--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 17 03:05:36 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/257/Gfrl-PK/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1389.51 -1403.31
2 -1389.39 -1401.84
--------------------------------------
TOTAL -1389.45 -1402.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.418859 0.005755 0.282118 0.569366 0.410320 1151.71 1229.84 1.000
r(A<->C){all} 0.074556 0.001489 0.008541 0.151292 0.069042 787.88 813.01 1.000
r(A<->G){all} 0.205707 0.003355 0.104436 0.326428 0.200830 684.47 843.42 1.000
r(A<->T){all} 0.178883 0.003405 0.072312 0.295420 0.174954 599.84 697.86 1.000
r(C<->G){all} 0.068277 0.000793 0.018922 0.124104 0.064628 814.96 904.25 1.000
r(C<->T){all} 0.377833 0.004807 0.250552 0.517958 0.375776 871.96 943.03 1.000
r(G<->T){all} 0.094743 0.001229 0.034242 0.167762 0.090959 891.68 900.16 1.000
pi(A){all} 0.230734 0.000260 0.200419 0.264386 0.230640 1239.65 1248.09 1.000
pi(C){all} 0.279343 0.000288 0.247889 0.313647 0.279134 1106.40 1280.74 1.000
pi(G){all} 0.237679 0.000264 0.204947 0.267415 0.237720 1268.21 1270.28 1.000
pi(T){all} 0.252244 0.000269 0.221648 0.283985 0.251696 1105.04 1255.36 1.000
alpha{1,2} 0.040665 0.000676 0.000119 0.086539 0.037870 1176.48 1248.95 1.000
alpha{3} 2.725638 0.770167 1.218363 4.384799 2.616761 1501.00 1501.00 1.001
pinvar{all} 0.619385 0.002331 0.523372 0.708294 0.622645 1432.65 1466.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1294.075885
Model 2: PositiveSelection -1294.075885
Model 0: one-ratio -1301.893192
Model 3: discrete -1293.534955
Model 7: beta -1297.105863
Model 8: beta&w>1 -1293.542373
Model 0 vs 1 15.634614000000056
Model 2 vs 1 0.0
Model 8 vs 7 7.126980000000003
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 1.000** 2.492
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 0.889 2.988 +- 2.194
>C1
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLAMLNC
>C2
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C3
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C4
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C5
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLALLNC
>C6
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRPASLNC
>C7
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=214
C1 MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C2 MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C3 MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C4 MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C5 MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C6 MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C7 MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
****:*********************************************
C1 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C2 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C3 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C4 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C5 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C6 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C7 CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
**************************************************
C1 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C2 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C3 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C4 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C5 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C6 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C7 LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
**************************************************
C1 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C2 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C3 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C4 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C5 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C6 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C7 KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
**************************************************
C1 NPCVGKFRLAMLNC
C2 NPCVGKFRLARLNC
C3 NPCVGKFRLARLNC
C4 NPCVGKFRLARLNC
C5 NPCVGKFRLALLNC
C6 NPCVGKFRPASLNC
C7 NPCVGKFRLARLNC
