161) [-3196.850] (-3202.428) (-3201.465) -- 0:00:44 819500 -- [-3197.588] (-3195.743) (-3199.803) (-3194.969) * (-3197.650) (-3198.114) (-3204.794) [-3202.917] -- 0:00:44 820000 -- (-3203.254) (-3198.842) [-3194.242] (-3198.254) * (-3205.464) (-3194.793) (-3200.176) [-3194.739] -- 0:00:44 Average standard deviation of split frequencies: 0.000862 820500 -- (-3204.975) (-3193.157) [-3199.685] (-3210.867) * (-3196.734) (-3211.830) [-3200.099] (-3199.522) -- 0:00:44 821000 -- (-3207.731) [-3199.453] (-3201.200) (-3200.254) * (-3195.317) (-3199.397) (-3197.961) [-3206.914] -- 0:00:44 821500 -- (-3206.995) (-3201.567) [-3197.001] (-3194.765) * [-3194.933] (-3196.464) (-3198.811) (-3204.144) -- 0:00:43 822000 -- (-3205.935) [-3197.032] (-3200.504) (-3203.404) * (-3198.018) [-3199.014] (-3198.628) (-3209.380) -- 0:00:43 822500 -- (-3207.436) (-3200.028) (-3197.626) [-3199.504] * (-3199.535) [-3195.747] (-3199.277) (-3203.968) -- 0:00:43 823000 -- (-3203.392) (-3197.048) (-3209.649) [-3200.460] * (-3197.196) (-3198.697) (-3194.751) [-3200.254] -- 0:00:43 823500 -- (-3203.208) [-3199.467] (-3206.267) (-3204.108) * [-3200.527] (-3196.661) (-3200.271) (-3196.160) -- 0:00:43 824000 -- (-3200.195) (-3198.596) (-3204.848) [-3195.639] * (-3199.209) (-3202.300) (-3197.241) [-3203.031] -- 0:00:43 824500 -- [-3200.187] (-3197.500) (-3215.244) (-3204.341) * (-3200.575) [-3198.862] (-3200.153) (-3196.098) -- 0:00:42 825000 -- [-3200.469] (-3196.577) (-3199.267) (-3202.013) * (-3204.083) [-3202.774] (-3203.752) (-3198.281) -- 0:00:43 Average standard deviation of split frequencies: 0.000856 825500 -- (-3195.862) [-3203.242] (-3195.480) (-3203.672) * (-3201.408) (-3204.684) (-3206.790) [-3195.235] -- 0:00:42 826000 -- (-3199.318) (-3207.685) [-3195.987] (-3199.936) * (-3201.363) [-3205.276] (-3202.044) (-3204.243) -- 0:00:42 826500 -- [-3197.321] (-3203.044) (-3193.697) (-3204.294) * [-3198.763] (-3199.688) (-3200.019) (-3197.203) -- 0:00:42 827000 -- (-3199.102) (-3200.222) (-3207.670) [-3200.588] * (-3197.120) [-3195.250] (-3198.517) (-3212.002) -- 0:00:42 827500 -- [-3201.721] (-3200.815) (-3201.496) (-3208.874) * [-3200.955] (-3196.249) (-3196.562) (-3204.452) -- 0:00:42 828000 -- (-3197.479) [-3207.008] (-3204.616) (-3212.015) * [-3195.637] (-3196.883) (-3196.632) (-3202.260) -- 0:00:42 828500 -- [-3198.657] (-3204.511) (-3200.153) (-3211.612) * (-3202.906) (-3196.769) [-3197.393] (-3204.412) -- 0:00:42 829000 -- (-3202.366) [-3198.849] (-3203.922) (-3197.851) * [-3201.377] (-3199.628) (-3195.826) (-3194.023) -- 0:00:42 829500 -- [-3202.037] (-3200.968) (-3195.920) (-3198.380) * (-3206.607) (-3199.914) (-3202.091) [-3198.417] -- 0:00:41 830000 -- (-3196.379) [-3201.724] (-3202.079) (-3204.365) * (-3201.940) [-3195.517] (-3204.877) (-3201.406) -- 0:00:41 Average standard deviation of split frequencies: 0.000851 830500 -- (-3202.597) (-3198.346) [-3198.570] (-3200.720) * (-3198.025) (-3195.099) (-3198.769) [-3200.159] -- 0:00:41 831000 -- (-3202.431) (-3201.515) (-3199.562) [-3203.756] * [-3195.734] (-3203.068) (-3201.498) (-3197.499) -- 0:00:41 831500 -- (-3202.088) [-3199.323] (-3200.825) (-3200.559) * (-3194.562) [-3203.190] (-3201.440) (-3199.206) -- 0:00:41 832000 -- [-3200.439] (-3204.867) (-3201.476) (-3199.587) * (-3196.237) (-3202.099) (-3195.653) [-3205.787] -- 0:00:41 832500 -- (-3196.933) (-3206.245) (-3196.679) [-3196.869] * (-3199.947) (-3208.745) [-3193.366] (-3198.526) -- 0:00:41 833000 -- (-3198.041) (-3202.812) (-3197.507) [-3196.768] * (-3205.476) [-3196.329] (-3196.249) (-3198.777) -- 0:00:41 833500 -- [-3199.635] (-3198.724) (-3195.007) (-3206.572) * (-3203.271) (-3194.466) [-3201.279] (-3202.465) -- 0:00:40 834000 -- [-3199.850] (-3197.462) (-3194.741) (-3200.721) * (-3206.985) (-3201.882) [-3197.335] (-3206.103) -- 0:00:40 834500 -- (-3199.473) (-3199.353) (-3198.720) [-3195.315] * [-3200.812] (-3196.359) (-3206.004) (-3202.739) -- 0:00:40 835000 -- (-3201.776) (-3202.282) [-3196.825] (-3202.575) * (-3200.539) (-3201.063) [-3202.867] (-3202.140) -- 0:00:40 Average standard deviation of split frequencies: 0.000846 835500 -- (-3200.591) [-3200.617] (-3195.802) (-3203.027) * (-3202.110) [-3197.894] (-3198.129) (-3202.121) -- 0:00:40 836000 -- (-3197.428) (-3197.393) [-3199.779] (-3198.930) * (-3199.576) (-3195.103) [-3195.263] (-3202.153) -- 0:00:40 836500 -- (-3196.095) [-3197.879] (-3208.335) (-3198.409) * [-3198.540] (-3197.366) (-3212.391) (-3202.407) -- 0:00:40 837000 -- (-3196.105) [-3196.475] (-3204.763) (-3195.628) * (-3199.246) (-3197.922) [-3198.051] (-3200.134) -- 0:00:40 837500 -- (-3203.121) (-3199.112) (-3204.393) [-3201.535] * (-3205.881) (-3203.479) [-3202.071] (-3195.838) -- 0:00:39 838000 -- (-3205.241) (-3194.188) [-3194.996] (-3198.704) * [-3200.717] (-3202.008) (-3197.753) (-3205.160) -- 0:00:39 838500 -- [-3201.902] (-3201.175) (-3196.904) (-3199.534) * (-3197.961) (-3201.607) (-3202.425) [-3199.050] -- 0:00:39 839000 -- (-3200.179) [-3199.152] (-3200.601) (-3207.347) * [-3200.061] (-3199.425) (-3195.909) (-3196.692) -- 0:00:39 839500 -- (-3196.347) (-3198.305) (-3198.616) [-3199.309] * (-3196.064) (-3206.643) (-3204.058) [-3207.399] -- 0:00:39 840000 -- [-3199.550] (-3195.637) (-3197.381) (-3198.635) * [-3201.587] (-3202.770) (-3198.377) (-3198.827) -- 0:00:39 Average standard deviation of split frequencies: 0.000841 840500 -- [-3197.114] (-3205.019) (-3196.142) (-3198.553) * (-3201.167) [-3202.653] (-3199.058) (-3200.197) -- 0:00:39 841000 -- (-3194.507) (-3202.619) (-3203.466) [-3200.633] * (-3210.300) [-3202.720] (-3197.041) (-3203.541) -- 0:00:38 841500 -- (-3203.906) (-3200.067) (-3200.874) [-3202.075] * [-3195.285] (-3195.642) (-3195.826) (-3200.812) -- 0:00:38 842000 -- (-3203.789) (-3196.937) (-3201.341) [-3201.249] * (-3196.256) [-3195.949] (-3201.754) (-3201.170) -- 0:00:38 842500 -- (-3207.995) [-3202.879] (-3202.093) (-3201.840) * (-3204.726) (-3202.127) [-3196.492] (-3204.584) -- 0:00:38 843000 -- (-3201.039) (-3196.314) [-3197.138] (-3209.555) * [-3202.356] (-3197.234) (-3198.949) (-3201.818) -- 0:00:38 843500 -- (-3198.448) [-3196.751] (-3198.540) (-3199.182) * (-3202.056) (-3202.913) [-3195.960] (-3213.488) -- 0:00:38 844000 -- (-3201.047) (-3201.020) [-3197.552] (-3203.833) * [-3195.287] (-3196.979) (-3202.221) (-3197.712) -- 0:00:38 844500 -- (-3202.756) (-3207.980) (-3212.708) [-3196.309] * (-3201.180) (-3200.293) (-3196.384) [-3198.054] -- 0:00:38 845000 -- (-3201.823) [-3195.538] (-3194.499) (-3207.622) * [-3200.391] (-3213.170) (-3202.022) (-3203.699) -- 0:00:37 Average standard deviation of split frequencies: 0.000836 845500 -- (-3205.578) (-3195.943) [-3201.665] (-3208.854) * (-3204.439) (-3205.765) [-3196.898] (-3200.411) -- 0:00:38 846000 -- (-3199.916) (-3198.245) [-3199.154] (-3200.290) * (-3202.074) (-3198.470) [-3192.797] (-3200.893) -- 0:00:37 846500 -- (-3202.814) (-3204.108) (-3194.183) [-3201.323] * (-3197.052) (-3196.803) [-3193.915] (-3206.123) -- 0:00:37 847000 -- [-3201.401] (-3198.531) (-3197.746) (-3199.141) * (-3204.608) (-3206.293) (-3197.789) [-3201.624] -- 0:00:37 847500 -- (-3200.729) [-3198.982] (-3204.315) (-3200.062) * (-3200.523) (-3195.427) (-3204.877) [-3198.915] -- 0:00:37 848000 -- (-3196.057) (-3203.019) [-3211.852] (-3206.149) * (-3196.026) (-3200.261) (-3197.350) [-3194.472] -- 0:00:37 848500 -- (-3198.392) [-3199.879] (-3207.838) (-3206.005) * (-3195.553) (-3198.425) (-3200.273) [-3195.129] -- 0:00:37 849000 -- (-3197.323) (-3205.600) (-3205.032) [-3205.431] * [-3194.586] (-3206.069) (-3198.488) (-3203.160) -- 0:00:36 849500 -- (-3203.479) (-3201.650) (-3205.565) [-3200.604] * (-3209.961) [-3198.510] (-3201.277) (-3198.281) -- 0:00:37 850000 -- (-3204.081) (-3208.762) [-3195.561] (-3205.113) * (-3201.969) (-3203.822) [-3199.772] (-3197.860) -- 0:00:36 Average standard deviation of split frequencies: 0.000831 850500 -- (-3205.895) (-3208.784) [-3201.124] (-3200.450) * (-3202.282) [-3202.355] (-3198.857) (-3197.630) -- 0:00:36 851000 -- (-3198.616) (-3205.093) [-3201.754] (-3202.258) * (-3202.733) (-3199.137) (-3201.603) [-3201.012] -- 0:00:36 851500 -- (-3194.813) (-3206.757) (-3197.184) [-3205.215] * [-3200.622] (-3200.884) (-3198.942) (-3200.446) -- 0:00:36 852000 -- (-3202.398) (-3195.906) [-3204.764] (-3208.718) * (-3199.257) (-3203.121) (-3204.092) [-3194.465] -- 0:00:36 852500 -- (-3196.341) [-3194.488] (-3200.111) (-3202.924) * [-3196.828] (-3202.240) (-3197.081) (-3205.654) -- 0:00:36 853000 -- [-3198.518] (-3195.114) (-3204.428) (-3201.012) * (-3198.834) [-3201.770] (-3201.329) (-3202.576) -- 0:00:36 853500 -- [-3198.576] (-3198.085) (-3201.345) (-3195.099) * (-3198.967) (-3198.931) (-3196.841) [-3197.347] -- 0:00:36 854000 -- (-3209.522) (-3205.327) [-3195.378] (-3200.076) * (-3196.112) [-3194.906] (-3206.901) (-3197.504) -- 0:00:35 854500 -- [-3195.839] (-3194.450) (-3196.260) (-3201.281) * (-3198.939) (-3200.601) [-3202.616] (-3197.968) -- 0:00:35 855000 -- (-3200.576) [-3195.529] (-3197.847) (-3197.665) * [-3196.368] (-3202.863) (-3205.147) (-3196.158) -- 0:00:35 Average standard deviation of split frequencies: 0.000826 855500 -- (-3202.786) (-3206.841) [-3205.615] (-3203.055) * (-3195.921) (-3206.216) (-3207.531) [-3195.520] -- 0:00:35 856000 -- (-3204.792) (-3206.497) [-3199.793] (-3198.908) * (-3205.736) [-3198.767] (-3207.323) (-3196.791) -- 0:00:35 856500 -- (-3201.741) [-3202.694] (-3194.178) (-3195.887) * [-3200.235] (-3202.831) (-3198.662) (-3196.178) -- 0:00:35 857000 -- (-3196.449) (-3194.632) (-3200.774) [-3204.058] * (-3199.231) (-3207.301) (-3201.286) [-3195.373] -- 0:00:35 857500 -- (-3200.412) (-3197.934) (-3194.156) [-3199.260] * [-3196.652] (-3201.433) (-3199.431) (-3198.000) -- 0:00:34 858000 -- (-3196.842) (-3194.780) [-3195.858] (-3201.777) * (-3207.537) (-3204.439) [-3198.937] (-3197.558) -- 0:00:34 858500 -- (-3198.731) (-3196.430) (-3201.334) [-3206.935] * (-3196.454) [-3196.069] (-3204.321) (-3198.783) -- 0:00:34 859000 -- (-3200.787) (-3202.619) [-3205.036] (-3201.895) * (-3204.067) [-3197.601] (-3201.504) (-3199.305) -- 0:00:34 859500 -- (-3200.043) [-3198.625] (-3203.112) (-3197.518) * [-3198.311] (-3200.049) (-3200.476) (-3202.300) -- 0:00:34 860000 -- (-3200.150) [-3200.890] (-3203.697) (-3202.624) * (-3201.083) (-3198.774) (-3210.078) [-3201.399] -- 0:00:34 Average standard deviation of split frequencies: 0.000822 860500 -- [-3199.313] (-3200.780) (-3200.442) (-3200.525) * (-3197.592) (-3196.133) (-3211.790) [-3202.729] -- 0:00:34 861000 -- (-3201.511) (-3201.914) (-3200.258) [-3201.391] * (-3199.565) (-3201.391) (-3209.495) [-3202.478] -- 0:00:34 861500 -- (-3202.123) (-3204.090) [-3198.531] (-3200.024) * [-3198.038] (-3199.226) (-3205.843) (-3195.848) -- 0:00:33 862000 -- (-3205.673) [-3200.539] (-3199.910) (-3201.668) * (-3196.719) (-3195.867) [-3199.412] (-3201.513) -- 0:00:33 862500 -- (-3200.385) (-3201.745) (-3197.816) [-3195.037] * (-3196.807) (-3199.020) (-3199.197) [-3199.500] -- 0:00:33 863000 -- (-3204.993) (-3198.967) (-3199.273) [-3205.376] * (-3201.434) (-3200.710) [-3193.785] (-3199.989) -- 0:00:33 863500 -- (-3201.578) [-3201.424] (-3196.842) (-3205.547) * [-3196.441] (-3199.282) (-3198.326) (-3199.037) -- 0:00:33 864000 -- (-3198.920) (-3196.859) [-3203.768] (-3203.762) * (-3197.699) (-3194.244) [-3199.495] (-3197.085) -- 0:00:33 864500 -- (-3202.250) (-3198.613) (-3203.649) [-3197.679] * (-3199.692) (-3196.568) [-3195.562] (-3214.083) -- 0:00:33 865000 -- [-3199.868] (-3201.066) (-3198.792) (-3203.737) * (-3198.485) (-3199.856) [-3196.089] (-3204.415) -- 0:00:33 Average standard deviation of split frequencies: 0.000817 865500 -- [-3200.343] (-3198.743) (-3198.546) (-3200.730) * (-3201.181) [-3200.551] (-3198.686) (-3206.577) -- 0:00:32 866000 -- (-3201.148) [-3201.740] (-3199.690) (-3199.637) * (-3203.512) [-3200.840] (-3201.119) (-3208.317) -- 0:00:32 866500 -- (-3202.934) (-3194.474) (-3203.088) [-3201.273] * (-3206.366) (-3200.241) (-3197.199) [-3204.067] -- 0:00:32 867000 -- (-3200.362) (-3202.637) (-3204.955) [-3197.818] * (-3202.415) (-3206.457) (-3200.946) [-3196.440] -- 0:00:32 867500 -- (-3209.940) (-3208.424) [-3195.926] (-3201.263) * (-3201.441) [-3200.068] (-3201.824) (-3203.084) -- 0:00:32 868000 -- (-3206.777) (-3194.970) (-3195.964) [-3195.369] * (-3201.181) [-3199.191] (-3203.145) (-3201.068) -- 