******** * ***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8988]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [8988]--->[8988]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/257/Gfrl-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.378 Mb, Max= 30.704 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLAMLNC
>C2
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C3
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C4
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C5
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLALLNC
>C6
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRPASLNC
>C7
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
FORMAT of file /tmp/tmp4630279825612006263aln Not Supported[FATAL:T-COFFEE]
>C1
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLAMLNC
>C2
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C3
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C4
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C5
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLALLNC
>C6
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRPASLNC
>C7
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:214 S:100 BS:214
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 99.53 C1 C2 99.53
TOP 1 0 99.53 C2 C1 99.53
BOT 0 2 99.53 C1 C3 99.53
TOP 2 0 99.53 C3 C1 99.53
BOT 0 3 99.53 C1 C4 99.53
TOP 3 0 99.53 C4 C1 99.53
BOT 0 4 99.53 C1 C5 99.53
TOP 4 0 99.53 C5 C1 99.53
BOT 0 5 98.60 C1 C6 98.60
TOP 5 0 98.60 C6 C1 98.60
BOT 0 6 99.07 C1 C7 99.07
TOP 6 0 99.07 C7 C1 99.07
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.53 C2 C5 99.53
TOP 4 1 99.53 C5 C2 99.53
BOT 1 5 98.60 C2 C6 98.60
TOP 5 1 98.60 C6 C2 98.60
BOT 1 6 99.53 C2 C7 99.53
TOP 6 1 99.53 C7 C2 99.53
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.53 C3 C5 99.53
TOP 4 2 99.53 C5 C3 99.53
BOT 2 5 98.60 C3 C6 98.60
TOP 5 2 98.60 C6 C3 98.60
BOT 2 6 99.53 C3 C7 99.53
TOP 6 2 99.53 C7 C3 99.53
BOT 3 4 99.53 C4 C5 99.53
TOP 4 3 99.53 C5 C4 99.53
BOT 3 5 98.60 C4 C6 98.60
TOP 5 3 98.60 C6 C4 98.60
BOT 3 6 99.53 C4 C7 99.53
TOP 6 3 99.53 C7 C4 99.53
BOT 4 5 98.60 C5 C6 98.60
TOP 5 4 98.60 C6 C5 98.60
BOT 4 6 99.07 C5 C7 99.07
TOP 6 4 99.07 C7 C5 99.07
BOT 5 6 99.07 C6 C7 99.07
TOP 6 5 99.07 C7 C6 99.07
AVG 0 C1 * 99.30
AVG 1 C2 * 99.53
AVG 2 C3 * 99.53
AVG 3 C4 * 99.53
AVG 4 C5 * 99.30
AVG 5 C6 * 98.68
AVG 6 C7 * 99.30
TOT TOT * 99.31
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGAAACCATTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
C2 ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
C3 ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
C4 ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
C5 ATGCTGAAACCGTTCGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC
C6 ATGCTGAAACCGTTGGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC
C7 ATGCTGAAACCGTTGGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC
***********.** *********** ***********************
C1 CATTAAGGGCGTCGTGGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT
C2 CATTAAGGGCGTCGTAGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT
C3 CATTAAGGGCGTCGTGGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT
C4 CATTAAGGGCGTCGTGGCCATTCTGAATTGTATCCTAGCACGTCAGCTTT
C5 CATTAAGGGCGTCGTGGCCATACTGAATTGTATCCTGGCACGTCAGCTAT
C6 CATTAAAGGTGTCGTGGCCATACTGAATTGTATTCTGGCACGTCAGCTCT
C7 CATTAAGGGCGTCGTGGCCATACTGAATTGTATCCTGGCACGTCAGCTAT
******.** *****.*****:***** ***** **.*********** *
C1 GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCTCGCGTC
C2 GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
C3 GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
C4 GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
C5 GTTTCGAAGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
C6 GTTTCGAGGATCCATCATGTTCGGCCATACTGGAAATAATTCCGCGTGTC
C7 GTTTCGAGGATCCCTCATGTTCGGCCATATTGGAAATTATACCGCGTGTC
* *****.*****.**************: *******:**:** ** ***
C1 TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA
C2 TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA
C3 TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA
C4 TGCGGGCCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
C5 TGCGGGCCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
C6 TGCGGACCCATACCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
C7 TGCGGGCCCATACCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
*****.*****:*********************************** **
C1 GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTTCGGCCCACCTGCC
C2 GGCTGCCCTGCGCACTCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
C3 GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
C4 GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
C5 GGCGGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
C6 GGCAGCCCTCCGCACCCTGCAGGCCTTCCAGTTTTTCCGGCCCACCTGCC
C7 GGCTGCCCTCCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
*** ***** ***** ***************** ** *************
C1 TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT
C2 TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT
C3 TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT
C4 TGTGCAAGGAGCCCGGAATGGATCCCGACTGCAATCACTTTCGGGACTTT
C5 TGTGCAAGGAGCCCGGCATGGATCCCGACTGCAATCACTTTCGGGACTTT
C6 TCTGCAAGGAGCCCGGCATGGATCCCGACTGCAACCACTTTCGGGACTTC
C7 TGTGCAAGGAGCCCGGCATGGATCCCGACTGCAATCACTTTCGAGACTTT
* **************.******** ******** ********.*****
C1 CTCTTCGATCATCCATGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
C2 CTCTTCGATCATCCATGTGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
C3 CTCTTCGATCATCCATGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
C4 CTCTTCGATCATCCGTGCGGATTTGTGCTAAAGAAAGCCGAAAAGGATCC
C5 CTCTTCGATCATCCCTGCGGATTTGTGCTGAAGAAAGCCGAGAAGGATCC
C6 CTCTTCGATCATCCCTGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
C7 CTCTTCGATCACCCATGCGGATTCGTACTGAAGAAAGCCGAGAAGGATCC
*********** ** ** ***** **.**.***********.********
C1 GTACCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
C2 GTACCCGATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
C3 GTATCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
C4 GTACCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
C5 GTATCCCATTGATGCACTACCCACATGCAACCATGCGCTTTCCGTTTGTC
C6 GTATCCCATTGATGCACTACCAACATGCAACCATGCTCTGTCCGTCTGCC
C7 TTATCCCATTGATGCACTACCAACTTGCAACCATGCTCTGTCCGTCTGTC
** ** ********.*****.**:*********** ** ***** ** *
C1 AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCATTGC
C2 AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCATTGC
C3 AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTTAAAACGCATTGC
C4 AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCACTGC
C5 AACAGGAACGCAAATGCCTGAAGCTCTTCGAGGACTTTAAAACGCATTGT
C6 AACAGGAACGAAAATGCCTGAAGCTTTTCGAGGACTTCAAAACGCATTGC
C7 AACAGGAACGCAAATGCCTGAAGCTCTTCGAGGACTTCAAAACGCATTGC
**********.***** **.***** *********** ******** **
C1 AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA
C2 AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA
C3 AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA
C4 AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA
C5 AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCTTGCCACGA
C6 AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA
C7 AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA
*****************.*********************** ********
C1 CTCCTGGACCAACCTGCGTCTGTCGCCCATGTTCGGATGCATCTGCCCGA
C2 CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
C3 CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
C4 CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
C5 TTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGTCCGA
C6 TTCCTGGACGAACCTGCGCCTGTCGCCGATGTTCGGATGCATCTGCCCGA
C7 TTCCTGGACCAACCTTCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
******** ***** ** ******** ***************** ****
C1 ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
C2 ATAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
C3 ATAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
C4 ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
C5 ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
C6 ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
C7 ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
* ************************************************
C1 AATCCTTGCGTGGGTAAGTTTCGACTGGCGATGCTGAACTGT
C2 AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT
C3 AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT
C4 AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT
C5 AATCCGTGTGTGGGTAAGTTTCGACTGGCGCTGCTGAACTGT
C6 AATCCGTGTGTGGGTAAGTTTCGTCCGGCGAGCCTGAACTGT
C7 AACCCGTGTGTGGGTAAGTTTCGTCTGGCGAGGCTGAACTGT
** ** ** **************:* ****. *********
>C1
ATGCTGAAACCATTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
CATTAAGGGCGTCGTGGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT
GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCTCGCGTC
TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA
GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTTCGGCCCACCTGCC
TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT
CTCTTCGATCATCCATGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
GTACCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCATTGC
AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA
CTCCTGGACCAACCTGCGTCTGTCGCCCATGTTCGGATGCATCTGCCCGA
ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AATCCTTGCGTGGGTAAGTTTCGACTGGCGATGCTGAACTGT
>C2
ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
CATTAAGGGCGTCGTAGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT
GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA
GGCTGCCCTGCGCACTCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT
CTCTTCGATCATCCATGTGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
GTACCCGATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCATTGC
AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA
CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
ATAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT
>C3
ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
CATTAAGGGCGTCGTGGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT
GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA
GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT
CTCTTCGATCATCCATGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
GTATCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTTAAAACGCATTGC
AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA
CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
ATAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT
>C4
ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC
CATTAAGGGCGTCGTGGCCATTCTGAATTGTATCCTAGCACGTCAGCTTT
GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
TGCGGGCCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
TGTGCAAGGAGCCCGGAATGGATCCCGACTGCAATCACTTTCGGGACTTT
CTCTTCGATCATCCGTGCGGATTTGTGCTAAAGAAAGCCGAAAAGGATCC
GTACCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC
AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCACTGC
AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA
CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT
>C5
ATGCTGAAACCGTTCGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC
CATTAAGGGCGTCGTGGCCATACTGAATTGTATCCTGGCACGTCAGCTAT
GTTTCGAAGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC
TGCGGGCCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
GGCGGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
TGTGCAAGGAGCCCGGCATGGATCCCGACTGCAATCACTTTCGGGACTTT
CTCTTCGATCATCCCTGCGGATTTGTGCTGAAGAAAGCCGAGAAGGATCC
GTATCCCATTGATGCACTACCCACATGCAACCATGCGCTTTCCGTTTGTC
AACAGGAACGCAAATGCCTGAAGCTCTTCGAGGACTTTAAAACGCATTGT
AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCTTGCCACGA
TTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGTCCGA
ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AATCCGTGTGTGGGTAAGTTTCGACTGGCGCTGCTGAACTGT
>C6
ATGCTGAAACCGTTGGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC
CATTAAAGGTGTCGTGGCCATACTGAATTGTATTCTGGCACGTCAGCTCT
GTTTCGAGGATCCATCATGTTCGGCCATACTGGAAATAATTCCGCGTGTC
TGCGGACCCATACCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
GGCAGCCCTCCGCACCCTGCAGGCCTTCCAGTTTTTCCGGCCCACCTGCC
TCTGCAAGGAGCCCGGCATGGATCCCGACTGCAACCACTTTCGGGACTTC
CTCTTCGATCATCCCTGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC
GTATCCCATTGATGCACTACCAACATGCAACCATGCTCTGTCCGTCTGCC
AACAGGAACGAAAATGCCTGAAGCTTTTCGAGGACTTCAAAACGCATTGC
AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA
TTCCTGGACGAACCTGCGCCTGTCGCCGATGTTCGGATGCATCTGCCCGA
ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AATCCGTGTGTGGGTAAGTTTCGTCCGGCGAGCCTGAACTGT
>C7
ATGCTGAAACCGTTGGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC
CATTAAGGGCGTCGTGGCCATACTGAATTGTATCCTGGCACGTCAGCTAT
GTTTCGAGGATCCCTCATGTTCGGCCATATTGGAAATTATACCGCGTGTC
TGCGGGCCCATACCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA
GGCTGCCCTCCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC
TGTGCAAGGAGCCCGGCATGGATCCCGACTGCAATCACTTTCGAGACTTT
CTCTTCGATCACCCATGCGGATTCGTACTGAAGAAAGCCGAGAAGGATCC
TTATCCCATTGATGCACTACCAACTTGCAACCATGCTCTGTCCGTCTGTC
AACAGGAACGCAAATGCCTGAAGCTCTTCGAGGACTTCAAAACGCATTGC
AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA
TTCCTGGACCAACCTTCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA
ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC
AACCCGTGTGTGGGTAAGTTTCGTCTGGCGAGGCTGAACTGT
>C1
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLAMLNC
>C2
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C3
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C4
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
>C5
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLALLNC
>C6
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRPASLNC
>C7
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVGKFRLARLNC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 7 taxa and 642 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479351498
Setting output file names to "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1677959631
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9927724857
Seed = 934493964
Swapseed = 1479351498
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 54 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1926.587419 -- -24.557203
Chain 2 -- -1922.768766 -- -24.557203
Chain 3 -- -1974.598050 -- -24.557203
Chain 4 -- -1955.386520 -- -24.557203
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1930.416387 -- -24.557203
Chain 2 -- -1950.112385 -- -24.557203
Chain 3 -- -1971.425362 -- -24.557203
Chain 4 -- -1921.262444 -- -24.557203
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1926.587] (-1922.769) (-1974.598) (-1955.387) * [-1930.416] (-1950.112) (-1971.425) (-1921.262)
500 -- (-1428.492) (-1439.036) [-1435.080] (-1435.789) * (-1436.341) [-1427.483] (-1428.407) (-1437.429) -- 0:00:00
1000 -- (-1444.948) (-1424.481) (-1429.310) [-1426.368] * (-1429.010) [-1425.900] (-1431.697) (-1433.236) -- 0:00:00
1500 -- (-1420.259) (-1419.155) [-1416.438] (-1423.244) * (-1425.030) [-1419.161] (-1426.721) (-1430.446) -- 0:00:00
2000 -- (-1414.355) [-1414.582] (-1408.494) (-1416.701) * (-1421.233) [-1417.995] (-1418.090) (-1433.375) -- 0:00:00
2500 -- [-1402.568] (-1416.506) (-1411.155) (-1419.009) * [-1412.526] (-1413.861) (-1417.071) (-1429.461) -- 0:00:00
3000 -- (-1394.905) [-1403.575] (-1413.436) (-1408.141) * [-1403.135] (-1405.301) (-1412.350) (-1414.318) -- 0:00:00
3500 -- [-1390.587] (-1406.203) (-1406.460) (-1411.167) * [-1392.697] (-1416.308) (-1403.077) (-1406.792) -- 0:00:00
4000 -- (-1397.832) [-1393.889] (-1396.668) (-1401.880) * (-1406.536) (-1405.651) (-1400.483) [-1392.289] -- 0:04:09
4500 -- (-1397.022) [-1391.491] (-1391.458) (-1403.020) * (-1402.477) (-1404.599) (-1403.648) [-1396.507] -- 0:03:41
5000 -- (-1389.045) [-1395.102] (-1388.468) (-1397.223) * [-1398.058] (-1400.452) (-1398.260) (-1400.624) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- [-1388.914] (-1397.269) (-1407.106) (-1394.787) * (-1399.450) [-1392.336] (-1408.612) (-1392.826) -- 0:03:00
6000 -- [-1392.840] (-1385.315) (-1399.070) (-1393.493) * (-1392.548) (-1396.288) (-1392.437) [-1395.618] -- 0:02:45
6500 -- (-1387.773) (-1389.298) (-1399.261) [-1394.895] * [-1399.173] (-1396.761) (-1395.633) (-1389.624) -- 0:02:32
7000 -- [-1390.052] (-1397.687) (-1391.821) (-1402.597) * [-1404.013] (-1403.398) (-1398.984) (-1391.971) -- 0:02:21
7500 -- (-1392.612) (-1395.079) [-1395.294] (-1390.644) * [-1395.701] (-1391.118) (-1405.432) (-1398.569) -- 0:02:12
8000 -- (-1390.395) (-1396.643) (-1390.357) [-1400.036] * [-1393.106] (-1403.447) (-1395.546) (-1393.546) -- 0:02:04
8500 -- (-1391.071) [-1389.475] (-1397.730) (-1392.800) * [-1393.513] (-1402.412) (-1402.170) (-1394.353) -- 0:01:56
9000 -- (-1396.885) (-1399.204) [-1396.665] (-1404.972) * (-1395.651) (-1394.527) (-1394.865) [-1393.189] -- 0:03:40
9500 -- (-1392.383) (-1393.611) [-1396.418] (-1392.212) * [-1392.832] (-1396.583) (-1392.776) (-1395.465) -- 0:03:28
10000 -- (-1406.959) (-1393.123) [-1393.230] (-1394.082) * (-1398.133) (-1391.341) [-1393.082] (-1398.107) -- 0:03:18
Average standard deviation of split frequencies: 0.014731
10500 -- (-1385.339) (-1390.655) (-1398.682) [-1389.843] * (-1396.564) (-1394.281) (-1391.348) [-1400.542] -- 0:03:08
11000 -- (-1395.488) (-1395.819) (-1403.908) [-1386.753] * (-1392.059) [-1392.172] (-1392.741) (-1396.665) -- 0:02:59
11500 -- (-1396.709) (-1403.275) (-1400.728) [-1388.843] * (-1393.635) (-1397.070) [-1395.346] (-1388.792) -- 0:02:51
12000 -- (-1403.314) (-1400.100) [-1391.846] (-1389.064) * (-1394.443) (-1391.842) [-1402.327] (-1398.602) -- 0:02:44