0:00:32 868500 -- (-3200.853) (-3201.173) [-3195.592] (-3208.768) * (-3202.920) [-3199.068] (-3201.949) (-3204.237) -- 0:00:32 869000 -- (-3202.482) (-3199.638) (-3197.764) [-3200.148] * (-3200.462) [-3197.267] (-3197.344) (-3202.825) -- 0:00:32 869500 -- (-3204.153) (-3202.711) (-3198.520) [-3197.862] * (-3207.209) (-3193.625) (-3196.139) [-3206.735] -- 0:00:31 870000 -- (-3199.510) (-3203.235) [-3201.664] (-3198.311) * (-3201.124) (-3195.348) (-3201.479) [-3204.218] -- 0:00:31 Average standard deviation of split frequencies: 0.000812 870500 -- (-3198.114) [-3202.814] (-3208.050) (-3194.346) * (-3196.087) (-3197.899) [-3199.940] (-3200.208) -- 0:00:31 871000 -- (-3204.773) (-3208.171) (-3200.814) [-3196.331] * (-3198.087) (-3198.433) (-3206.063) [-3200.854] -- 0:00:31 871500 -- (-3199.789) (-3205.210) [-3200.984] (-3199.890) * (-3201.607) (-3200.036) (-3203.044) [-3203.468] -- 0:00:31 872000 -- (-3201.544) [-3201.406] (-3198.375) (-3195.185) * [-3199.730] (-3199.997) (-3205.043) (-3204.272) -- 0:00:31 872500 -- (-3196.804) (-3203.442) (-3198.032) [-3201.245] * (-3196.771) [-3203.935] (-3198.869) (-3198.570) -- 0:00:31 873000 -- (-3199.177) (-3196.398) [-3201.384] (-3202.659) * (-3196.604) (-3200.631) [-3198.483] (-3197.925) -- 0:00:31 873500 -- [-3199.441] (-3197.013) (-3199.062) (-3206.917) * [-3200.038] (-3201.087) (-3198.915) (-3195.908) -- 0:00:30 874000 -- [-3201.806] (-3204.895) (-3197.323) (-3206.835) * (-3200.830) [-3200.944] (-3206.270) (-3203.662) -- 0:00:30 874500 -- [-3197.881] (-3200.195) (-3198.391) (-3208.119) * (-3204.408) [-3199.348] (-3197.211) (-3200.748) -- 0:00:30 875000 -- [-3203.755] (-3202.497) (-3199.067) (-3198.176) * [-3196.636] (-3201.840) (-3193.620) (-3197.806) -- 0:00:30 Average standard deviation of split frequencies: 0.000807 875500 -- (-3204.054) [-3199.906] (-3198.235) (-3208.993) * (-3197.837) (-3200.614) (-3207.561) [-3197.139] -- 0:00:30 876000 -- (-3206.024) [-3198.465] (-3197.924) (-3196.523) * (-3197.047) (-3205.460) (-3200.364) [-3196.490] -- 0:00:30 876500 -- (-3209.607) [-3199.472] (-3198.490) (-3198.489) * (-3206.615) [-3204.026] (-3200.185) (-3204.143) -- 0:00:30 877000 -- (-3202.373) (-3200.955) [-3201.852] (-3198.729) * [-3207.438] (-3208.018) (-3199.530) (-3200.557) -- 0:00:30 877500 -- [-3201.051] (-3192.824) (-3200.218) (-3204.756) * (-3212.874) (-3199.827) (-3201.899) [-3198.300] -- 0:00:30 878000 -- [-3197.321] (-3196.909) (-3197.169) (-3201.531) * (-3199.619) (-3202.353) [-3201.076] (-3201.099) -- 0:00:29 878500 -- (-3199.855) (-3196.771) [-3198.067] (-3195.885) * [-3198.505] (-3209.631) (-3194.565) (-3202.008) -- 0:00:29 879000 -- (-3202.170) [-3196.393] (-3202.127) (-3198.495) * (-3206.929) [-3203.279] (-3197.778) (-3195.026) -- 0:00:29 879500 -- [-3194.715] (-3200.242) (-3198.473) (-3200.391) * (-3198.434) [-3199.548] (-3194.560) (-3199.179) -- 0:00:29 880000 -- [-3201.168] (-3198.324) (-3199.119) (-3196.407) * (-3203.763) (-3198.150) [-3198.907] (-3196.124) -- 0:00:29 Average standard deviation of split frequencies: 0.000803 880500 -- [-3196.383] (-3198.826) (-3196.855) (-3199.464) * (-3200.905) [-3210.386] (-3199.082) (-3196.166) -- 0:00:29 881000 -- (-3203.897) (-3198.957) [-3203.530] (-3195.356) * (-3205.688) [-3199.418] (-3200.382) (-3200.943) -- 0:00:29 881500 -- (-3203.435) [-3204.203] (-3200.233) (-3197.722) * (-3204.675) (-3203.609) (-3198.497) [-3198.965] -- 0:00:29 882000 -- (-3199.376) [-3197.777] (-3201.803) (-3194.648) * (-3199.129) (-3201.926) (-3205.851) [-3203.217] -- 0:00:28 882500 -- (-3201.055) [-3200.321] (-3209.724) (-3196.104) * (-3195.247) (-3194.938) [-3197.958] (-3200.150) -- 0:00:28 883000 -- (-3204.697) (-3199.064) (-3205.807) [-3195.200] * (-3204.624) [-3200.620] (-3202.776) (-3194.843) -- 0:00:28 883500 -- [-3200.199] (-3200.128) (-3208.477) (-3199.580) * (-3211.644) (-3199.421) [-3196.921] (-3204.306) -- 0:00:28 884000 -- [-3200.632] (-3203.919) (-3208.841) (-3198.317) * (-3199.359) (-3198.997) [-3202.939] (-3201.782) -- 0:00:28 884500 -- (-3201.222) (-3198.216) (-3199.720) [-3196.938] * [-3195.766] (-3196.055) (-3199.917) (-3197.673) -- 0:00:28 885000 -- (-3199.488) [-3196.172] (-3204.363) (-3199.019) * (-3196.447) (-3200.664) [-3200.966] (-3199.902) -- 0:00:28 Average standard deviation of split frequencies: 0.000798 885500 -- (-3207.069) (-3202.766) [-3197.036] (-3196.060) * (-3202.541) [-3197.664] (-3199.546) (-3198.652) -- 0:00:28 886000 -- (-3204.007) (-3199.054) [-3206.805] (-3199.822) * [-3198.938] (-3206.953) (-3200.552) (-3203.119) -- 0:00:27 886500 -- [-3200.963] (-3204.944) (-3203.137) (-3204.164) * (-3198.891) [-3202.456] (-3201.495) (-3205.270) -- 0:00:27 887000 -- (-3199.675) (-3204.584) [-3202.689] (-3205.169) * (-3201.530) (-3207.182) (-3201.426) [-3204.373] -- 0:00:27 887500 -- (-3201.986) (-3203.557) [-3200.358] (-3199.252) * (-3205.797) (-3208.199) [-3198.863] (-3196.928) -- 0:00:27 888000 -- [-3199.466] (-3197.312) (-3206.331) (-3197.828) * (-3200.649) (-3207.996) (-3201.381) [-3195.264] -- 0:00:27 888500 -- [-3198.912] (-3199.585) (-3197.202) (-3200.947) * (-3198.160) [-3202.107] (-3196.309) (-3199.942) -- 0:00:27 889000 -- [-3198.577] (-3198.084) (-3203.522) (-3201.304) * (-3194.464) [-3201.431] (-3197.821) (-3205.363) -- 0:00:27 889500 -- [-3196.983] (-3198.749) (-3203.495) (-3198.553) * (-3197.328) (-3206.071) (-3195.914) [-3199.514] -- 0:00:27 890000 -- (-3202.931) (-3205.543) [-3197.179] (-3195.564) * (-3199.552) (-3203.432) [-3202.943] (-3207.884) -- 0:00:26 Average standard deviation of split frequencies: 0.000794 890500 -- (-3208.781) [-3202.264] (-3204.935) (-3199.714) * (-3200.868) (-3204.774) (-3200.018) [-3200.877] -- 0:00:26 891000 -- (-3199.848) (-3199.804) (-3202.817) [-3207.223] * (-3196.580) (-3208.832) [-3195.310] (-3199.809) -- 0:00:26 891500 -- (-3200.044) (-3199.108) [-3202.010] (-3209.005) * (-3202.371) (-3207.285) (-3202.513) [-3196.020] -- 0:00:26 892000 -- [-3203.052] (-3196.489) (-3200.907) (-3200.719) * (-3199.761) (-3198.066) (-3194.025) [-3195.404] -- 0:00:26 892500 -- (-3202.900) (-3196.837) [-3198.799] (-3195.771) * (-3200.418) (-3201.951) (-3198.997) [-3197.363] -- 0:00:26 893000 -- (-3207.061) (-3202.585) (-3196.175) [-3197.848] * (-3205.243) (-3209.426) [-3197.998] (-3198.202) -- 0:00:26 893500 -- (-3209.765) (-3195.936) [-3199.996] (-3194.594) * (-3197.286) (-3203.840) (-3199.897) [-3198.330] -- 0:00:26 894000 -- (-3198.187) [-3199.147] (-3200.066) (-3197.962) * (-3193.749) (-3201.347) [-3194.387] (-3204.733) -- 0:00:25 894500 -- (-3201.630) (-3206.098) (-3197.799) [-3201.815] * (-3199.929) (-3198.262) (-3200.985) [-3198.322] -- 0:00:25 895000 -- [-3204.939] (-3199.821) (-3199.404) (-3195.385) * [-3204.388] (-3194.526) (-3201.331) (-3200.495) -- 0:00:25 Average standard deviation of split frequencies: 0.000789 895500 -- [-3197.042] (-3201.739) (-3198.543) (-3200.750) * (-3202.246) (-3200.550) [-3199.876] (-3202.288) -- 0:00:25 896000 -- (-3197.634) (-3200.725) [-3201.252] (-3207.111) * (-3204.455) (-3205.030) [-3199.623] (-3205.118) -- 0:00:25 896500 -- (-3201.151) (-3200.331) (-3202.812) [-3198.237] * (-3206.017) (-3206.284) [-3202.175] (-3200.317) -- 0:00:25 897000 -- (-3211.409) (-3197.017) [-3194.529] (-3198.491) * [-3199.228] (-3203.402) (-3202.083) (-3201.435) -- 0:00:25 897500 -- (-3204.361) [-3203.149] (-3200.346) (-3197.072) * [-3193.932] (-3199.358) (-3193.552) (-3200.465) -- 0:00:25 898000 -- (-3202.998) (-3200.308) [-3196.879] (-3202.560) * [-3196.933] (-3198.521) (-3195.885) (-3203.972) -- 0:00:24 898500 -- (-3218.833) (-3198.652) [-3195.817] (-3201.220) * (-3197.632) (-3199.798) (-3198.207) [-3199.066] -- 0:00:24 899000 -- (-3198.416) (-3202.591) [-3204.208] (-3199.360) * (-3198.927) (-3203.443) [-3201.855] (-3206.208) -- 0:00:24 899500 -- [-3192.062] (-3199.423) (-3209.358) (-3200.473) * [-3197.759] (-3197.369) (-3205.937) (-3203.593) -- 0:00:24 900000 -- (-3202.176) (-3200.385) (-3208.658) [-3203.339] * [-3199.327] (-3205.381) (-3200.972) (-3196.026) -- 0:00:24 Average standard deviation of split frequencies: 0.000785 900500 -- [-3193.889] (-3206.627) (-3205.847) (-3197.124) * [-3198.532] (-3198.176) (-3206.780) (-3201.811) -- 0:00:24 901000 -- (-3199.548) (-3207.027) (-3200.163) [-3196.291] * (-3200.477) [-3196.375] (-3201.284) (-3200.289) -- 0:00:24 901500 -- (-3196.153) [-3201.956] (-3207.310) (-3205.923) * (-3202.347) (-3204.060) [-3202.768] (-3202.793) -- 0:00:24 902000 -- (-3200.827) (-3197.423) (-3200.260) [-3205.853] * (-3202.684) (-3201.817) [-3200.931] (-3203.499) -- 0:00:24 902500 -- (-3196.222) (-3196.597) [-3203.456] (-3200.595) * (-3198.920) (-3205.162) [-3202.513] (-3203.510) -- 0:00:23 903000 -- [-3196.408] (-3201.676) (-3203.130) (-3197.458) * (-3198.523) [-3202.972] (-3198.675) (-3199.154) -- 0:00:23 903500 -- (-3203.499) (-3199.902) [-3196.135] (-3210.585) * (-3202.962) [-3202.010] (-3203.152) (-3200.362) -- 0:00:23 904000 -- (-3205.084) (-3199.545) [-3198.206] (-3203.913) * (-3201.603) (-3198.917) (-3197.505) [-3196.203] -- 0:00:23 904500 -- (-3207.430) (-3201.392) [-3195.060] (-3204.201) * (-3198.919) (-3208.803) [-3193.393] (-3197.723) -- 0:00:23 905000 -- (-3201.223) (-3202.499) [-3196.803] (-3203.971) * (-3196.815) (-3203.338) [-3199.531] (-3201.974) -- 0:00:23 Average standard deviation of split frequencies: 0.000780 905500 -- (-3198.024) [-3198.926] (-3194.143) (-3202.054) * (-3199.392) [-3199.965] (-3197.089) (-3198.016) -- 0:00:23 906000 -- (-3199.163) [-3200.151] (-3199.956) (-3208.137) * (-3203.218) (-3199.587) (-3200.251) [-3198.549] -- 0:00:23 906500 -- (-3200.191) (-3204.485) [-3200.799] (-3216.925) * (-3200.848) [-3199.724] (-3204.541) (-3200.668) -- 0:00:22 907000 -- (-3197.554) [-3199.935] (-3204.109) (-3206.540) * (-3202.060) (-3200.648) (-3214.304) [-3205.011] -- 0:00:22 907500 -- (-3197.124) [-3199.883] (-3199.831) (-3207.277) * (-3203.191) (-3200.465) (-3206.068) [-3202.430] -- 0:00:22 908000 -- (-3194.633) (-3202.836) [-3200.186] (-3200.826) * (-3204.054) (-3199.214) (-3208.604) [-3201.186] -- 0:00:22 908500 -- (-3197.801) (-3202.731) [-3196.957] (-3205.716) * (-3198.997) (-3197.533) [-3198.784] (-3196.175) -- 0:00:22 909000 -- [-3202.400] (-3203.035) (-3198.884) (-3205.667) * (-3203.932) (-3194.469) [-3196.698] (-3205.153) -- 0:00:22 909500 -- (-3202.116) [-3201.654] (-3200.949) (-3195.903) * [-3198.765] (-3204.646) (-3200.506) (-3196.834) -- 0:00:22 910000 -- (-3200.565) [-3196.719] (-3199.294) (-3194.749) * (-3200.163) (-3194.984) [-3193.698] (-3198.833) -- 0:00:22 Average standard deviation of split frequencies: 0.000776 910500 -- (-3203.839) (-3195.811) [-3195.161] (-3199.860) * (-3206.602) (-3195.427) [-3201.587] (-3200.583) -- 0:00:21 911000 -- [-3196.042] (-3196.402) (-3196.180) (-3202.157) * (-3206.384) (-3197.990) (-3198.165) [-3199.760] -- 0:00:21 911500 -- (-3203.780) [-3195.653] (-3202.091) (-3201.816) * (-3202.757) [-3198.610] (-3201.888) (-3199.627) -- 0:00:21 912000 -- (-3200.779) (-3205.220) (-3201.557) [-3198.401] * (-3205.070) (-3205.102) [-3204.036] (-3202.923) -- 0:00:21 912500 -- (-3199.545) [-3202.463] (-3204.135) (-3203.960) * (-3200.153) (-3201.714) (-3198.788) [-3201.738] -- 0:00:21 913000 -- [-3197.346] (-3197.003) (-3201.770) (-3205.008) * (-3203.192) [-3207.129] (-3203.103) (-3197.393) -- 0:00:21 913500 -- [-3194.461] (-3197.887) (-3203.247) (-3195.285) * (-3203.300) (-3208.806) (-3201.186) [-3200.309] -- 0:00:21 914000 -- [-3196.527] (-3199.809) (-3202.401) (-3204.143) * (-3199.097) (-3207.804) (-3199.643) [-3201.881] -- 0:00:21 914500 -- (-3203.244) (-3201.469) (-3200.673) [-3200.019] * (-3195.214) [-3201.010] (-3204.679) (-3200.439) -- 0:00:20 915000 -- (-3198.481) (-3205.959) [-3199.473] (-3197.954) * [-3200.593] (-3204.047) (-3205.976) (-3193.524) -- 0:00:20 Average standard deviation of split frequencies: 0.000772 915500 -- (-3201.156) [-3201.949] (-3202.673) (-3196.173) * (-3201.358) (-3202.207) (-3204.113) [-3197.450] -- 0:00:20 916000 -- (-3199.894) (-3201.113) (-3204.706) [-3200.059] * (-3208.691) (-3206.891) [-3200.062] (-3194.670) -- 0:00:20 916500 -- [-3203.460] (-3203.700) (-3200.986) (-3198.738) * (-3209.848) [-3194.657] (-3201.156) (-3203.741) -- 0:00:20 917000 -- (-3205.504) (-3196.560) [-3197.562] (-3203.414) * (-3209.900) (-3199.820) [-3204.249] (-3195.794) -- 0:00:20 917500 -- (-3206.493) [-3203.495] (-3202.596) (-3206.161) * (-3203.718) (-3197.076) (-3195.507) [-3201.329] -- 0:00:20 918000 -- [-3196.601] (-3198.622) (-3202.066) (-3202.279) * (-3201.089) (-3202.165) [-3197.086] (-3196.887) -- 0:00:20 918500 -- (-3204.316) (-3207.644) (-3200.849) [-3200.433] * (-3201.752) (-3198.692) [-3197.290] (-3204.162) -- 0:00:19 919000 -- (-3197.655) [-3201.516] (-3201.519) (-3205.265) * [-3201.822] (-3209.574) (-3197.351) (-3202.149) -- 0:00:19 919500 -- (-3196.734) (-3203.758) [-3197.558] (-3207.938) * (-3194.500) (-3199.579) (-3199.773) [-3197.898] -- 0:00:19 920000 -- (-3204.330) (-3207.315) [-3197.306] (-3206.286) * (-3192.894) [-3201.097] (-3202.044) (-3197.233) -- 0:00:19 Average standard deviation of split frequencies: 0.000768 920500 -- (-3199.858) (-3198.083) [-3198.492] (-3203.752) * (-3205.405) [-3198.793] (-3204.239) (-3205.594) -- 0:00:19 921000 -- (-3199.913) (-3203.216) [-3202.535] (-3196.548) * [-3201.108] (-3211.610) (-3202.555) (-3207.901) -- 0:00:19 921500 -- (-3200.473) (-3203.400) [-3196.333] (-3197.737) * [-3209.707] (-3201.664) (-3200.392) (-3197.083) -- 0:00:19 922000 -- (-3201.550) (-3205.769) (-3201.016) [-3199.583] * (-3205.295) (-3201.416) [-3195.615] (-3202.750) -- 0:00:19 922500 -- (-3203.017) (-3197.571) (-3205.003) [-3197.686] * (-3205.103) [-3197.117] (-3200.627) (-3201.321) -- 0:00:18 923000 -- (-3201.321) (-3204.634) [-3201.980] (-3198.007) * (-3196.786) (-3201.861) [-3201.590] (-3201.558) -- 0:00:18 923500 -- [-3198.761] (-3204.776) (-3199.998) (-3197.092) * (-3205.288) (-3197.981) (-3203.712) [-3199.474] -- 0:00:18 924000 -- (-3204.200) (-3201.322) (-3203.197) [-3199.666] * (-3197.357) [-3196.072] (-3205.980) (-3199.199) -- 0:00:18 924500 -- [-3197.957] (-3203.091) (-3202.280) (-3203.008) * (-3208.957) [-3201.106] (-3201.559) (-3198.140) -- 0:00:18 925000 -- (-3202.267) [-3203.641] (-3202.440) (-3200.898) * (-3199.857) (-3198.792) (-3194.134) [-3200.715] -- 0:00:18 Average standard deviation of split frequencies: 0.000764 925500 -- (-3206.019) (-3209.147) (-3198.483) [-3203.269] * (-3207.656) [-3199.854] (-3202.412) (-3201.323) -- 0:00:18 926000 -- (-3199.924) (-3200.819) [-3198.298] (-3197.775) * [-3201.160] (-3199.322) (-3197.133) (-3204.192) -- 0:00:18 926500 -- [-3197.553] (-3201.367) (-3193.618) (-3207.540) * (-3205.136) (-3195.227) [-3196.656] (-3199.890) -- 0:00:18 927000 -- (-3195.501) (-3196.416) [-3201.001] (-3207.811) * (-3199.025) (-3202.278) [-3201.294] (-3198.871) -- 0:00:17 927500 -- (-3195.050) (-3196.463) (-3200.718) [-3205.179] * (-3209.771) (-3207.293) (-3197.733) [-3205.397] -- 0:00:17 928000 -- (-3202.007) (-3203.027) [-3199.038] (-3197.793) * (-3202.310) [-3198.953] (-3200.229) (-3205.505) -- 0:00:17 928500 -- [-3200.728] (-3203.251) (-3200.829) (-3199.311) * (-3201.958) [-3202.405] (-3201.080) (-3200.625) -- 0:00:17 929000 -- (-3202.062) (-3201.851) [-3199.845] (-3202.443) * [-3196.182] (-3203.054) (-3203.123) (-3198.566) -- 0:00:17 929500 -- (-3205.463) (-3198.694) [-3203.968] (-3197.233) * (-3195.660) [-3202.996] (-3200.716) (-3204.150) -- 0:00:17 930000 -- (-3201.842) [-3205.257] (-3198.835) (-3202.646) * (-3207.469) (-3209.577) (-3206.535) [-3203.590] -- 0:00:17 Average standard deviation of split frequencies: 0.000760 930500 -- (-3209.052) (-3198.159) (-3199.801) [-3194.439] * (-3202.623) [-3199.866] (-3199.034) (-3204.736) -- 0:00:17 931000 -- (-3203.689) (-3199.023) [-3201.837] (-3205.784) * (-3201.202) [-3202.769] (-3200.369) (-3204.509) -- 0:00:16 931500 -- (-3206.397) (-3195.693) [-3199.734] (-3200.914) * (-3201.755) (-3199.000) (-3207.598) [-3203.577] -- 0:00:16 932000 -- (-3203.194) [-3200.584] (-3199.430) (-3202.506) * [-3195.544] (-3201.050) (-3208.862) (-3201.737) -- 0:00:16 932500 -- (-3204.487) (-3195.275) (-3196.713) [-3198.200] * (-3195.512) (-3201.717) (-3204.112) [-3198.047] -- 0:00:16 933000 -- (-3199.347) [-3195.778] (-3197.282) (-3202.333) * (-3197.861) (-3200.427) [-3197.274] (-3201.484) -- 0:00:16 933500 -- (-3198.484) (-3196.246) (-3199.412) [-3201.718] * (-3197.477) [-3201.495] (-3205.926) (-3198.497) -- 0:00:16 934000 -- (-3197.775) [-3198.401] (-3198.898) (-3209.468) * (-3204.416) (-3202.528) [-3200.878] (-3195.090) -- 0:00:16 934500 -- [-3198.506] (-3194.924) (-3203.109) (-3202.299) * (-3200.371) (-3207.117) (-3208.014) [-3196.240] -- 0:00:16 935000 -- (-3205.474) (-3200.021) (-3208.347) [-3202.086] * (-3206.521) (-3203.081) (-3201.584) [-3199.554] -- 0:00:15 Average standard deviation of split frequencies: 0.000755 935500 -- (-3199.737) (-3202.407) (-3203.726) [-3200.210] * (-3199.874) (-3201.736) [-3195.808] (-3202.570) -- 0:00:15 936000 -- [-3195.847] (-3201.985) (-3204.901) (-3198.037) * (-3202.808) (-3201.720) [-3197.797] (-3197.035) -- 0:00:15 936500 -- [-3195.649] (-3199.639) (-3202.591) (-3196.784) * [-3198.235] (-3200.499) (-3204.828) (-3200.645) -- 0:00:15 937000 -- [-3207.342] (-3198.137) (-3198.527) (-3200.279) * (-3205.872) (-3203.609) [-3198.983] (-3202.969) -- 0:00:15 937500 -- [-3200.261] (-3203.393) (-3198.175) (-3197.228) * (-3203.220) (-3201.202) [-3200.531] (-3204.433) -- 0:00:15 938000 -- (-3200.092) (-3204.338) (-3201.313) [-3193.956] * (-3193.267) (-3197.601) (-3196.603) [-3194.314] -- 0:00:15 938500 -- (-3199.480) (-3195.477) [-3199.891] (-3199.452) * (-3199.120) [-3197.978] (-3198.408) (-3203.432) -- 0:00:15 939000 -- (-3205.858) [-3196.899] (-3199.262) (-3197.887) * (-3200.728) (-3199.844) [-3199.837] (-3201.806) -- 0:00:14 939500 -- [-3205.069] (-3197.443) (-3198.360) (-3201.462) * [-3198.253] (-3195.008) (-3198.606) (-3214.339) -- 0:00:14 940000 -- (-3201.160) (-3195.245) (-3202.291) [-3201.509] * (-3198.532) (-3204.387) (-3197.163) [-3196.791] -- 0:00:14 Average standard deviation of split frequencies: 0.000752 940500 -- (-3208.901) (-3197.361) (-3202.700) [-3197.848] * (-3197.200) [-3200.439] (-3192.747) (-3201.771) -- 0:00:14 941000 -- [-3200.367] (-3199.612) (-3204.726) (-3199.928) * (-3199.033) (-3199.305) (-3202.264) [-3201.589] -- 0:00:14 941500 -- (-3196.214) [-3197.257] (-3201.415) (-3207.285) * (-3205.854) (-3200.655) (-3204.374) [-3200.965] -- 0:00:14 942000 -- (-3196.238) (-3198.478) [-3195.214] (-3195.816) * [-3200.091] (-3198.767) (-3201.515) (-3193.380) -- 0:00:14 942500 -- (-3203.226) (-3195.285) [-3197.711] (-3200.194) * (-3202.541) [-3194.253] (-3203.687) (-3203.166) -- 0:00:14 943000 -- (-3200.814) (-3199.934) [-3199.679] (-3206.344) * [-3197.592] (-3197.671) (-3209.148) (-3198.367) -- 0:00:13 943500 -- (-3205.878) (-3203.960) (-3204.292) [-3198.804] * [-3202.108] (-3206.282) (-3196.873) (-3199.986) -- 0:00:13 944000 -- [-3198.445] (-3196.817) (-3200.814) (-3198.889) * (-3200.808) (-3195.329) [-3197.001] (-3199.368) -- 0:00:13 944500 -- (-3198.861) (-3202.902) [-3201.506] (-3196.315) * (-3202.560) (-3195.184) [-3199.211] (-3197.153) -- 0:00:13 945000 -- (-3200.052) (-3199.892) [-3197.327] (-3202.032) * (-3201.078) (-3198.829) (-3208.207) [-3197.125] -- 0:00:13 Average standard deviation of split frequencies: 0.000747 945500 -- [-3202.338] (-3195.906) (-3196.761) (-3206.854) * [-3205.426] (-3198.541) (-3211.795) (-3211.377) -- 0:00:13 946000 -- (-3201.051) [-3195.062] (-3201.173) (-3196.057) * (-3206.899) (-3198.631) (-3197.086) [-3201.438] -- 0:00:13 946500 -- (-3203.527) (-3196.480) [-3204.743] (-3196.985) * (-3203.740) (-3199.719) [-3199.255] (-3202.053) -- 0:00:13 947000 -- (-3207.363) (-3195.076) (-3207.664) [-3198.323] * (-3209.200) [-3201.805] (-3197.878) (-3203.113) -- 0:00:12 947500 -- (-3204.770) (-3195.631) (-3194.948) [-3191.753] * (-3203.919) (-3207.312) (-3201.013) [-3198.230] -- 0:00:12 948000 -- [-3201.324] (-3207.291) (-3200.032) (-3201.283) * [-3197.133] (-3198.135) (-3203.482) (-3198.882) -- 0:00:12 948500 -- (-3195.518) (-3202.781) [-3201.984] (-3202.345) * (-3197.472) [-3192.329] (-3202.813) (-3202.317) -- 0:00:12 949000 -- (-3202.382) [-3201.928] (-3200.743) (-3201.502) * (-3198.951) [-3197.358] (-3198.297) (-3200.266) -- 0:00:12 949500 -- (-3197.167) (-3200.555) (-3201.075) [-3201.246] * (-3199.277) [-3196.819] (-3198.781) (-3212.291) -- 0:00:12 950000 -- [-3197.706] (-3200.493) (-3201.222) (-3203.032) * (-3201.846) (-3201.796) (-3197.522) [-3200.677] -- 0:00:12 Average standard deviation of split frequencies: 0.000744 950500 -- [-3196.947] (-3198.616) (-3201.432) (-3206.104) * [-3203.326] (-3202.401) (-3198.958) (-3201.665) -- 0:00:12 951000 -- (-3206.433) (-3201.412) [-3199.389] (-3196.747) * [-3198.353] (-3197.856) (-3196.112) (-3199.506) -- 0:00:12 951500 -- (-3200.121) (-3200.072) (-3199.967) [-3200.825] * [-3199.850] (-3203.433) (-3199.044) (-3199.227) -- 0:00:11 952000 -- [-3202.645] (-3204.546) (-3202.719) (-3204.933) * (-3212.551) (-3203.177) [-3199.513] (-3199.824) -- 0:00:11 952500 -- (-3198.434) (-3205.490) [-3198.445] (-3197.953) * [-3200.736] (-3198.158) (-3196.777) (-3202.476) -- 0:00:11 953000 -- (-3198.681) [-3202.680] (-3206.357) (-3198.592) * (-3203.835) (-3204.821) [-3198.645] (-3200.069) -- 0:00:11 953500 -- (-3193.180) (-3203.791) (-3201.301) [-3195.221] * (-3213.816) [-3201.815] (-3203.420) (-3196.086) -- 0:00:11 954000 -- (-3200.869) (-3205.646) [-3197.744] (-3195.580) * (-3207.308) [-3198.374] (-3202.672) (-3208.653) -- 0:00:11 954500 -- (-3202.818) (-3210.050) [-3198.069] (-3195.704) * [-3203.419] (-3202.170) (-3201.288) (-3205.311) -- 0:00:11 955000 -- (-3202.133) (-3197.575) [-3202.598] (-3200.793) * [-3198.970] (-3201.347) (-3195.264) (-3203.461) -- 0:00:11 Average standard deviation of split frequencies: 0.000740 955500 -- (-3200.049) (-3201.129) (-3192.864) [-3200.644] * (-3205.092) [-3201.716] (-3198.472) (-3200.492) -- 0:00:10 956000 -- (-3199.334) (-3204.885) [-3193.230] (-3200.832) * (-3203.013) (-3197.815) (-3202.557) [-3199.732] -- 0:00:10 956500 -- (-3202.402) (-3199.886) [-3199.217] (-3205.914) * (-3199.535) [-3200.241] (-3198.270) (-3197.758) -- 0:00:10 957000 -- (-3202.513) (-3200.113) (-3202.223) [-3197.720] * (-3198.055) (-3198.517) [-3204.873] (-3197.546) -- 0:00:10 957500 -- (-3198.849) [-3196.229] (-3197.699) (-3200.198) * (-3205.880) (-3199.221) (-3199.080) [-3199.772] -- 0:00:10 958000 -- (-3202.393) (-3202.723) (-3199.032) [-3202.547] * (-3199.393) [-3196.651] (-3201.024) (-3200.807) -- 0:00:10 958500 -- (-3203.508) [-3193.385] (-3198.873) (-3197.486) * (-3197.440) (-3203.461) (-3200.631) [-3197.182] -- 0:00:10 959000 -- (-3206.579) (-3198.152) (-3199.994) [-3202.804] * (-3199.698) (-3197.708) (-3198.961) [-3200.586] -- 0:00:10 959500 -- (-3192.929) (-3199.011) [-3199.011] (-3198.302) * [-3197.101] (-3209.366) (-3199.119) (-3196.624) -- 0:00:09 960000 -- (-3208.280) [-3198.031] (-3204.979) (-3197.140) * (-3196.844) (-3198.506) (-3200.300) [-3193.428] -- 0:00:09 Average standard deviation of split frequencies: 0.000736 960500 -- (-3203.153) (-3198.314) [-3196.410] (-3200.352) * (-3194.384) (-3196.616) [-3199.952] (-3195.723) -- 0:00:09 961000 -- [-3198.880] (-3201.731) (-3195.682) (-3198.520) * (-3195.267) [-3203.086] (-3200.565) (-3197.291) -- 0:00:09 961500 -- [-3196.411] (-3197.151) (-3199.811) (-3200.890) * (-3194.376) (-3203.921) (-3196.597) [-3191.944] -- 0:00:09 962000 -- (-3204.865) [-3201.556] (-3209.185) (-3202.744) * (-3205.172) [-3206.293] (-3201.792) (-3194.996) -- 0:00:09 962500 -- (-3198.030) [-3201.946] (-3205.078) (-3204.233) * (-3203.286) (-3203.999) (-3202.048) [-3199.130] -- 0:00:09 963000 -- [-3201.028] (-3201.551) (-3210.942) (-3205.285) * (-3200.444) [-3200.071] (-3201.323) (-3207.685) -- 0:00:09 963500 -- (-3194.321) (-3198.375) [-3202.023] (-3198.917) * [-3197.186] (-3199.916) (-3203.573) (-3205.329) -- 0:00:08 964000 -- (-3203.361) [-3201.712] (-3203.497) (-3202.405) * (-3199.103) [-3199.589] (-3199.478) (-3204.228) -- 0:00:08 964500 -- (-3202.798) (-3196.479) [-3198.114] (-3200.479) * (-3215.670) [-3200.402] (-3211.968) (-3193.837) -- 0:00:08 965000 -- (-3202.345) [-3207.858] (-3203.216) (-3201.996) * (-3197.701) [-3202.020] (-3202.177) (-3200.024) -- 0:00:08 Average standard deviation of split frequencies: 0.000732 965500 -- (-3198.654) (-3204.048) (-3202.539) [-3199.541] * (-3206.373) [-3197.471] (-3204.247) (-3195.108) -- 0:00:08 966000 -- (-3208.755) (-3199.082) (-3198.074) [-3197.090] * (-3212.002) (-3204.210) [-3201.616] (-3197.489) -- 