12500 -- (-1398.352) (-1402.981) [-1392.996] (-1390.190) * [-1391.465] (-1396.903) (-1393.473) (-1400.000) -- 0:02:38
13000 -- (-1398.764) (-1402.341) (-1389.140) [-1393.288] * (-1395.339) (-1397.144) (-1390.884) [-1391.201] -- 0:02:31
13500 -- (-1392.367) (-1396.853) (-1393.007) [-1396.194] * (-1398.113) [-1389.407] (-1393.802) (-1390.640) -- 0:03:39
14000 -- (-1407.533) (-1394.775) (-1396.819) [-1393.770] * (-1398.181) (-1401.868) [-1393.361] (-1388.950) -- 0:03:31
14500 -- (-1418.482) (-1399.325) (-1396.716) [-1390.598] * (-1395.324) [-1397.798] (-1395.277) (-1391.345) -- 0:03:23
15000 -- (-1410.760) (-1393.824) [-1396.066] (-1395.027) * (-1396.791) (-1395.641) (-1399.455) [-1392.865] -- 0:03:17
Average standard deviation of split frequencies: 0.029463
15500 -- (-1400.998) [-1390.914] (-1397.168) (-1395.755) * (-1402.316) (-1392.121) (-1396.426) [-1397.203] -- 0:03:10
16000 -- (-1402.315) (-1393.510) (-1400.139) [-1391.691] * (-1400.946) [-1388.691] (-1398.260) (-1389.294) -- 0:03:04
16500 -- (-1393.954) (-1399.006) [-1390.979] (-1395.216) * (-1389.247) [-1397.853] (-1387.590) (-1398.789) -- 0:02:58
17000 -- [-1391.443] (-1394.204) (-1398.060) (-1396.385) * (-1399.663) (-1402.332) (-1395.855) [-1392.635] -- 0:02:53
17500 -- (-1389.434) (-1405.094) [-1396.445] (-1395.935) * (-1400.144) (-1390.798) [-1393.105] (-1395.306) -- 0:02:48
18000 -- (-1395.321) (-1398.909) [-1392.021] (-1402.282) * [-1395.054] (-1392.640) (-1385.284) (-1395.096) -- 0:03:38
18500 -- (-1397.299) (-1392.398) [-1388.663] (-1395.988) * (-1401.130) (-1396.995) [-1393.920] (-1396.260) -- 0:03:32
19000 -- [-1396.857] (-1396.725) (-1398.423) (-1393.090) * (-1392.963) (-1392.935) (-1392.468) [-1394.593] -- 0:03:26
19500 -- (-1397.422) (-1397.909) [-1402.326] (-1393.383) * (-1394.279) (-1393.985) [-1395.022] (-1390.374) -- 0:03:21
20000 -- (-1396.080) (-1391.294) [-1394.943] (-1396.265) * (-1391.610) (-1392.506) (-1395.775) [-1395.089] -- 0:03:16
Average standard deviation of split frequencies: 0.034215
20500 -- (-1401.192) (-1393.990) (-1393.863) [-1396.425] * [-1389.933] (-1395.667) (-1391.675) (-1391.796) -- 0:03:11
21000 -- (-1398.712) (-1388.057) [-1396.459] (-1392.208) * (-1400.938) [-1394.280] (-1400.112) (-1397.435) -- 0:03:06
21500 -- (-1397.091) (-1395.059) (-1399.873) [-1389.352] * (-1394.935) [-1395.865] (-1400.868) (-1401.864) -- 0:03:02
22000 -- (-1396.907) (-1394.093) [-1398.041] (-1400.085) * [-1390.230] (-1396.569) (-1403.627) (-1397.592) -- 0:03:42
22500 -- [-1396.613] (-1403.708) (-1394.519) (-1390.308) * (-1397.185) [-1391.006] (-1404.384) (-1406.903) -- 0:03:37
23000 -- [-1391.004] (-1400.171) (-1397.163) (-1390.780) * (-1393.008) [-1393.414] (-1403.236) (-1390.325) -- 0:03:32
23500 -- (-1393.624) (-1399.667) (-1393.032) [-1399.029] * (-1397.393) (-1394.007) [-1396.840] (-1405.942) -- 0:03:27
24000 -- (-1393.499) (-1400.311) [-1389.627] (-1407.113) * (-1391.548) (-1394.980) (-1401.902) [-1389.474] -- 0:03:23
24500 -- (-1394.086) (-1398.330) (-1397.567) [-1393.193] * [-1390.396] (-1388.639) (-1404.235) (-1402.311) -- 0:03:19
25000 -- (-1395.211) [-1394.326] (-1400.383) (-1393.918) * (-1401.176) (-1395.001) (-1402.394) [-1393.033] -- 0:03:15
Average standard deviation of split frequencies: 0.033240
25500 -- (-1402.711) (-1393.397) [-1398.997] (-1390.857) * (-1396.839) [-1393.241] (-1395.960) (-1397.819) -- 0:03:11
26000 -- (-1393.600) (-1396.987) [-1393.140] (-1404.774) * (-1402.130) (-1394.517) [-1398.803] (-1395.330) -- 0:03:07
26500 -- (-1390.856) (-1393.679) [-1398.294] (-1388.736) * (-1395.229) [-1395.702] (-1400.764) (-1403.006) -- 0:03:03
27000 -- (-1396.029) (-1399.856) [-1391.650] (-1400.781) * (-1389.462) (-1396.656) [-1390.040] (-1398.454) -- 0:03:36
27500 -- (-1392.843) (-1405.353) [-1394.289] (-1388.407) * (-1391.986) (-1390.138) [-1396.249] (-1395.098) -- 0:03:32
28000 -- (-1400.360) [-1398.598] (-1400.167) (-1390.106) * [-1393.765] (-1393.237) (-1401.008) (-1399.169) -- 0:03:28
28500 -- (-1404.265) [-1391.275] (-1401.902) (-1392.757) * (-1396.207) (-1404.403) [-1394.151] (-1392.061) -- 0:03:24
29000 -- (-1407.085) (-1390.445) (-1393.924) [-1397.060] * [-1388.638] (-1404.916) (-1391.552) (-1393.262) -- 0:03:20
29500 -- [-1395.491] (-1399.120) (-1397.178) (-1400.229) * (-1390.675) [-1393.475] (-1394.334) (-1391.518) -- 0:03:17
30000 -- [-1387.550] (-1394.921) (-1397.496) (-1393.931) * (-1395.514) (-1396.070) [-1400.072] (-1397.709) -- 0:03:14