0:00:08 966500 -- [-3201.224] (-3202.783) (-3200.509) (-3201.616) * (-3216.495) (-3203.061) (-3209.421) [-3195.998] -- 0:00:08 967000 -- (-3206.052) (-3203.893) [-3196.714] (-3195.744) * (-3210.171) (-3207.647) [-3202.569] (-3200.891) -- 0:00:08 967500 -- (-3202.090) (-3204.400) [-3200.720] (-3202.570) * (-3206.131) (-3200.677) [-3201.206] (-3199.707) -- 0:00:07 968000 -- (-3201.040) (-3201.678) (-3198.720) [-3204.152] * [-3201.536] (-3204.659) (-3200.827) (-3199.443) -- 0:00:07 968500 -- (-3196.365) (-3200.320) [-3199.283] (-3205.365) * (-3200.323) (-3204.965) (-3201.455) [-3202.614] -- 0:00:07 969000 -- (-3195.135) [-3194.202] (-3201.507) (-3201.707) * (-3198.750) [-3194.647] (-3204.799) (-3194.369) -- 0:00:07 969500 -- (-3194.678) (-3199.153) [-3197.708] (-3203.784) * (-3209.254) [-3197.801] (-3202.876) (-3199.931) -- 0:00:07 970000 -- (-3199.439) (-3196.534) (-3206.680) [-3201.368] * [-3197.235] (-3202.067) (-3196.204) (-3200.710) -- 0:00:07 Average standard deviation of split frequencies: 0.000728 970500 -- (-3198.258) (-3195.534) [-3203.958] (-3202.616) * (-3209.260) [-3198.996] (-3203.168) (-3201.432) -- 0:00:07 971000 -- (-3195.453) (-3195.921) (-3202.985) [-3195.934] * (-3200.699) (-3197.654) [-3200.442] (-3198.265) -- 0:00:07 971500 -- (-3205.676) (-3201.589) (-3196.349) [-3197.245] * (-3201.310) [-3198.864] (-3201.994) (-3203.002) -- 0:00:06 972000 -- (-3203.029) [-3197.014] (-3199.794) (-3208.870) * (-3200.142) (-3202.730) [-3199.793] (-3202.360) -- 0:00:06 972500 -- (-3200.460) [-3200.070] (-3197.841) (-3198.701) * [-3196.574] (-3197.271) (-3204.478) (-3197.493) -- 0:00:06 973000 -- (-3199.451) (-3199.613) [-3193.936] (-3202.989) * (-3197.861) [-3195.495] (-3202.374) (-3201.980) -- 0:00:06 973500 -- (-3200.503) [-3203.730] (-3198.800) (-3198.314) * (-3195.453) (-3194.931) (-3199.850) [-3200.336] -- 0:00:06 974000 -- [-3198.091] (-3197.175) (-3200.366) (-3202.777) * (-3199.962) (-3199.498) (-3203.953) [-3203.564] -- 0:00:06 974500 -- (-3206.231) (-3204.194) [-3199.553] (-3197.856) * (-3196.430) [-3197.216] (-3204.297) (-3198.599) -- 0:00:06 975000 -- (-3211.601) [-3201.436] (-3203.893) (-3201.476) * [-3201.691] (-3202.883) (-3198.897) (-3195.043) -- 0:00:06 Average standard deviation of split frequencies: 0.000724 975500 -- (-3208.233) (-3200.928) (-3202.808) [-3198.939] * [-3203.274] (-3199.394) (-3203.859) (-3202.784) -- 0:00:06 976000 -- (-3198.021) (-3198.434) (-3193.073) [-3203.590] * [-3199.798] (-3205.231) (-3196.037) (-3196.544) -- 0:00:05 976500 -- (-3199.576) (-3195.035) (-3200.591) [-3193.439] * (-3204.404) (-3197.057) (-3198.049) [-3194.204] -- 0:00:05 977000 -- (-3204.649) (-3201.375) [-3201.024] (-3193.149) * (-3203.072) (-3195.374) [-3197.544] (-3199.927) -- 0:00:05 977500 -- (-3198.982) (-3201.731) (-3195.898) [-3197.693] * (-3197.090) [-3197.734] (-3209.044) (-3198.500) -- 0:00:05 978000 -- (-3199.591) (-3198.802) (-3201.771) [-3199.227] * (-3196.937) (-3207.977) (-3198.057) [-3200.163] -- 0:00:05 978500 -- (-3202.498) (-3199.304) (-3200.943) [-3202.683] * [-3198.619] (-3205.510) (-3202.361) (-3210.935) -- 0:00:05 979000 -- (-3194.661) [-3194.641] (-3203.756) (-3203.394) * (-3198.924) [-3201.465] (-3202.769) (-3204.814) -- 0:00:05 979500 -- (-3197.602) [-3201.261] (-3198.281) (-3206.532) * (-3198.611) (-3209.008) (-3194.487) [-3200.978] -- 0:00:05 980000 -- (-3198.433) (-3207.185) [-3196.529] (-3201.567) * (-3193.958) (-3203.654) (-3202.345) [-3198.825] -- 0:00:04 Average standard deviation of split frequencies: 0.000721 980500 -- (-3202.612) [-3202.776] (-3197.917) (-3200.474) * [-3199.225] (-3205.775) (-3197.127) (-3204.411) -- 0:00:04 981000 -- (-3198.748) (-3197.514) [-3202.361] (-3197.285) * (-3200.226) [-3205.480] (-3198.630) (-3199.855) -- 0:00:04 981500 -- (-3200.413) [-3196.337] (-3199.692) (-3203.720) * (-3199.624) [-3202.279] (-3199.578) (-3207.497) -- 0:00:04 982000 -- (-3202.428) (-3201.703) (-3204.361) [-3196.144] * [-3200.325] (-3201.840) (-3199.467) (-3203.311) -- 0:00:04 982500 -- (-3199.038) (-3204.663) (-3198.408) [-3198.560] * (-3203.631) [-3196.523] (-3207.481) (-3200.447) -- 0:00:04 983000 -- (-3198.412) (-3202.042) (-3203.072) [-3202.897] * (-3208.652) (-3203.265) [-3203.789] (-3199.329) -- 0:00:04 983500 -- (-3200.295) (-3199.481) (-3204.966) [-3199.538] * (-3207.387) [-3203.154] (-3205.362) (-3203.318) -- 0:00:04 984000 -- (-3203.954) (-3200.266) [-3200.785] (-3206.464) * [-3199.674] (-3205.731) (-3200.683) (-3204.413) -- 0:00:03 984500 -- (-3197.010) (-3205.635) (-3201.903) [-3196.580] * (-3198.638) (-3199.981) (-3200.565) [-3202.232] -- 0:00:03 985000 -- (-3206.508) (-3201.787) [-3196.889] (-3202.238) * (-3202.332) [-3197.089] (-3201.901) (-3199.455) -- 0:00:03 Average standard deviation of split frequencies: 0.000717 985500 -- (-3200.334) [-3204.391] (-3199.519) (-3203.386) * (-3200.944) [-3198.375] (-3201.963) (-3197.437) -- 0:00:03 986000 -- (-3203.637) (-3208.459) [-3206.161] (-3203.741) * (-3202.438) [-3200.632] (-3195.091) (-3203.547) -- 0:00:03 986500 -- (-3195.412) (-3200.400) (-3195.349) [-3196.486] * (-3197.488) (-3205.366) (-3200.181) [-3206.667] -- 0:00:03 987000 -- [-3195.601] (-3195.471) (-3198.882) (-3196.775) * [-3197.667] (-3196.786) (-3196.157) (-3203.290) -- 0:00:03 987500 -- (-3196.832) (-3201.053) (-3199.620) [-3196.378] * (-3203.106) (-3201.435) (-3202.683) [-3199.662] -- 0:00:03 988000 -- (-3201.924) (-3198.129) (-3200.748) [-3196.536] * (-3205.853) (-3203.934) [-3205.417] (-3194.872) -- 0:00:02 988500 -- [-3199.445] (-3197.293) (-3197.475) (-3195.982) * (-3203.434) (-3207.511) (-3209.857) [-3198.211] -- 0:00:02 989000 -- (-3200.960) [-3196.106] (-3196.498) (-3205.418) * (-3201.099) (-3205.821) [-3196.614] (-3198.265) -- 0:00:02 989500 -- (-3204.613) (-3197.519) (-3199.342) [-3206.647] * (-3195.243) (-3198.368) [-3199.678] (-3200.761) -- 0:00:02 990000 -- (-3208.731) (-3204.296) (-3203.845) [-3198.353] * (-3201.696) (-3208.697) [-3201.566] (-3196.309) -- 0:00:02 Average standard deviation of split frequencies: 0.000714 990500 -- (-3200.138) (-3201.389) (-3198.676) [-3197.868] * (-3198.625) (-3200.872) [-3194.253] (-3193.943) -- 0:00:02 991000 -- [-3198.534] (-3201.400) (-3198.406) (-3195.695) * (-3198.803) [-3192.620] (-3196.418) (-3201.814) -- 0:00:02 991500 -- (-3196.300) [-3196.554] (-3205.040) (-3204.124) * (-3199.692) [-3193.974] (-3196.050) (-3201.952) -- 0:00:02 992000 -- (-3200.313) (-3207.037) (-3203.040) [-3197.073] * (-3195.021) [-3202.844] (-3200.099) (-3203.141) -- 0:00:01 992500 -- [-3198.652] (-3197.950) (-3198.890) (-3202.324) * (-3202.849) (-3195.314) [-3202.915] (-3205.577) -- 0:00:01 993000 -- (-3203.659) (-3197.356) (-3204.713) [-3194.445] * [-3197.923] (-3200.529) (-3201.205) (-3205.088) -- 0:00:01 993500 -- (-3203.696) (-3198.608) (-3200.693) [-3203.275] * [-3195.895] (-3204.310) (-3202.206) (-3201.459) -- 0:00:01 994000 -- (-3203.958) (-3202.845) [-3198.036] (-3199.701) * (-3201.033) (-3198.587) (-3197.633) [-3194.121] -- 0:00:01 994500 -- (-3203.626) [-3197.811] (-3195.051) (-3206.762) * (-3204.415) [-3195.632] (-3193.830) (-3203.963) -- 0:00:01 995000 -- (-3201.334) (-3205.292) [-3199.917] (-3201.125) * (-3198.686) [-3199.097] (-3197.510) (-3196.680) -- 0:00:01 Average standard deviation of split frequencies: 0.000710 995500 -- [-3207.537] (-3200.467) (-3201.970) (-3202.589) * [-3194.821] (-3197.569) (-3203.851) (-3205.476) -- 0:00:01 996000 -- (-3202.824) [-3200.357] (-3196.363) (-3207.300) * [-3200.938] (-3201.942) (-3200.289) (-3200.611) -- 0:00:00 996500 -- [-3197.397] (-3202.612) (-3200.897) (-3197.675) * [-3195.728] (-3200.945) (-3200.846) (-3198.960) -- 0:00:00 997000 -- [-3196.597] (-3206.626) (-3201.806) (-3195.454) * (-3210.616) (-3199.279) [-3200.692] (-3199.177) -- 0:00:00 997500 -- (-3204.831) (-3196.673) (-3200.547) [-3198.930] * [-3202.235] (-3197.985) (-3208.092) (-3203.540) -- 0:00:00 998000 -- (-3205.845) (-3198.148) (-3196.699) [-3200.545] * (-3205.768) (-3196.523) (-3203.535) [-3194.706] -- 0:00:00 998500 -- (-3203.202) (-3205.605) [-3197.748] (-3208.536) * [-3197.091] (-3202.534) (-3199.853) (-3200.774) -- 0:00:00 999000 -- (-3208.127) (-3197.428) (-3203.200) [-3194.820] * (-3202.804) (-3197.059) [-3195.628] (-3204.751) -- 0:00:00 999500 -- (-3217.776) (-3207.122) (-3204.433) [-3204.095] * (-3200.329) [-3198.779] (-3193.218) (-3202.042) -- 0:00:00 1000000 -- (-3203.866) (-3207.409) (-3208.267) [-3197.336] * (-3202.227) (-3199.156) (-3197.630) [-3199.448] -- 0:00:00 Average standard deviation of split frequencies: 0.000707 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3203.865972 -- 11.539323 Chain 1 -- -3203.865972 -- 11.539323 Chain 2 -- -3207.408945 -- 14.049541 Chain 2 -- -3207.408945 -- 14.049541 Chain 3 -- -3208.267205 -- 14.310566 Chain 3 -- -3208.267205 -- 14.310566 Chain 4 -- -3197.336073 -- 12.609728 Chain 4 -- -3197.336074 -- 12.609728 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3202.226743 -- 13.619591 Chain 1 -- -3202.226743 -- 13.619591 Chain 2 -- -3199.155587 -- 12.189012 Chain 2 -- -3199.155587 -- 12.189012 Chain 3 -- -3197.629632 -- 12.716822 Chain 3 -- -3197.629630 -- 12.716822 Chain 4 -- -3199.448174 -- 12.284814 Chain 4 -- -3199.448174 -- 12.284814 Analysis completed in 4 mins 5 seconds Analysis used 244.64 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3190.57 Likelihood of best state for "cold" chain of run 2 was -3190.43 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 44.2 % ( 32 %) Dirichlet(Revmat{all}) 58.6 % ( 50 %) Slider(Revmat{all}) 23.2 % ( 26 %) Dirichlet(Pi{all}) 26.2 % ( 22 %) Slider(Pi{all}) 63.4 % ( 35 %) Multiplier(Alpha{1,2}) 45.5 % ( 30 %) Multiplier(Alpha{3}) 56.2 % ( 32 %) Slider(Pinvar{all}) 0.1 % ( 1 %) ExtSPR(Tau{all},V{all}) 0.1 % ( 1 %) ExtTBR(Tau{all},V{all}) 0.1 % ( 0 %) NNI(Tau{all},V{all}) 0.1 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 34 %) Multiplier(V{all}) 23.5 % ( 17 %) Nodeslider(V{all}) 25.3 % ( 34 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 43.9 % ( 39 %) Dirichlet(Revmat{all}) 59.0 % ( 43 %) Slider(Revmat{all}) 23.1 % ( 25 %) Dirichlet(Pi{all}) 26.0 % ( 25 %) Slider(Pi{all}) 62.0 % ( 29 %) Multiplier(Alpha{1,2}) 45.6 % ( 23 %) Multiplier(Alpha{3}) 55.2 % ( 23 %) Slider(Pinvar{all}) 0.1 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.1 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.1 % ( 0 %) NNI(Tau{all},V{all}) 0.1 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 18 %) Multiplier(V{all}) 23.6 % ( 21 %) Nodeslider(V{all}) 25.3 % ( 20 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.84 0.69 0.57 2 | 166347 0.85 0.72 3 | 166533 167528 0.86 4 | 166437 166728 166427 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.84 0.70 0.57 2 | 167117 0.85 0.72 3 | 166325 166583 0.86 4 | 165890 167357 166728 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3198.08 | 2 2 2| | 1 2 | | 22 2 1 12 2 2 1 2 | | 2 2 1 1* 2 21 21 | | 1 1 1 1 1 *2 2 2 2 122 2 1| | 1 1 1 11 2 | |1 1 22 1222 2 1 1 2 1 1 1 2 | | 1 2 22 1 1 1 1 | | 21 21 2 1 121 1 1 112 | |22 1 1 2 1 * 2 21 | | 2 12 2 2 2 | | 2 1 1 2 2 1 11 2 2 | | 1 1 2 1 | | 1 | | 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3200.88 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3196.22 -3206.12 2 -3195.98 -3205.30 -------------------------------------- TOTAL -3196.09 -3205.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363040 0.001527 0.285603 0.436985 0.361368 1288.31 1394.66 1.000 r(A<->C){all} 0.074744 0.000388 0.037570 0.113770 0.073424 999.61 1099.29 1.000 r(A<->G){all} 0.296595 0.001595 0.218618 0.374994 0.295289 871.73 883.83 1.000 r(A<->T){all} 0.077269 0.000326 0.044113 0.113914 0.075875 866.33 1029.92 1.000 r(C<->G){all} 0.125752 0.000634 0.079668 0.177852 0.124475 973.09 1047.22 1.001 r(C<->T){all} 0.386649 0.002133 0.300756 0.479625 0.386949 755.72 809.49 1.001 r(G<->T){all} 0.038991 0.000230 0.012184 0.069326 0.037528 1159.31 1192.89 1.000 pi(A){all} 0.264446 0.000125 0.243300 0.286124 0.264267 1009.13 1058.78 1.000 pi(C){all} 0.241908 0.000120 0.220113 0.262853 0.241950 1194.79 1214.22 1.000 pi(G){all} 0.227232 0.000123 0.205417 0.248965 0.227282 1104.68 1192.07 1.000 pi(T){all} 0.266414 0.000140 0.243327 0.289176 0.266307 1035.93 1119.62 1.000 alpha{1,2} 0.063566 0.001910 0.000277 0.148511 0.057354 1366.54 1433.77 1.000 alpha{3} 2.523163 0.784647 0.984573 4.207629 2.377121 1501.00 1501.00 1.000 pinvar{all} 0.314717 0.006133 0.160949 0.469993 0.318885 1125.16 1166.05 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 Key to taxon bipartitions (saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------- 1 -- .**** 2 -- .*... 3 -- ..*.. 4 -- ...*. 5 -- ....* 6 -- ...** 7 -- .**.. ----------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 6 3002 1.000000 0.000000 1.000000 1.000000 2 7 2999 0.999001 0.001413 0.998001 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.058394 0.000111 0.038177 0.078919 0.057628 1.000 2 length{all}[2] 0.016950 0.000019 0.008622 0.025423 0.016648 1.000 2 length{all}[3] 0.003880 0.000005 0.000298 0.008228 0.003524 1.000 2 length{all}[4] 0.105390 0.000350 0.069093 0.141523 0.103870 1.000 2 length{all}[5] 0.094018 0.000291 0.060693 0.126035 0.092975 1.000 2 length{all}[6] 0.067947 0.000227 0.039534 0.097257 0.066427 1.000 2 length{all}[7] 0.016473 0.000034 0.006299 0.028323 0.016023 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000707 Maximum standard deviation of split frequencies = 0.001413 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.000 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------ C4 (4) |----------------100----------------+ + \------------------------------------ C5 (5) | | /------------------------------------ C2 (2) \----------------100----------------+ \------------------------------------ C3 (3) Phylogram (based on average branch lengths): /------------------------ C1 (1) | | /-------------------------------------------- C4 (4) |---------------------------+ + \--------------------------------------- C5 (5) | | /------- C2 (2) \------+ \- C3 (3) |-------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (2 trees sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 5 ls = 1341 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Sequences read.. Counting site patterns.. 0:00 233 patterns at 447 / 447 sites (100.0%), 0:00 Counting codons.. 80 bytes for distance 227408 bytes for conP 31688 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (4, 5), (2, 3)); MP score: 256 341112 bytes for conP, adjusted 0.121730 0.115658 0.186599 0.190664 0.027873 0.034840 0.008926 0.300000 1.300000 ntime & nrate & np: 7 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 9 lnL0 = -3394.477835 Iterating by ming2 Initial: fx= 3394.477835 x= 0.12173 0.11566 0.18660 0.19066 0.02787 0.03484 0.00893 0.30000 1.30000 1 h-m-p 0.0000 0.0002 403.9060 ++CYYYC 3372.941165 4 0.0002 21 | 0/9 2 h-m-p 0.0000 0.0001 19973.3079 +CYCCC 3261.042659 4 0.0000 41 | 0/9 3 h-m-p 0.0001 0.0004 1157.9260 +YYYCCC 3212.867475 5 0.0003 61 | 0/9 4 h-m-p 0.0000 0.0002 1286.5784 +YCCCC 3200.430668 4 0.0001 81 | 0/9 5 h-m-p 0.0000 0.0002 308.7229 +YCYCCC 3195.029314 5 0.0002 102 | 0/9 6 h-m-p 0.0001 0.0014 618.0592 ++YYYYYYYYYC 3089.712868 10 0.0012 126 | 0/9 7 h-m-p 0.0000 0.0002 453.7532 YCCCCC 3087.915015 5 0.0001 147 | 0/9 8 h-m-p 0.0014 0.0172 17.6656 CCC 3087.561836 2 0.0018 163 | 0/9 9 h-m-p 0.0090 0.0785 3.5779 CC 3087.132668 1 0.0090 177 | 0/9 10 h-m-p 0.0107 0.1479 3.0120 +CYCYCCC 3061.473483 6 0.0761 200 | 0/9 11 h-m-p 1.2385 6.1926 0.0407 CCCCC 3056.878949 4 1.6361 220 | 0/9 12 h-m-p 1.6000 8.0000 0.0293 CCCC 3056.457865 3 0.5954 247 | 0/9 13 h-m-p 0.5182 8.0000 0.0337 YCCC 3055.889374 3 1.2167 273 | 0/9 14 h-m-p 0.6997 8.0000 0.0586 +YCC 3054.087060 2 2.0702 298 | 0/9 15 h-m-p 1.3045 6.5227 0.0882 CCCC 3051.965960 3 2.2661 325 | 0/9 16 h-m-p 0.3472 1.7361 0.1957 +YCYCCC 3049.877130 5 0.9480 355 | 0/9 17 h-m-p 0.8856 4.4281 0.0319 CYCCC 3048.918630 4 1.2038 383 | 0/9 18 h-m-p 0.7358 3.6792 0.0465 CCC 3048.786023 2 0.7332 408 | 0/9 19 h-m-p 1.6000 8.0000 0.0056 YC 3048.750522 1 1.0871 430 | 0/9 20 h-m-p 0.9051 8.0000 0.0067 YC 3048.740318 1 1.9234 452 | 0/9 21 h-m-p 1.4884 8.0000 0.0087 YC 3048.730170 1 3.4017 474 | 0/9 22 h-m-p 1.6000 8.0000 0.0112 CC 3048.722229 1 1.8229 497 | 0/9 23 h-m-p 1.6000 8.0000 0.0031 YC 3048.721692 1 1.0941 519 | 0/9 24 h-m-p 1.6000 8.0000 0.0001 Y 3048.721689 0 1.0468 540 | 0/9 25 h-m-p 1.6000 8.0000 0.0000 Y 3048.721689 0 1.1542 561 | 0/9 26 h-m-p 1.6000 8.0000 0.0000 Y 3048.721689 0 1.2340 582 | 0/9 27 h-m-p 1.6000 8.0000 0.0000 Y 3048.721689 0 0.6879 603 | 0/9 28 h-m-p 1.6000 8.0000 0.0000 --Y 3048.721689 0 0.0430 626 Out.. lnL = -3048.721689 627 lfun, 627 eigenQcodon, 4389 P(t) Time used: 0:03 Model 1: NearlyNeutral TREE # 1 (1, (4, 5), (2, 3)); MP score: 256 0.121730 0.115658 0.186599 0.190664 0.027873 0.034840 0.008926 2.278506 0.573207 0.492243 ntime & nrate & np: 7 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 5.551767 np = 10 lnL0 = -3151.364912 Iterating by ming2 Initial: fx= 3151.364912 x= 0.12173 0.11566 0.18660 0.19066 0.02787 0.03484 0.00893 2.27851 0.57321 0.49224 1 h-m-p 0.0000 0.0002 165.8191 ++YYYYCC 3148.774501 5 0.0002 23 | 0/10 2 h-m-p 0.0000 0.0004 1852.8218 ++YYYYCCCCCC 3130.602934 9 0.0002 52 | 0/10 3 h-m-p 0.0000 0.0001 2153.8311 +YYCCCCC 3115.454021 6 0.0001 76 | 0/10 4 h-m-p 0.0009 0.0043 58.3059 YCCC 3114.711467 3 0.0005 94 | 0/10 5 h-m-p 0.0006 0.0032 37.1230 YYC 3114.420137 2 0.0005 109 | 0/10 6 h-m-p 0.0015 0.0166 13.1194 YC 3114.356074 1 0.0006 123 | 0/10 7 h-m-p 0.0005 0.0109 16.9077 +YC 3114.157396 1 0.0016 138 | 0/10 8 h-m-p 0.0007 0.0068 42.5809 CCC 3113.887479 2 0.0009 155 | 0/10 9 h-m-p 0.0006 0.0857 60.6452 ++YCCC 3105.643114 3 0.0198 175 | 0/10 10 h-m-p 0.0005 0.0024 1448.2104 YCCCCC 3094.980053 5 0.0009 197 | 0/10 11 h-m-p 0.0646 0.3230 0.4690 +YYYCCC 3073.768240 5 0.2380 218 | 0/10 12 h-m-p 0.0492 0.7084 2.2699 +CYYCCC 3057.886666 5 0.4260 251 | 0/10 13 h-m-p 0.1824 0.9122 4.3562 CYCCCC 3045.242899 5 0.3842 273 | 0/10 14 h-m-p 0.4921 2.4604 0.3076 CCCC 3042.843277 3 0.4285 292 | 0/10 15 h-m-p 0.2819 3.1774 0.4677 YC 3041.360819 1 0.6252 316 | 0/10 16 h-m-p 1.1197 6.0861 0.2611 YCC 3040.752192 2 0.7949 342 | 0/10 17 h-m-p 1.5717 7.8586 0.0240 CC 3040.697268 1 0.4306 367 | 0/10 18 h-m-p 0.3536 8.0000 0.0292 YC 3040.689281 1 0.7718 391 | 0/10 19 h-m-p 1.6000 8.0000 0.0092 YC 3040.683884 1 0.7647 415 | 0/10 20 h-m-p 1.6000 8.0000 0.0018 YC 3040.683679 1 1.0448 439 | 0/10 21 h-m-p 1.6000 8.0000 0.0001 C 3040.683662 0 1.9745 462 | 0/10 22 h-m-p 1.6000 8.0000 0.0001 C 3040.683660 0 1.6675 485 | 0/10 23 h-m-p 1.6000 8.0000 0.0000 Y 3040.683660 0 1.2186 508 | 0/10 24 h-m-p 1.6000 8.0000 0.0000 Y 3040.683660 0 1.1109 531 | 0/10 25 h-m-p 1.6000 8.0000 0.0000 -C 3040.683660 0 0.1000 555 | 0/10 26 h-m-p 0.1216 8.0000 0.0000 -----C 3040.683660 0 0.0000 583 Out.. lnL = -3040.683660 584 lfun, 1752 eigenQcodon, 8176 P(t) Time used: 0:06 Model 2: PositiveSelection TREE # 1 (1, (4, 5), (2, 3)); MP score: 256 initial w for M2:NSpselection reset. 0.121730 0.115658 0.186599 0.190664 0.027873 0.034840 0.008926 2.280481 0.986220 0.117156 0.463564 2.408838 ntime & nrate & np: 7 3 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.378220 np = 12 lnL0 = -3177.487088 Iterating by ming2 Initial: fx= 3177.487088 x= 0.12173 0.11566 0.18660 0.19066 0.02787 0.03484 0.00893 2.28048 0.98622 0.11716 0.46356 2.40884 1 h-m-p 0.0000 0.0044 171.3739 ++YCYCC 3174.012205 4 0.0003 25 | 0/12 2 h-m-p 0.0001 0.0004 262.5897 +YCYCCC 3165.482764 5 0.0003 49 | 0/12 3 h-m-p 0.0000 0.0000 16827.6660 ++ 3110.150946 m 0.0000 64 | 1/12 4 h-m-p 0.0000 0.0002 485.7638 YCCC 3109.698206 3 0.0001 84 | 1/12 5 h-m-p 0.0002 0.0052 210.8364 YCCC 3108.037513 3 0.0004 104 | 1/12 6 h-m-p 0.0013 0.0083 64.2782 +YYCCCC 3101.315220 5 0.0040 128 | 1/12 7 h-m-p 0.0017 0.0086 77.2415 YYCC 3099.322773 3 0.0015 147 | 1/12 8 h-m-p 0.0028 0.0275 41.3446 +YCCC 3095.083955 3 0.0079 168 | 1/12 9 h-m-p 0.0015 0.0096 212.5383 +CYCC 3077.755751 3 0.0059 189 | 1/12 10 h-m-p 0.0007 0.0036 121.8984 YCCC 3077.102965 3 0.0005 209 | 1/12 11 h-m-p 0.0088 0.0844 6.6181 ++ 3070.219508 m 0.0844 224 | 2/12 12 h-m-p 0.2252 1.1983 1.8850 YCCCC 3064.747733 4 0.1383 246 | 2/12 13 h-m-p 0.0989 0.4945 2.0720 +YYCCCC 3057.494813 5 0.3174 270 | 2/12 14 h-m-p 0.4860 2.4618 1.3532 CYCCCC 3052.017577 5 0.7833 294 | 1/12 15 h-m-p 0.0005 0.0025 907.9839 CCC 3051.514902 2 0.0001 313 | 1/12 16 h-m-p 0.1513 8.0000 0.7607 +YCCC 3047.372731 3 1.2609 334 | 1/12 17 h-m-p 1.5810 7.9049 0.3988 CCCCC 3043.627576 4 1.7851 368 | 1/12 18 h-m-p 1.6000 8.0000 0.3880 CYCC 3042.075351 3 1.1586 399 | 1/12 19 h-m-p 1.6000 8.0000 0.1849 YCC 3041.513704 2 1.1874 428 | 1/12 20 h-m-p 1.5412 8.0000 0.1425 CC 3041.230262 1 1.4373 456 | 1/12 21 h-m-p 1.6000 8.0000 0.0865 C 3041.093803 0 1.5851 482 | 1/12 22 h-m-p 1.6000 8.0000 0.0436 YCC 3041.027101 2 1.2447 511 | 1/12 23 h-m-p 1.6000 8.0000 0.0337 YC 3040.966895 1 3.5058 538 | 1/12 24 h-m-p 1.6000 8.0000 0.0416 +YC 3040.841162 1 5.3358 566 | 1/12 25 h-m-p 1.6000 8.0000 0.0333 YCCC 3040.707986 3 2.5935 597 | 1/12 26 h-m-p 1.2114 8.0000 0.0713 CC 3040.684629 1 1.2761 625 | 1/12 27 h-m-p 1.6000 8.0000 0.0037 YC 3040.683696 1 1.1040 652 | 1/12 28 h-m-p 1.6000 8.0000 0.0005 Y 3040.683662 0 0.8642 678 | 1/12 29 h-m-p 0.8497 8.0000 0.0005 C 3040.683660 0 1.0022 704 | 1/12 30 h-m-p 1.6000 8.0000 0.0000 Y 3040.683660 0 0.9428 730 | 1/12 31 h-m-p 1.6000 8.0000 0.0000 Y 3040.683660 0 1.0897 756 | 1/12 32 h-m-p 1.6000 8.0000 0.0000 C 3040.683660 0 1.9500 782 | 1/12 33 h-m-p 1.6000 8.0000 0.0000 Y 3040.683660 0 2.6875 808 | 1/12 34 h-m-p 1.6000 8.0000 0.0000 C 3040.683660 0 1.6000 834 | 1/12 35 h-m-p 1.6000 8.0000 0.0000 ---------------Y 3040.683660 0 0.0000 875 Out.. lnL = -3040.683660 876 lfun, 3504 eigenQcodon, 18396 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3051.160026 S = -2919.534498 -122.461700 Calculating f(w|X), posterior probabilities of site classes. did 10 / 233 patterns 0:15 did 20 / 233 patterns 0:15 did 30 / 233 patterns 0:15 did 40 / 233 patterns 0:15 did 50 / 233 patterns 0:15 did 60 / 233 patterns 0:15 did 70 / 233 patterns 0:15 did 80 / 233 patterns 0:15 did 90 / 233 patterns 0:16 did 100 / 233 patterns 0:16 did 110 / 233 patterns 0:16 did 120 / 233 patterns 0:16 did 130 / 233 patterns 0:16 did 140 / 233 patterns 0:16 did 150 / 233 patterns 0:16 did 160 / 233 patterns 0:16 did 170 / 233 patterns 0:16 did 180 / 233 patterns 0:16 did 190 / 233 patterns 0:16 did 200 / 233 patterns 0:16 did 210 / 233 patterns 0:16 did 220 / 233 patterns 0:16 did 230 / 233 patterns 0:16 did 233 / 233 patterns 0:16 Time used: 0:16 Model 3: discrete TREE # 1 (1, (4, 5), (2, 3)); MP score: 256 0.121730 0.115658 0.186599 0.190664 0.027873 0.034840 0.008926 2.280482 0.331355 0.382499 0.052503 0.131070 0.219462 ntime & nrate & np: 7 4 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 12.263359 np = 13 lnL0 = -3047.212988 Iterating by ming2 Initial: fx= 3047.212988 x= 0.12173 0.11566 0.18660 0.19066 0.02787 0.03484 0.00893 2.28048 0.33136 0.38250 0.05250 0.13107 0.21946 1 h-m-p 0.0000 0.0002 110.7305 +YCCCC 3046.684035 4 0.0001 26 | 0/13 2 h-m-p 0.0000 0.0002 290.2583 YCCC 3045.902036 3 0.0001 47 | 0/13 3 h-m-p 0.0000 0.0002 165.4852 ++ 3043.738793 m 0.0002 63 | 1/13 4 h-m-p 0.0004 0.0029 51.5864 CYC 3043.427156 2 0.0005 82 | 1/13 5 h-m-p 0.0001 0.0009 156.7894 +CYC 3041.770576 2 0.0006 102 | 1/13 6 h-m-p 0.0001 0.0007 82.7972 +CC 3041.293076 1 0.0005 121 | 1/13 7 h-m-p 0.0044 0.0302 9.5179 YC 3041.254720 1 0.0008 138 | 0/13 8 h-m-p 0.0002 0.0567 35.4005 +CYC 3040.870124 2 0.0007 158 | 0/13 9 h-m-p 0.0004 0.0018 11.9705 CC 3040.831241 1 0.0006 176 | 0/13 10 h-m-p 0.0022 0.0210 3.1977 YC 3040.825935 1 0.0010 193 | 0/13 11 h-m-p 0.0011 0.0699 2.9139 ++YC 3040.665202 1 0.0398 212 | 0/13 12 h-m-p 0.0009 0.0047 4.7867 ++ 3040.614473 m 0.0047 228 | 1/13 13 h-m-p 0.0241 0.4205 0.9319 +YCCC 3040.364238 3 0.2384 250 | 0/13 14 h-m-p 0.0005 0.0025 69.3086 ++ 3040.239448 m 0.0025 278 | 0/13 15 h-m-p 0.3035 1.5174 0.5332 CYC 3040.102081 2 0.2647 297 | 0/13 16 h-m-p 0.0929 0.4644 0.5809 +YC 3040.025831 1 0.2381 328 | 0/13 17 h-m-p 0.1190 0.5949 0.1634 ++ 3039.978723 m 0.5949 357 | 1/13 18 h-m-p 1.5603 7.8016 0.0102 YC 3039.974559 1 1.0317 387 | 1/13 19 h-m-p 0.1583 2.1937 0.0667 C 3039.974306 0 0.1346 415 | 1/13 20 h-m-p 0.3815 1.9076 0.0114 YC 3039.973224 1 0.8752 444 | 1/13 21 h-m-p 1.6000 8.0000 0.0020 C 3039.973067 0 1.5827 472 | 0/13 22 h-m-p 0.0139 