Average standard deviation of split frequencies: 0.033306
30500 -- (-1399.135) (-1392.509) (-1400.100) [-1404.966] * (-1395.282) [-1395.458] (-1397.907) (-1397.313) -- 0:03:10
31000 -- [-1397.878] (-1393.094) (-1397.309) (-1405.041) * [-1387.436] (-1399.275) (-1394.600) (-1396.408) -- 0:03:07
31500 -- (-1390.814) (-1395.886) [-1397.500] (-1397.967) * (-1393.852) (-1393.252) [-1392.929] (-1397.784) -- 0:03:04
32000 -- [-1389.253] (-1402.850) (-1397.985) (-1400.054) * [-1392.566] (-1407.375) (-1393.783) (-1403.012) -- 0:03:31
32500 -- [-1398.486] (-1399.805) (-1401.314) (-1395.049) * [-1395.566] (-1406.976) (-1388.256) (-1405.343) -- 0:03:28
33000 -- [-1392.614] (-1405.010) (-1404.469) (-1390.203) * [-1391.390] (-1406.452) (-1391.778) (-1396.695) -- 0:03:25
33500 -- (-1394.627) (-1395.988) [-1399.834] (-1390.617) * (-1394.580) (-1400.949) [-1395.473] (-1402.209) -- 0:03:21
34000 -- (-1392.107) (-1398.158) (-1400.275) [-1391.172] * (-1390.685) (-1391.664) [-1388.552] (-1403.596) -- 0:03:18
34500 -- [-1388.656] (-1394.492) (-1393.785) (-1391.996) * (-1398.742) [-1388.411] (-1391.452) (-1398.009) -- 0:03:15
35000 -- (-1390.442) (-1398.861) [-1393.665] (-1392.099) * (-1393.967) [-1394.375] (-1391.353) (-1398.962) -- 0:03:13
Average standard deviation of split frequencies: 0.021824
35500 -- (-1397.520) (-1403.294) [-1395.996] (-1387.190) * (-1392.883) (-1400.358) [-1395.104] (-1400.244) -- 0:03:10
36000 -- (-1396.277) (-1390.771) [-1393.658] (-1401.714) * (-1396.782) [-1392.676] (-1399.580) (-1398.985) -- 0:03:07
36500 -- (-1400.660) [-1387.074] (-1398.232) (-1402.345) * (-1394.665) [-1396.401] (-1396.128) (-1400.885) -- 0:03:04
37000 -- [-1392.109] (-1404.139) (-1398.668) (-1395.867) * (-1396.748) (-1391.652) [-1387.059] (-1395.109) -- 0:03:28
37500 -- [-1396.273] (-1403.910) (-1395.449) (-1395.234) * (-1402.764) (-1389.216) [-1393.219] (-1391.093) -- 0:03:25
38000 -- (-1393.870) (-1394.955) (-1399.147) [-1391.920] * [-1394.878] (-1387.605) (-1397.290) (-1397.876) -- 0:03:22
38500 -- [-1395.022] (-1404.006) (-1394.098) (-1394.575) * (-1394.174) (-1393.153) [-1392.588] (-1398.744) -- 0:03:19
39000 -- [-1391.682] (-1390.242) (-1399.488) (-1399.292) * (-1398.160) (-1389.275) [-1390.610] (-1395.014) -- 0:03:17
39500 -- (-1386.707) (-1393.342) [-1389.901] (-1392.317) * (-1395.830) (-1391.304) [-1394.528] (-1397.661) -- 0:03:14
40000 -- (-1390.506) [-1396.938] (-1400.416) (-1396.032) * [-1397.803] (-1397.587) (-1391.928) (-1392.532) -- 0:03:12
Average standard deviation of split frequencies: 0.038640
40500 -- [-1394.627] (-1399.069) (-1399.921) (-1393.497) * (-1399.707) (-1389.939) [-1403.420] (-1398.607) -- 0:03:09
41000 -- [-1390.805] (-1391.969) (-1393.187) (-1394.480) * [-1394.223] (-1391.159) (-1394.513) (-1388.786) -- 0:03:07
41500 -- (-1394.897) (-1399.094) [-1397.855] (-1390.721) * [-1389.392] (-1394.912) (-1394.777) (-1393.200) -- 0:03:27
42000 -- (-1388.929) (-1396.319) [-1396.716] (-1398.902) * (-1394.116) [-1402.271] (-1394.167) (-1389.122) -- 0:03:25
42500 -- (-1390.262) (-1392.412) [-1397.509] (-1390.047) * (-1396.046) [-1391.149] (-1392.957) (-1400.305) -- 0:03:22
43000 -- (-1390.720) [-1393.778] (-1398.619) (-1390.905) * (-1391.655) (-1396.033) [-1391.576] (-1395.779) -- 0:03:20
43500 -- (-1389.267) [-1392.123] (-1396.413) (-1392.971) * (-1395.816) (-1391.371) [-1396.468] (-1397.455) -- 0:03:17
44000 -- (-1390.917) [-1391.802] (-1394.105) (-1390.856) * [-1389.515] (-1398.960) (-1395.658) (-1397.858) -- 0:03:15
44500 -- (-1391.368) [-1398.150] (-1391.965) (-1405.322) * (-1393.892) (-1394.295) [-1393.855] (-1394.234) -- 0:03:13
45000 -- (-1397.554) (-1393.861) [-1394.014] (-1399.942) * [-1393.206] (-1391.851) (-1404.914) (-1398.333) -- 0:03:11
Average standard deviation of split frequencies: 0.020496
45500 -- [-1391.712] (-1392.050) (-1399.496) (-1392.968) * (-1398.122) (-1401.312) [-1392.907] (-1396.386) -- 0:03:08
46000 -- (-1395.320) [-1389.865] (-1398.389) (-1400.223) * (-1397.728) (-1394.936) [-1394.868] (-1396.982) -- 0:03:06
46500 -- [-1397.983] (-1400.155) (-1393.358) (-1399.546) * (-1396.254) [-1395.412] (-1392.601) (-1391.545) -- 0:03:25
47000 -- (-1389.007) (-1398.942) (-1399.744) [-1398.646] * [-1392.794] (-1405.470) (-1394.858) (-1397.416) -- 0:03:22