0.0752 0.2293 -Y 3039.973065 0 0.0005 501 | 0/13 23 h-m-p 0.0336 1.0026 0.0033 +++ 3039.973022 m 1.0026 531 | 1/13 24 h-m-p 0.0560 8.0000 0.0593 ++Y 3039.972700 0 0.8966 562 | 1/13 25 h-m-p 1.4222 8.0000 0.0374 YY 3039.972349 1 1.4222 591 | 0/13 26 h-m-p 0.0030 1.5120 65.9732 C 3039.972021 0 0.0008 619 | 0/13 27 h-m-p 1.6000 8.0000 0.0139 YC 3039.971639 1 0.7909 636 | 0/13 28 h-m-p 0.4023 8.0000 0.0272 +YC 3039.971523 1 1.0506 667 | 0/13 29 h-m-p 1.6000 8.0000 0.0086 ++ 3039.971199 m 8.0000 696 | 0/13 30 h-m-p 1.0483 5.2416 0.0128 ++ 3039.969004 m 5.2416 725 | 1/13 31 h-m-p 0.1451 8.0000 0.4627 +YCYC 3039.963397 3 0.4358 759 | 0/13 32 h-m-p 0.0000 0.0019 44388.0568 ---Y 3039.963397 0 0.0000 790 | 0/13 33 h-m-p 0.0004 0.0020 0.2730 ++ 3039.963361 m 0.0020 806 | 1/13 34 h-m-p 0.0122 6.0900 0.3545 ++CY 3039.957895 1 0.2452 839 | 1/13 35 h-m-p 0.1608 0.9332 0.5404 ---------------.. | 1/13 36 h-m-p 0.0018 0.8762 17.0283 --CC 3039.954859 1 0.0000 912 | 1/13 37 h-m-p 0.0001 0.0648 2.4907 C 3039.954490 0 0.0001 928 | 1/13 38 h-m-p 0.0004 0.2063 0.7865 YC 3039.954290 1 0.0007 945 | 1/13 39 h-m-p 0.0003 0.1354 2.8459 Y 3039.954102 0 0.0002 973 | 1/13 40 h-m-p 0.0008 0.3855 1.3181 +YC 3039.953257 1 0.0026 991 | 1/13 41 h-m-p 0.0011 0.1697 3.1492 YC 3039.952819 1 0.0006 1008 | 1/13 42 h-m-p 0.0051 1.5101 0.3709 Y 3039.952706 0 0.0024 1024 | 1/13 43 h-m-p 0.0076 3.7954 0.7644 -Y 3039.952641 0 0.0008 1053 | 1/13 44 h-m-p 0.0066 3.3188 0.1370 C 3039.952627 0 0.0019 1081 | 1/13 45 h-m-p 0.0160 8.0000 0.2942 ++CCC 3039.947674 2 0.3340 1115 | 1/13 46 h-m-p 0.0988 8.0000 0.9944 YYC 3039.943495 2 0.0822 1145 | 0/13 47 h-m-p 0.0015 0.7342 138.6664 YC 3039.941043 1 0.0007 1174 | 0/13 48 h-m-p 1.6000 8.0000 0.0496 YC 3039.934519 1 1.1108 1191 | 0/13 49 h-m-p 0.6815 6.0018 0.0808 +CCC 3039.924581 2 3.0452 1225 | 0/13 50 h-m-p 0.0715 0.3576 0.2906 ++ 3039.918138 m 0.3576 1254 | 1/13 51 h-m-p 1.1624 8.0000 0.0894 YC 3039.914766 1 0.5559 1284 | 1/13 52 h-m-p 0.7480 8.0000 0.0664 C 3039.911112 0 0.7892 1312 | 1/13 53 h-m-p 1.5323 8.0000 0.0342 YC 3039.907805 1 2.5795 1341 | 1/13 54 h-m-p 0.9140 8.0000 0.0966 C 3039.906777 0 0.9606 1369 | 1/13 55 h-m-p 1.1403 8.0000 0.0814 ++ 3039.890313 m 8.0000 1397 | 1/13 56 h-m-p 0.6149 8.0000 1.0585 CYC 3039.884308 2 0.2521 1428 | 1/13 57 h-m-p 0.2079 7.2014 1.2835 CCC 3039.869658 2 0.3330 1448 | 1/13 58 h-m-p 1.6000 8.0000 0.0901 YCC 3039.856990 2 0.9725 1467 | 1/13 59 h-m-p 0.1191 8.0000 0.7356 +CYCC 3039.831508 3 0.8144 1501 | 1/13 60 h-m-p 1.6000 8.0000 0.2605 +YCC 3039.771269 2 5.1911 1533 | 0/13 61 h-m-p 0.0324 3.2395 41.7253 --Y 3039.771214 0 0.0004 1563 | 0/13 62 h-m-p 0.0012 0.0062 1.8226 ++ 3039.769562 m 0.0062 1579 | 1/13 63 h-m-p 0.0078 3.9176 1.9029 ++YC 3039.758785 1 0.0791 1598 | 1/13 64 h-m-p 0.2513 8.0000 0.5991 +YYC 3039.719720 2 0.8683 1617 | 1/13 65 h-m-p 1.3013 8.0000 0.3997 C 3039.710237 0 1.2694 1645 | 1/13 66 h-m-p 1.6000 8.0000 0.0226 YC 3039.706904 1 1.0228 1674 | 1/13 67 h-m-p 0.3367 8.0000 0.0686 ++CC 3039.700519 1 5.0095 1706 | 1/13 68 h-m-p 1.6000 8.0000 0.0404 ++ 3039.664085 m 8.0000 1734 | 1/13 69 h-m-p 0.7225 8.0000 0.4474 CCC 3039.652089 2 1.0528 1766 | 1/13 70 h-m-p 1.6000 8.0000 0.0835 YC 3039.650310 1 0.8784 1795 | 1/13 71 h-m-p 1.3191 8.0000 0.0556 C 3039.649964 0 1.3191 1823 | 1/13 72 h-m-p 1.6000 8.0000 0.0097 Y 3039.649928 0 1.2028 1851 | 1/13 73 h-m-p 1.6000 8.0000 0.0012 Y 3039.649928 0 0.9833 1879 | 1/13 74 h-m-p 1.6000 8.0000 0.0001 Y 3039.649928 0 0.8698 1907 | 1/13 75 h-m-p 1.6000 8.0000 0.0000 C 3039.649928 0 1.6000 1935 | 1/13 76 h-m-p 1.6000 8.0000 0.0000 Y 3039.649928 0 1.6000 1963 | 1/13 77 h-m-p 1.6000 8.0000 0.0000 -C 3039.649928 0 0.1000 1992 | 1/13 78 h-m-p 0.5659 8.0000 0.0000 ---------------Y 3039.649928 0 0.0000 2035 Out.. lnL = -3039.649928 2036 lfun, 8144 eigenQcodon, 42756 P(t) Time used: 0:36 Model 7: beta TREE # 1 (1, (4, 5), (2, 3)); MP score: 256 0.121730 0.115658 0.186599 0.190664 0.027873 0.034840 0.008926 2.260221 0.665673 1.549129 ntime & nrate & np: 7 1 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 9.070570 np = 10 lnL0 = -3069.255319 Iterating by ming2 Initial: fx= 3069.255319 x= 0.12173 0.11566 0.18660 0.19066 0.02787 0.03484 0.00893 2.26022 0.66567 1.54913 1 h-m-p 0.0000 0.0004 117.0644 ++YYC 3068.371539 2 0.0001 19 | 0/10 2 h-m-p 0.0001 0.0031 291.8024 CYCCC 3067.866150 4 0.0000 39 | 0/10 3 h-m-p 0.0001 0.0037 189.8148 ++YYCYYCCC 3046.944105 7 0.0021 65 | 0/10 4 h-m-p 0.0000 0.0002 1772.6834 CCCCC 3044.423802 4 0.0000 86 | 0/10 5 h-m-p 0.0009 0.0044 62.5478 YCCC 3043.754263 3 0.0005 104 | 0/10 6 h-m-p 0.0016 0.0101 19.5265 YCC 3043.632636 2 0.0007 120 | 0/10 7 h-m-p 0.0006 0.0817 24.4011 ++CCCC 3041.404157 3 0.0146 141 | 0/10 8 h-m-p 0.0022 0.0110 44.8266 CC 3041.241785 1 0.0007 156 | 0/10 9 h-m-p 0.0343 0.5114 0.8549 CC 3041.228814 1 0.0102 171 | 0/10 10 h-m-p 0.0007 0.1959 12.3054 ++CCCC 3040.842485 3 0.0192 202 | 0/10 11 h-m-p 0.2525 1.2626 0.4690 CCCC 3040.280665 3 0.2727 221 | 0/10 12 h-m-p 1.6000 8.0000 0.0546 YC 3040.200924 1 2.9216 245 | 0/10 13 h-m-p 0.9668 8.0000 0.1651 +YYYC 3039.969888 3 3.6929 272 | 0/10 14 h-m-p 1.6000 8.0000 0.0619 YC 3039.937809 1 1.0311 296 | 0/10 15 h-m-p 1.6000 8.0000 0.0273 YC 3039.935685 1 0.9804 320 | 0/10 16 h-m-p 1.2361 8.0000 0.0217 YC 3039.935217 1 0.8041 344 | 0/10 17 h-m-p 1.6000 8.0000 0.0022 YC 3039.935164 1 0.8869 368 | 0/10 18 h-m-p 1.6000 8.0000 0.0001 Y 3039.935164 0 1.0957 391 | 0/10 19 h-m-p 1.6000 8.0000 0.0000 Y 3039.935164 0 0.8101 414 | 0/10 20 h-m-p 1.6000 8.0000 0.0000 Y 3039.935164 0 0.2655 437 | 0/10 21 h-m-p 0.3925 8.0000 0.0000 C 3039.935164 0 0.0981 460 | 0/10 22 h-m-p 0.0992 8.0000 0.0000 C 3039.935164 0 0.0248 483 | 0/10 23 h-m-p 0.0317 8.0000 0.0000 -------Y 3039.935164 0 0.0000 513 Out.. lnL = -3039.935164 514 lfun, 5654 eigenQcodon, 35980 P(t) Time used: 0:52 Model 8: beta&w>1 TREE # 1 (1, (4, 5), (2, 3)); MP score: 256 initial w for M8:NSbetaw>1 reset. 0.121730 0.115658 0.186599 0.190664 0.027873 0.034840 0.008926 2.261502 0.900000 0.401601 1.403915 2.022819 ntime & nrate & np: 7 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 7.848763 np = 12 lnL0 = -3075.596560 Iterating by ming2 Initial: fx= 3075.596560 x= 0.12173 0.11566 0.18660 0.19066 0.02787 0.03484 0.00893 2.26150 0.90000 0.40160 1.40392 2.02282 1 h-m-p 0.0000 0.0004 318.4121 +++ 3055.702236 m 0.0004 18 | 1/12 2 h-m-p 0.0000 0.0002 154.7220 YCYCCC 3054.828335 5 0.0001 41 | 1/12 3 h-m-p 0.0000 0.0008 339.0805 +CYCCC 3049.108767 4 0.0003 64 | 1/12 4 h-m-p 0.0002 0.0008 322.7139 CCCCC 3046.559512 4 0.0002 87 | 1/12 5 h-m-p 0.0014 0.0073 44.4763 CCC 3046.100183 2 0.0006 106 | 0/12 6 h-m-p 0.0002 0.0055 128.7560 YCCCC 3045.574245 4 0.0001 128 | 0/12 7 h-m-p 0.0014 0.0752 8.9276 +YC 3045.430483 1 0.0035 145 | 0/12 8 h-m-p 0.0007 0.0316 42.3958 +YCCC 3044.092284 3 0.0072 166 | 0/12 9 h-m-p 0.0008 0.0039 259.6757 +YCCC 3041.309301 3 0.0024 187 | 0/12 10 h-m-p 0.0063 0.0315 7.6543 YC 3041.292246 1 0.0009 203 | 0/12 11 h-m-p 0.0011 0.0572 5.7522 +++ 3040.356369 m 0.0572 219 | 0/12 12 h-m-p -0.0000 -0.0000 0.3252 h-m-p: -0.00000000e+00 -0.00000000e+00 3.25249142e-01 3040.356369 .. | 0/12 13 h-m-p 0.0000 0.0010 55.5436 ++YCC 3040.176166 2 0.0001 263 | 0/12 14 h-m-p 0.0001 0.0023 45.1475 CCC 3040.156602 2 0.0000 282 | 0/12 15 h-m-p 0.0001 0.0088 23.9085 +CC 3040.102498 1 0.0003 300 | 0/12 16 h-m-p 0.0003 0.0119 23.8506 CCC 3040.068393 2 0.0002 319 | 0/12 17 h-m-p 0.0003 0.0146 17.6496 YC 3040.009658 1 0.0008 335 | 0/12 18 h-m-p 0.0010 0.0221 13.0492 CC 3039.975214 1 0.0009 352 | 0/12 19 h-m-p 0.0026 0.0973 4.3748 CC 3039.971351 1 0.0006 369 | 0/12 20 h-m-p 0.0022 1.1116 1.2650 CC 3039.968912 1 0.0035 386 | 0/12 21 h-m-p 0.0004 0.1660 9.8795 ++CCC 3039.921859 2 0.0089 407 | 0/12 22 h-m-p 0.0037 0.0511 23.9558 CC 3039.912131 1 0.0008 424 | 0/12 23 h-m-p 0.2088 8.0000 0.0899 +CC 3039.908402 1 0.8574 442 | 0/12 24 h-m-p 1.0259 5.1295 0.0745 CYC 3039.900431 2 1.7711 472 | 0/12 25 h-m-p 0.3241 1.6207 0.2146 YC 3039.898024 1 0.3241 500 | 0/12 26 h-m-p 0.7059 7.3592 0.0985 YC 3039.888609 1 1.4962 528 | 0/12 27 h-m-p 1.6000 8.0000 0.0693 +YC 3039.875206 1 4.8967 557 | 0/12 28 h-m-p 0.1592 0.7960 0.4807 YY 3039.873214 1 0.1432 585 | 0/12 29 h-m-p 0.5929 7.7329 0.1160 YC 3039.869276 1 1.1064 613 | 0/12 30 h-m-p 1.6000 8.0000 0.0486 YC 3039.867988 1 1.2959 641 | 0/12 31 h-m-p 0.6627 8.0000 0.0950 C 3039.867516 0 0.7542 668 | 0/12 32 h-m-p 1.6000 8.0000 0.0266 YC 3039.867420 1 0.8250 696 | 0/12 33 h-m-p 1.6000 8.0000 0.0050 C 3039.867417 0 1.4237 723 | 0/12 34 h-m-p 1.6000 8.0000 0.0009 C 3039.867416 0 1.5889 750 | 0/12 35 h-m-p 1.6000 8.0000 0.0002 Y 3039.867416 0 1.2018 777 | 0/12 36 h-m-p 1.6000 8.0000 0.0000 -C 3039.867416 0 0.1000 805 | 0/12 37 h-m-p 0.1084 8.0000 0.0000 ----------C 3039.867416 0 0.0000 842 Out.. lnL = -3039.867416 843 lfun, 10116 eigenQcodon, 64911 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3050.859479 S = -2919.850373 -122.691021 Calculating f(w|X), posterior probabilities of site classes. did 10 / 233 patterns 1:22 did 20 / 233 patterns 1:22 did 30 / 233 patterns 1:23 did 40 / 233 patterns 1:23 did 50 / 233 patterns 1:23 did 60 / 233 patterns 1:23 did 70 / 233 patterns 1:23 did 80 / 233 patterns 1:24 did 90 / 233 patterns 1:24 did 100 / 233 patterns 1:24 did 110 / 233 patterns 1:24 did 120 / 233 patterns 1:24 did 130 / 233 patterns 1:24 did 140 / 233 patterns 1:25 did 150 / 233 patterns 1:25 did 160 / 233 patterns 1:25 did 170 / 233 patterns 1:25 did 180 / 233 patterns 1:25 did 190 / 233 patterns 1:26 did 200 / 233 patterns 1:26 did 210 / 233 patterns 1:26 did 220 / 233 patterns 1:26 did 230 / 233 patterns 1:26 did 233 / 233 patterns 1:27 Time used: 1:27 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=5, Len=447 D_melanogaster_Gr28b-PE MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT D_sechellia_Gr28b-PE MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT D_simulans_Gr28b-PE MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT D_yakuba_Gr28b-PE MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT D_erecta_Gr28b-PE MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA * ** * * **********:***** :*** ****** *::*: *** *: D_melanogaster_Gr28b-PE SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN D_sechellia_Gr28b-PE SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN D_simulans_Gr28b-PE SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN D_yakuba_Gr28b-PE SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN D_erecta_Gr28b-PE SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN ***:**:**::***:** ******::*.:********.******.***** D_melanogaster_Gr28b-PE GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM D_sechellia_Gr28b-PE GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM D_simulans_Gr28b-PE GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM D_yakuba_Gr28b-PE GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM D_erecta_Gr28b-PE GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM ***** ****:***:*::**:*** ** *************:****::** D_melanogaster_Gr28b-PE NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF D_sechellia_Gr28b-PE NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF D_simulans_Gr28b-PE NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF D_yakuba_Gr28b-PE NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF D_erecta_Gr28b-PE NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF **** :*****.**********.***::*****:***:**** ****:** D_melanogaster_Gr28b-PE LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM D_sechellia_Gr28b-PE LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM D_simulans_Gr28b-PE LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM D_yakuba_Gr28b-PE LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM D_erecta_Gr28b-PE LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM *.**:********.****************:**** *********:**** D_melanogaster_Gr28b-PE YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF D_sechellia_Gr28b-PE YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF D_simulans_Gr28b-PE YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF D_yakuba_Gr28b-PE YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF D_erecta_Gr28b-PE YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF ************************************************** D_melanogaster_Gr28b-PE DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI D_sechellia_Gr28b-PE DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI D_simulans_Gr28b-PE DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI D_yakuba_Gr28b-PE DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI D_erecta_Gr28b-PE DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI ************************************************** D_melanogaster_Gr28b-PE KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR D_sechellia_Gr28b-PE KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR D_simulans_Gr28b-PE KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR D_yakuba_Gr28b-PE KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR D_erecta_Gr28b-PE KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR ************************************************** D_melanogaster_Gr28b-PE TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL D_sechellia_Gr28b-PE TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL D_simulans_Gr28b-PE TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL D_yakuba_Gr28b-PE TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL D_erecta_Gr28b-PE TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL ***************************************.*******
>D_melanogaster_Gr28b-PE ATGTGGCTCCTTAGGCGATCGGTTGGAAAATCGGGCAACCGACCACACGA CGTATACACCTGCTATCGATTGACTATATTCATGGCACTTTGTCTCGGAA TTGTGCCTTACTACGTATCCATATCTTCGGAAGGCAGAGGAAAACTAACA TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT GGTCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT TTTTCCTTACAGACATATCCAATGTGATAGATGCTTTGCAAAAGATCAAT GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTATTGAACCGAAA AGAATTGCTAAAACTGCTGGCCACATTCGATAGACTTGAGACGGAGGCGT TTCCACGGGTGGGCGTGGCAATGCACCAGGTTGCAGCTAATAAGAAAATG AATCGATTGGTTATAATCCTTGTTGGCAGTATGGTGGCATATATAACCTG TAGTTTTCTGATGATCAGTTTGAGAGACACGACCACATTTTCTATCTCAG CAGTGATTAGTTTTTTTTCACCACATTTTATCGTGTGCGCGGTTTCTTTT CTGGCTGGAAATGTAATGATTAAGTTACGCATATATCTGAGTGCACTTAA CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG CAGTGAATCAAAAACAGCGCTCTCTACAATGTCTCGATTCATTTTCCATG TACACCATTGTAACCAAGGATCCTGCGGAGATTATACAGGAGTCCATGGA GATACATCATCTCATTTGCGAGGCAGCTGCCACGGCTAACAAATATTTTA CCTACCAATTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCATACTATGTTCTGGAGACGCTACTGGGAAAATCGAAGCGCGAAAG CAAATTCAAAACTGTGGAATTTGTGACATTTTTCTCGTGTCAAATGATTT TGTATCTGATCGCCATAATTTCCATTGTCGAGGGAAGTAATCGAGCCATC AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA TGCATCTGAAAATTAATTTTACTGCAGCTGGTCTGTTCAACATCGACCGC ACATTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCGAACAATGGTTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT >D_sechellia_Gr28b-PE ATGTGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCTCACGA CGTATACACCTGCTATCGGCTGACAACATTCATGGCACTTTGCCTCGGAA TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA TCCTCCTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT GGGCAACTCATTCTACGGTGCCGTCAATCGGGATACGTTGATGTCCAACT TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC GGAATGCTGGGAATATTTGCCATTTTACTTATATCGCTGCTGAACCGGAA GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG AATCGATTGGTTATGATCCTGGTTGGCAGTATGGTGGCATATATAACCTG TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT CTGGCTGGAAATGTAATGATAAAATTACGCATATATCTGGGTGCTCTTAA CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGAACTCATTTTCCATG TACACCATTGTAACAAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTCCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC TGTATCTAATCGCCATTATTTCGATTGTCGAGGGAAGTAATCGCGCCATC AAGAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT >D_simulans_Gr28b-PE ATGGGGCTCCTTAGGCGAATGGTTGGGAAATCGGGCAACCGACCACACGA CGTATACACCTGCTATCGACTGACCATATTCATGGCACTTTGCCTCGGAA TTGTGCCGTATTACGTGACCATATCTTCAGAAGGCAGAGGAAAACTAACA TCCTCGTACATCGGCTACATCAACATCATCATACGAATGGCCATATATAT GGGCAACTCATTCTACGGCGCCGTCAATCGGGATACGTTGATGTCCAACT TTTTCCTTACGGACATATCGAATGTGATAGATGCTTTGCAAAAGATCAAC GGAATGCTGGGAATATTTGCCATATTACTTATATCGCTGCTGAACCGGAA GGAATTGCTGAAACTGCTGGCCCTATTCGATGGACTTGAGACGGAGGCGT TTCCACGCGTGGGCGTGGCAATGCAGCAGGTTGCAGCTAATAAGAAAATG AATCGATTGGTTATGATCCTGGTGGGCAGTATGGTGGCATATATAACCTG TAGTTTTCTGATGATCGGTTTGAGAGACACGGCCACATTTTCCATCTCAG CGGTGATTAGTTATTTTTCACCACATTTTATCGTGTGCGCGATTTCTTTT CTGGCTGGAAATGTAATGATCAAATTACGCATATATCTGGGTGCTCTTAA CGAGGTGTTGAAGAACCTAGCCCATCAATGGGACACCCGAAGCCTCAAGG CAGTGACTCAAAAACAGCGTTCTCTACAATGTCTGGACTCATTTTCCATG TACACCATTGTAACCAAGGATCCTGCAGAGATTATACAGGAGTCCATGGA GATACATCATCTCATTTGCGAGGCCGCTGCCACGGCCAACAAATATTTTA CCTACCAACTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTTCTGGAGACCCTGCTGGGAAAATCGAAGCGCGAAAG CAAGTTCAAAACTGTGGAATTTGTGACGTTTTTCTCGTGTCAAATGATCC TGTATTTGATCGCCATAATTTCCATTGTCGAGGGCAGTAATCGCGCCATC AAAAAGAGCGAGAAAACTGGAGGCATAGTGCACTCCCTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGTTGA TGCATCTCAAAATTAATTTCACCGCTGCCGGTCTGTTCAACATCGACCGC ACTTTGTATTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAATAATATGACGAATCATACGCTT >D_yakuba_Gr28b-PE ATGTGGCTCCTTGGACGATTGGTCAGGAAATCGGGTAACCGACCACACGA CGTATACACCTGCTATCGCCTGACCATATTCATGGCCCTCTGCCTTGGGA TTGTGCCCTACAACGTGACCATATCTTCAGAAGGCAGAGGAGTACTAACA TCCTCCTACTTGGGCTACATCAACATCCTCATACGAATGGCCATCTATAT GGGCAACTCATTCTACGGCGCCGTCCATCGGGATGCCTTGATGTCCAACT TTTTCCTTACGGGCATATCCAATGTGATCGATGGACTGCAGAAGATCAAC GGAATGCTGGGCATCTCTGCCATATTGCTTCTATCGCTGCTGCATCGCAG GGAATTGCTGCAACTGCTGGCCATTTTCGATGCACTCGAGACGGAGGCGT TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCGGCTAAGAAGAAAATG AATCGATTGGTGGCATTGCTGGTGGGCAGTATGGCGGCTTATATAACGTG CAGTTTTCTGATGATCGGCCTGAGAGACGCGACCACATTTTCCATCTCAT CGGTGATTAGTTACTTTTCACCACATTGTATCGTGTGCGCGGTTTCTTTT CTGGTCGGAAATGTAATGATCAAGTTACGCATTTACCTGGGTGCTCTTAA CGAGGTGTTGAAAAACCTAGCCCATCAATGGGACACCCGTACTCTGAAGG CAGTGACTCAGAAACAGCGCTCTCTGCAGTGTCTGGATTCATTCTCCATG TACACCATTGTAACCAAGGATCCTGCCGAGATCATACAGGAGTCCATGGA GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTCA CCTACCAACTGCTGACCATTATTTCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTACTGGAAACGCTGCTGGGCAAATCGAAGCGTGAAAG CAAATTCAAAACTGTGGAATTCGTCACGTTTTTCTCCTGCCAAATGATCC TGTATCTGATTGCCATCATTTCGATTGTCGAAGGAAGCAATCGGGCTATT AAAAAGAGCGAGAAAACGGGTGGAATAGTGCACTCACTACTCAATAAAAC CAAAAGTGCTGAGGTCAAGGAGAAACTGCAGCAATTCTCCATGCAGCTGA TGCATCTGAAAATTAACTTCACCGCAGCTGGACTGTTCAACATCGACCGC ACTTTGTACTTCACAATCAGCGGCGCCCTGACCACTTATCTCATCATCTT GCTGCAGTTCACATCCAATTCCCCCAACAATGGCTATGGAAATGGCAGCT CCTGCTGCGAGACCTTCAATAATATGACGAATCATACGCTT >D_erecta_Gr28b-PE ATGTGGCTCCTTGGGCGATTGGTTAGGAAGTCGGGTAACCGACCACACGA CGTGTACAGCTGCTATCGATTGACCATACTCATGGCCCTTTGGCTCGGGA TTGTGCCCTACTACGTAACCGTATCTGCAGGAGGCCGAGGAAAACTGGCA TCTTCGTACATCGGCTACGTCAACATCCTCATGCGAATGGCCGTTTATAT GGGCAACTCGTTCTACGGCGCCATCAATCGGAGCTCGCTAATGTCCAACT TCTTCCTGACGGACATATCCAACGTGATAGATGGACTGCAAAAGATCAAC GGAATGCTGGGTATCTCCGCCATACTGCTCATATCGCTGCTGAATCGGAG GGATTTGCTGCAACTGCTGGCCATCTTCGATGGACTCGAGACGGAGGCGT TTCCACGGGTGGGCGTGGCAATGCATCAGGTGGCAGCTAACAGGAAAATG AATCGCTTGGTTGGGATCCTGGTGGGCAGCATGGCGGCATATATTACCTG CAGTTTTCTGATGATCGGCCTAAGAGACGCGGCCACATTTTCCATCTCAT CGGTGATTAGTTATTTCTCACCACATTTTATCGTGTGCGCGGTTTCCTTT CTGGCTGGAAACATAATGATCAAATTACGCATATATCTGGGTGCTCTTAA CGAGGTGCTGAAAAACCTAGCCCATCAATGGGACACCCGCACCCTCAAGG CAGTGGCTCAAAAACAGCGCTCCCTACAATGCCTGGATTCGTTCTCCATG TACACCATCGTAACCAAGGATCCTGCCGAGATTATACAGGAGTCCATGGA GATACATCATCTGATTTGCGAGGCCGCCGCCACGGCCAACAAATATTTTA CCTACCAGCTGCTGACCATTATATCCATAGCATTTCTGATCATCGTTTTC GATGCGTACTATGTTCTGGAGACCCTGCTGGGGAAATCGAAGCGTGAAAG CAAATTCAAAACTGTCGAGTTCGTGACGTTTTTCTCCTGTCAAATGATCC TGTATCTGATCGCCATCATTTCGATTGTCGAGGGTAGCAATCGCGCCATC AAGAAGAGCGAGAAGACGGGAGGAATAGTGCACTCCCTACTCAACAAGAC CAAAAGTGCAGAGGTCAAGGAGAAACTGCAGCAGTTCTCCATGCAGTTGA TGCATCTCAAAATAAATTTCACTGCAGCTGGGCTGTTTAACATCGACCGC ACCCTGTACTTCACGATCAGCGGGGCCTTGACCACTTATCTCATCATCTT GCTGCAGTTCACGTCCAATTCCCCCAACAATGGTTATGGGAATGGCAGCT CTTGCTGTGAGACCTTCAGTAACATGACGAATCATACGCTT
>D_melanogaster_Gr28b-PE MWLLRRSVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVSISSEGRGKLT SSYIGYINIIIRMAIYMVNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLATFDRLETEAFPRVGVAMHQVAANKKM NRLVIILVGSMVAYITCSFLMISLRDTTTFSISAVISFFSPHFIVCAVSF LAGNVMIKLRIYLSALNEVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >D_sechellia_Gr28b-PE MWLLRRMVGKSGNRPHDVYTCYRLTTFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLNSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >D_simulans_Gr28b-PE MGLLRRMVGKSGNRPHDVYTCYRLTIFMALCLGIVPYYVTISSEGRGKLT SSYIGYINIIIRMAIYMGNSFYGAVNRDTLMSNFFLTDISNVIDALQKIN GMLGIFAILLISLLNRKELLKLLALFDGLETEAFPRVGVAMQQVAANKKM NRLVMILVGSMVAYITCSFLMIGLRDTATFSISAVISYFSPHFIVCAISF LAGNVMIKLRIYLGALNEVLKNLAHQWDTRSLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >D_yakuba_Gr28b-PE MWLLGRLVRKSGNRPHDVYTCYRLTIFMALCLGIVPYNVTISSEGRGVLT SSYLGYINILIRMAIYMGNSFYGAVHRDALMSNFFLTGISNVIDGLQKIN GMLGISAILLLSLLHRRELLQLLAIFDALETEAFPRVGVAMHQVAAKKKM NRLVALLVGSMAAYITCSFLMIGLRDATTFSISSVISYFSPHCIVCAVSF LVGNVMIKLRIYLGALNEVLKNLAHQWDTRTLKAVTQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL >D_erecta_Gr28b-PE MWLLGRLVRKSGNRPHDVYSCYRLTILMALWLGIVPYYVTVSAGGRGKLA SSYIGYVNILMRMAVYMGNSFYGAINRSSLMSNFFLTDISNVIDGLQKIN GMLGISAILLISLLNRRDLLQLLAIFDGLETEAFPRVGVAMHQVAANRKM NRLVGILVGSMAAYITCSFLMIGLRDAATFSISSVISYFSPHFIVCAVSF LAGNIMIKLRIYLGALNEVLKNLAHQWDTRTLKAVAQKQRSLQCLDSFSM YTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVF DAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAI KKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDR TLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFSNMTNHTL
#NEXUS [ID: 4969495876] begin taxa; dimensions ntax=5; taxlabels D_melanogaster_Gr28b-PE D_sechellia_Gr28b-PE D_simulans_Gr28b-PE D_yakuba_Gr28b-PE D_erecta_Gr28b-PE ; end; begin trees; translate 1 D_melanogaster_Gr28b-PE, 2 D_sechellia_Gr28b-PE, 3 D_simulans_Gr28b-PE, 4 D_yakuba_Gr28b-PE, 5 D_erecta_Gr28b-PE ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.05762753,(4:0.1038699,5:0.09297511)1.000:0.06642698,(2:0.01664755,3:0.003524172)0.999:0.01602277); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.05762753,(4:0.1038699,5:0.09297511):0.06642698,(2:0.01664755,3:0.003524172):0.01602277); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3196.22 -3206.12 2 -3195.98 -3205.30 -------------------------------------- TOTAL -3196.09 -3205.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/262/Gr28b-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363040 0.001527 0.285603 0.436985 0.361368 1288.31 1394.66 1.000 r(A<->C){all} 0.074744 0.000388 0.037570 0.113770 0.073424 999.61 1099.29 1.000 r(A<->G){all} 0.296595 0.001595 0.218618 0.374994 0.295289 871.73 883.83 1.000 r(A<->T){all} 0.077269 0.000326 0.044113 0.113914 0.075875 866.33 1029.92 1.000 r(C<->G){all} 0.125752 0.000634 0.079668 0.177852 0.124475 973.09 1047.22 1.001 r(C<->T){all} 0.386649 0.002133 0.300756 0.479625 0.386949 755.72 809.49 1.001 r(G<->T){all} 0.038991 0.000230 0.012184 0.069326 0.037528 1159.31 1192.89 1.000 pi(A){all} 0.264446 0.000125 0.243300 0.286124 0.264267 1009.13 1058.78 1.000 pi(C){all} 0.241908 0.000120 0.220113 0.262853 0.241950 1194.79 1214.22 1.000 pi(G){all} 0.227232 0.000123 0.205417 0.248965 0.227282 1104.68 1192.07 1.000 pi(T){all} 0.266414 0.000140 0.243327 0.289176 0.266307 1035.93 1119.62 1.000 alpha{1,2} 0.063566 0.001910 0.000277 0.148511 0.057354 1366.54 1433.77 1.000 alpha{3} 2.523163 0.784647 0.984573 4.207629 2.377121 1501.00 1501.00 1.000 pinvar{all} 0.314717 0.006133 0.160949 0.469993 0.318885 1125.16 1166.05 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/262/Gr28b-PE/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 5 ls = 447 Codon usage in sequences ---------------------------------------------------------------------------------------------------------------------- Phe TTT 15 13 13 8 9 | Ser TCT 5 4 4 4 3 | Tyr TAT 10 12 12 8 10 | Cys TGT 5 4 4 2 2 TTC 12 13 13 16 15 | TCC 12 11 11 13 14 | TAC 9 8 8 11 10 | TGC 4 5 5 8 6 Leu TTA 2 2 2 1 1 | TCA 4 5 5 6 2 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 14 10 11 10 7 | TCG 7 6 6 5 9 | TAG 0 0 0 0 0 | Trp TGG 2 2 1 2 3 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 8 7 7 6 4 | Pro CCT 2 2 1 1 1 | His CAT 6 6 6 9 7 | Arg CGT 0 1 1 2 1 CTC 7 7 7 6 10 | CCC 0 1 1 2 2 | CAC 3 2 2 2 2 | CGC 4 5 5 5 6 CTA 7 6 5 4 5 | CCA 3 2 3 3 3 | Gln CAA 7 7 7 5 6 | CGA 8 5 6 4 5 CTG 15 22 22 31 29 | CCG 1 1 1 0 0 | CAG 6 7 7 9 8 | CGG 2 3 2 3 3 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 11 12 10 13 8 | Thr ACT 5 5 5 5 3 | Asn AAT 16 14 14 11 9 | Ser AGT 7 5 5 4 4 ATC 17 18 19 19 22 | ACC 11 12 14 13 14 | AAC 10 12 11 12 15 | AGC 5 5 5 5 8 ATA 18 15 17 10 13 | ACA 7 6 3 4 1 | Lys AAA 16 14 15 14 12 | Arg AGA 3 2 2 2 1 Met ATG 17 19 19 17 18 | ACG 8 9 9 9 9 | AAG 9 11 10 9 10 | AGG 1 1 1 2 3 ---------------------------------------------------------------------------------------------------------------------- Val GTT 7 5 5 2 6 | Ala GCT 7 7 7 6 5 | Asp GAT 6 5 5 6 6 | Gly GGT 2 4 3 3 5 GTC 4 4 3 6 4 | GCC 9 13 13 14 15 | GAC 5 5 6 4 5 | GGC 8 9 11 13 8 GTA 4 3 3 5 3 | GCA 11 7 7 6 9 | Glu GAA 4 4 4 6 1 | GGA 9 9 8 9 8 GTG 12 13 14 14 13 | GCG 3 4 4 6 5 | GAG 13 13 13 11 14 | GGG 2 3 4 1 7 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Gr28b-PE position 1: T:0.22595 C:0.17673 A:0.36018 G:0.23714 position 2: T:0.38031 C:0.21253 A:0.26846 G:0.13870 position 3: T:0.25056 C:0.26846 A:0.23043 G:0.25056 Average T:0.28561 C:0.21924 A:0.28635 G:0.20880 #2: D_sechellia_Gr28b-PE position 1: T:0.21253 C:0.18792 A:0.35794 G:0.24161 position 2: T:0.37808 C:0.21253 A:0.26846 G:0.14094 position 3: T:0.23714 C:0.29083 A:0.19463 G:0.27740 Average T:0.27591 C:0.23043 A:0.27368 G:0.21999 #3: D_simulans_Gr28b-PE position 1: T:0.21253 C:0.18568 A:0.35570 G:0.24609 position 2: T:0.38031 C:0.21029 A:0.26846 G:0.14094 position 3: T:0.22819 C:0.29978 A:0.19463 G:0.27740 Average T:0.27368 C:0.23192 A:0.27293 G:0.22148 #4: D_yakuba_Gr28b-PE position 1: T:0.21029 C:0.20582 A:0.33333 G:0.25056 position 2: T:0.37584 C:0.21700 A:0.26174 G:0.14541 position 3: T:0.20134 C:0.33333 A:0.17673 G:0.28859 Average T:0.26249 C:0.25205 A:0.25727 G:0.22819 #5: D_erecta_Gr28b-PE position 1: T:0.20358 C:0.20582 A:0.33557 G:0.25503 position 2: T:0.37360 C:0.21253 A:0.25727 G:0.15660 position 3: T:0.18568 C:0.34899 A:0.15660 G:0.30872 Average T:0.25429 C:0.25578 A:0.24981 G:0.24012 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 58 | Ser S TCT 20 | Tyr Y TAT 52 | Cys C TGT 17 TTC 69 | TCC 61 | TAC 46 | TGC 28 Leu L TTA 8 | TCA 22 | *** * TAA 0 | *** * TGA 0 TTG 52 | TCG 33 | TAG 0 | Trp W TGG 10 ------------------------------------------------------------------------------ Leu L CTT 32 | Pro P CCT 7 | His H CAT 34 | Arg R CGT 5 CTC 37 | CCC 6 | CAC 11 | CGC 25 CTA 27 | CCA 14 | Gln Q CAA 32 | CGA 28 CTG 119 | CCG 3 | CAG 37 | CGG 13 ------------------------------------------------------------------------------ Ile I ATT 54 | Thr T ACT 23 | Asn N AAT 64 | Ser S AGT 25 ATC 95 | ACC 64 | AAC 60 | AGC 28 ATA 73 | ACA 21 | Lys K AAA 71 | Arg R AGA 10 Met M ATG 90 | ACG 44 | AAG 49 | AGG 8 ------------------------------------------------------------------------------ Val V GTT 25 | Ala A GCT 32 | Asp D GAT 28 | Gly G GGT 17 GTC 21 | GCC 64 | GAC 25 | GGC 49 GTA 18 | GCA 40 | Glu E GAA 19 | GGA 43 GTG 66 | GCG 22 | GAG 64 | GGG 17 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.21298 C:0.19239 A:0.34855 G:0.24609 position 2: T:0.37763 C:0.21298 A:0.26488 G:0.14452 position 3: T:0.22058 C:0.30828 A:0.19060 G:0.28054 Average T:0.27040 C:0.23788 A:0.26801 G:0.22371 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Gr28b-PE D_sechellia_Gr28b-PE 0.0823 (0.0168 0.2043) D_simulans_Gr28b-PE 0.0919 (0.0158 0.1720) 0.0570 (0.0029 0.0517) D_yakuba_Gr28b-PE 0.0822 (0.0383 0.4656) 0.0952 (0.0366 0.3848) 0.0990 (0.0356 0.3596) D_erecta_Gr28b-PE 0.0931 (0.0427 0.4594) 0.0975 (0.0383 0.3928) 0.1058 (0.0373 0.3523) 0.0906 (0.0364 0.4019) Model 0: one-ratio TREE # 1: (1, (4, 5), (2, 3)); MP score: 256 lnL(ntime: 7 np: 9): -3048.721689 +0.000000 6..1 6..7 7..4 7..5 6..8 8..2 8..3 0.117054 0.118498 0.187480 0.185154 0.034836 0.036208 0.007808 2.278506 0.105006 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.68704 (1: 0.117054, (4: 0.187480, 5: 0.185154): 0.118498, (2: 0.036208, 3: 0.007808): 0.034836); (D_melanogaster_Gr28b-PE: 0.117054, (D_yakuba_Gr28b-PE: 0.187480, D_erecta_Gr28b-PE: 0.185154): 0.118498, (D_sechellia_Gr28b-PE: 0.036208, D_simulans_Gr28b-PE: 0.007808): 0.034836); Detailed output identifying parameters kappa (ts/tv) = 2.27851 omega (dN/dS) = 0.10501 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.117 988.6 352.4 0.1050 0.0120 0.1147 11.9 40.4 6..7 0.118 988.6 352.4 0.1050 0.0122 0.1161 12.1 40.9 7..4 0.187 988.6 352.4 0.1050 0.0193 0.1837 19.1 64.7 7..5 0.185 988.6 352.4 0.1050 0.0191 0.1814 18.8 63.9 6..8 0.035 988.6 352.4 0.1050 0.0036 0.0341 3.5 12.0 8..2 0.036 988.6 352.4 0.1050 0.0037 0.0355 3.7 12.5 8..3 0.008 988.6 352.4 0.1050 0.0008 0.0077 0.8 2.7 tree length for dN: 0.0707 tree length for dS: 0.6732 Time used: 0:03 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (4, 5), (2, 3)); MP score: 256 lnL(ntime: 7 np: 10): -3040.683660 +0.000000 6..1 6..7 7..4 7..5 6..8 8..2 8..3 0.118688 0.121978 0.190845 0.189748 0.034051 0.036184 0.007807 2.280481 0.936626 0.059543 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.69930 (1: 0.118688, (4: 0.190845, 5: 0.189748): 0.121978, (2: 0.036184, 3: 0.007807): 0.034051); (D_melanogaster_Gr28b-PE: 0.118688, (D_yakuba_Gr28b-PE: 0.190845, D_erecta_Gr28b-PE: 0.189748): 0.121978, (D_sechellia_Gr28b-PE: 0.036184, D_simulans_Gr28b-PE: 0.007807): 0.034051); Detailed output identifying parameters kappa (ts/tv) = 2.28048 dN/dS (w) for site classes (K=2) p: 0.93663 0.06337 w: 0.05954 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.119 988.6 352.4 0.1191 0.0134 0.1128 13.3 39.8 6..7 0.122 988.6 352.4 0.1191 0.0138 0.1160 13.7 40.9 7..4 0.191 988.6 352.4 0.1191 0.0216 0.1814 21.4 63.9 7..5 0.190 988.6 352.4 0.1191 0.0215 0.1804 21.2 63.6 6..8 0.034 988.6 352.4 0.1191 0.0039 0.0324 3.8 11.4 8..2 0.036 988.6 352.4 0.1191 0.0041 0.0344 4.1 12.1 8..3 0.008 988.6 352.4 0.1191 0.0009 0.0074 0.9 2.6 Time used: 0:06 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (4, 5), (2, 3)); MP score: 256 lnL(ntime: 7 np: 12): -3040.683660 +0.000000 6..1 6..7 7..4 7..5 6..8 8..2 8..3 0.118688 0.121978 0.190845 0.189748 0.034050 0.036184 0.007807 2.280482 0.936626 0.024047 0.059543 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.69930 (1: 0.118688, (4: 0.190845, 5: 0.189748): 0.121978, (2: 0.036184, 3: 0.007807): 0.034050); (D_melanogaster_Gr28b-PE: 0.118688, (D_yakuba_Gr28b-PE: 0.190845, D_erecta_Gr28b-PE: 0.189748): 0.121978, (D_sechellia_Gr28b-PE: 0.036184, D_simulans_Gr28b-PE: 0.007807): 0.034050); Detailed output identifying parameters kappa (ts/tv) = 2.28048 dN/dS (w) for site classes (K=3) p: 0.93663 0.02405 0.03933 w: 0.05954 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.119 988.6 352.4 0.1191 0.0134 0.1128 13.3 39.8 6..7 0.122 988.6 352.4 0.1191 0.0138 0.1160 13.7 40.9 7..4 0.191 988.6 352.4 0.1191 0.0216 0.1814 21.4 63.9 7..5 0.190 988.6 352.4 0.1191 0.0215 0.1804 21.2 63.6 6..8 0.034 988.6 352.4 0.1191 0.0039 0.0324 3.8 11.4 8..2 0.036 988.6 352.4 0.1191 0.0041 0.0344 4.1 12.1 8..3 0.008 988.6 352.4 0.1191 0.0009 0.0074 0.9 2.6 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr28b-PE) Pr(w>1) post mean +- SE for w 7 S 0.510 1.194 +- 0.465 48 K 0.516 1.201 +- 0.462 78 D 0.502 1.184 +- 0.470 125 T 0.535 1.208 +- 0.488 128 R 0.587 1.277 +- 0.425 155 I 0.732 1.405 +- 0.326 236 N 0.528 1.214 +- 0.456 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.958 0.039 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.997 sum of density on p0-p1 = 1.000000 Time used: 0:16 Model 3: discrete (3 categories) TREE # 1: (1, (4, 5), (2, 3)); MP score: 256 lnL(ntime: 7 np: 13): -3039.649928 +0.000000 6..1 6..7 7..4 7..5 6..8 8..2 8..3 0.118255 0.120712 0.191684 0.189948 0.034332 0.036137 0.007796 2.260221 0.674415 0.320757 0.000001 0.323980 2.196130 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.69886 (1: 0.118255, (4: 0.191684, 5: 0.189948): 0.120712, (2: 0.036137, 3: 0.007796): 0.034332); (D_melanogaster_Gr28b-PE: 0.118255, (D_yakuba_Gr28b-PE: 0.191684, D_erecta_Gr28b-PE: 0.189948): 0.120712, (D_sechellia_Gr28b-PE: 0.036137, D_simulans_Gr28b-PE: 0.007796): 0.034332); Detailed output identifying parameters kappa (ts/tv) = 2.26022 dN/dS (w) for site classes (K=3) p: 0.67441 0.32076 0.00483 w: 0.00000 0.32398 2.19613 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.118 989.0 352.0 0.1145 0.0130 0.1136 12.9 40.0 6..7 0.121 989.0 352.0 0.1145 0.0133 0.1160 13.1 40.8 7..4 0.192 989.0 352.0 0.1145 0.0211 0.1842 20.9 64.8 7..5 0.190 989.0 352.0 0.1145 0.0209 0.1825 20.7 64.2 6..8 0.034 989.0 352.0 0.1145 0.0038 0.0330 3.7 11.6 8..2 0.036 989.0 352.0 0.1145 0.0040 0.0347 3.9 12.2 8..3 0.008 989.0 352.0 0.1145 0.0009 0.0075 0.8 2.6 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr28b-PE) Pr(w>1) post mean +- SE for w 155 I 0.737 1.704 Time used: 0:36 Model 7: beta (10 categories) TREE # 1: (1, (4, 5), (2, 3)); MP score: 256 lnL(ntime: 7 np: 10): -3039.935164 +0.000000 6..1 6..7 7..4 7..5 6..8 8..2 8..3 0.118622 0.121362 0.190975 0.188847 0.034100 0.036262 0.007822 2.261502 0.180401 1.352300 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.69799 (1: 0.118622, (4: 0.190975, 5: 0.188847): 0.121362, (2: 0.036262, 3: 0.007822): 0.034100); (D_melanogaster_Gr28b-PE: 0.118622, (D_yakuba_Gr28b-PE: 0.190975, D_erecta_Gr28b-PE: 0.188847): 0.121362, (D_sechellia_Gr28b-PE: 0.036262, D_simulans_Gr28b-PE: 0.007822): 0.034100); Detailed output identifying parameters kappa (ts/tv) = 2.26150 Parameters in M7 (beta): p = 0.18040 q = 1.35230 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00002 0.00030 0.00195 0.00787 0.02406 0.06143 0.13911 0.29282 0.61134 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.119 989.0 352.0 0.1139 0.0130 0.1141 12.9 40.2 6..7 0.121 989.0 352.0 0.1139 0.0133 0.1168 13.2 41.1 7..4 0.191 989.0 352.0 0.1139 0.0209 0.1837 20.7 64.7 7..5 0.189 989.0 352.0 0.1139 0.0207 0.1817 20.5 64.0 6..8 0.034 989.0 352.0 0.1139 0.0037 0.0328 3.7 11.5 8..2 0.036 989.0 352.0 0.1139 0.0040 0.0349 3.9 12.3 8..3 0.008 989.0 352.0 0.1139 0.0009 0.0075 0.8 2.6 Time used: 0:52 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (4, 5), (2, 3)); MP score: 256 lnL(ntime: 7 np: 12): -3039.867416 +0.000000 6..1 6..7 7..4 7..5 6..8 8..2 8..3 0.118393 0.121046 0.191263 0.189530 0.034222 0.036174 0.007804 2.262288 0.996532 0.214286 1.705268 2.069064 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.69843 (1: 0.118393, (4: 0.191263, 5: 0.189530): 0.121046, (2: 0.036174, 3: 0.007804): 0.034222); (D_melanogaster_Gr28b-PE: 0.118393, (D_yakuba_Gr28b-PE: 0.191263, D_erecta_Gr28b-PE: 0.189530): 0.121046, (D_sechellia_Gr28b-PE: 0.036174, D_simulans_Gr28b-PE: 0.007804): 0.034222); Detailed output identifying parameters kappa (ts/tv) = 2.26229 Parameters in M8 (beta&w>1): p0 = 0.99653 p = 0.21429 q = 1.70527 (p1 = 0.00347) w = 2.06906 dN/dS (w) for site classes (K=11) p: 0.09965 0.09965 0.09965 0.09965 0.09965 0.09965 0.09965 0.09965 0.09965 0.09965 0.00347 w: 0.00000 0.00007 0.00076 0.00367 0.01192 0.03074 0.06854 0.13945 0.27134 0.54805 2.06906 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.118 989.0 352.0 0.1143 0.0130 0.1138 12.9 40.1 6..7 0.121 989.0 352.0 0.1143 0.0133 0.1164 13.1 41.0 7..4 0.191 989.0 352.0 0.1143 0.0210 0.1839 20.8 64.7 7..5 0.190 989.0 352.0 0.1143 0.0208 0.1822 20.6 64.1 6..8 0.034 989.0 352.0 0.1143 0.0038 0.0329 3.7 11.6 8..2 0.036 989.0 352.0 0.1143 0.0040 0.0348 3.9 12.2 8..3 0.008 989.0 352.0 0.1143 0.0009 0.0075 0.8 2.6 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr28b-PE) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr28b-PE) Pr(w>1) post mean +- SE for w 7 S 0.595 1.078 +- 0.560 48 K 0.604 1.089 +- 0.557 78 D 0.582 1.063 +- 0.565 79 T 0.564 1.040 +- 0.571 125 T 0.612 1.094 +- 0.564 128 R 0.708 1.211 +- 0.505 155 I 0.917 1.445 +- 0.266 178 T 0.517 0.983 +- 0.581 236 N 0.621 1.110 +- 0.550 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.003 0.024 0.082 0.179 0.297 0.415 ws: 0.987 0.013 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:27
Model 1: NearlyNeutral -3040.68366 Model 2: PositiveSelection -3040.68366 Model 0: one-ratio -3048.721689 Model 3: discrete -3039.649928 Model 7: beta -3039.935164 Model 8: beta&w>1 -3039.867416 Model 0 vs 1 16.076057999999648 Model 2 vs 1 0.0 Model 8 vs 7 0.1354959999998755