47500 -- [-1392.633] (-1393.844) (-1395.829) (-1396.726) * (-1395.934) [-1399.389] (-1392.251) (-1397.355) -- 0:03:20
48000 -- [-1391.382] (-1400.440) (-1399.702) (-1394.671) * [-1400.674] (-1400.970) (-1394.646) (-1394.961) -- 0:03:18
48500 -- [-1396.349] (-1398.661) (-1398.795) (-1401.696) * (-1403.619) (-1400.928) [-1393.582] (-1393.812) -- 0:03:16
49000 -- [-1394.470] (-1392.336) (-1393.970) (-1394.899) * (-1396.485) (-1397.520) (-1408.659) [-1390.820] -- 0:03:14
49500 -- (-1392.593) (-1395.398) [-1390.996] (-1399.614) * (-1396.916) (-1388.831) (-1400.358) [-1392.344] -- 0:03:12
50000 -- (-1398.404) (-1397.122) [-1400.251] (-1393.754) * (-1395.233) [-1388.817] (-1396.264) (-1389.656) -- 0:03:10
Average standard deviation of split frequencies: 0.006203
50500 -- (-1391.395) [-1391.282] (-1392.050) (-1395.098) * (-1397.223) [-1388.423] (-1399.483) (-1401.425) -- 0:03:08
51000 -- (-1397.839) (-1397.768) [-1387.926] (-1391.185) * (-1391.088) [-1393.072] (-1398.532) (-1400.532) -- 0:03:06
51500 -- (-1402.922) (-1398.852) [-1388.973] (-1396.090) * (-1389.347) (-1402.586) (-1397.289) [-1396.990] -- 0:03:22
52000 -- (-1398.552) (-1392.638) [-1389.994] (-1397.994) * (-1401.131) (-1401.012) (-1398.838) [-1389.567] -- 0:03:20
52500 -- (-1404.659) [-1395.000] (-1392.639) (-1397.461) * (-1394.871) (-1393.768) (-1396.973) [-1387.839] -- 0:03:18
53000 -- (-1392.071) (-1398.199) [-1395.631] (-1399.099) * (-1395.236) [-1387.866] (-1395.546) (-1395.473) -- 0:03:16
53500 -- (-1402.491) (-1394.182) (-1387.857) [-1393.024] * [-1401.584] (-1395.385) (-1398.436) (-1402.299) -- 0:03:14
54000 -- (-1393.633) (-1400.743) [-1388.491] (-1394.609) * [-1397.291] (-1395.933) (-1392.743) (-1398.270) -- 0:03:12
54500 -- [-1397.514] (-1400.677) (-1391.890) (-1393.636) * (-1395.605) (-1395.706) (-1391.497) [-1396.323] -- 0:03:10
55000 -- (-1397.946) [-1400.759] (-1391.390) (-1397.199) * [-1398.579] (-1407.590) (-1395.517) (-1392.114) -- 0:03:09
Average standard deviation of split frequencies: 0.002806
55500 -- (-1402.317) (-1395.782) [-1396.162] (-1395.716) * (-1396.108) [-1390.735] (-1406.997) (-1400.005) -- 0:03:07
56000 -- (-1391.079) [-1389.314] (-1392.527) (-1411.524) * (-1401.907) [-1396.897] (-1393.925) (-1398.574) -- 0:03:22
56500 -- (-1393.168) (-1389.440) (-1390.026) [-1399.483] * (-1402.859) (-1406.279) (-1392.968) [-1398.941] -- 0:03:20
57000 -- [-1393.928] (-1388.937) (-1395.524) (-1397.254) * [-1399.145] (-1398.020) (-1387.929) (-1391.508) -- 0:03:18
57500 -- (-1396.230) [-1387.225] (-1392.762) (-1395.839) * (-1405.795) [-1394.415] (-1395.515) (-1399.323) -- 0:03:16
58000 -- (-1393.855) [-1394.363] (-1397.612) (-1396.732) * (-1398.285) [-1394.295] (-1392.255) (-1392.125) -- 0:03:14
58500 -- [-1392.088] (-1386.935) (-1396.420) (-1393.764) * (-1404.233) (-1401.837) (-1396.539) [-1391.997] -- 0:03:13
59000 -- (-1400.628) [-1387.791] (-1394.999) (-1386.838) * (-1405.653) [-1396.236] (-1395.440) (-1393.609) -- 0:03:11
59500 -- [-1395.976] (-1396.568) (-1406.921) (-1392.546) * [-1401.099] (-1401.394) (-1392.696) (-1398.222) -- 0:03:09
60000 -- (-1394.108) (-1397.328) (-1395.737) [-1395.907] * (-1412.502) (-1392.103) (-1389.187) [-1389.059] -- 0:03:08
Average standard deviation of split frequencies: 0.005180
60500 -- (-1397.413) [-1396.497] (-1399.224) (-1396.218) * (-1402.761) (-1386.695) (-1392.930) [-1388.486] -- 0:03:21
61000 -- (-1397.227) (-1388.779) (-1391.178) [-1398.214] * (-1393.719) (-1394.667) [-1392.848] (-1392.915) -- 0:03:20
61500 -- (-1405.842) (-1397.764) (-1398.381) [-1390.399] * (-1395.661) [-1394.032] (-1400.002) (-1392.187) -- 0:03:18
62000 -- (-1405.871) (-1404.401) [-1394.472] (-1401.915) * (-1396.091) (-1399.730) [-1396.942] (-1398.617) -- 0:03:16
62500 -- (-1399.498) [-1394.741] (-1393.512) (-1403.327) * [-1398.754] (-1395.862) (-1401.585) (-1391.345) -- 0:03:15
63000 -- (-1394.862) (-1402.487) (-1390.428) [-1385.295] * (-1397.327) (-1391.074) (-1404.676) [-1393.103] -- 0:03:13
63500 -- (-1394.867) (-1398.936) (-1395.707) [-1395.737] * (-1404.479) (-1391.077) (-1399.003) [-1397.116] -- 0:03:11
64000 -- [-1392.907] (-1386.701) (-1403.611) (-1395.446) * (-1399.993) [-1391.790] (-1398.634) (-1392.356) -- 0:03:10
64500 -- (-1393.884) (-1392.472) (-1396.360) [-1406.304] * (-1396.699) (-1399.057) [-1396.037] (-1402.048) -- 0:03:08
65000 -- (-1396.082) (-1397.399) [-1393.243] (-1402.805) * [-1393.922] (-1395.946) (-1401.603) (-1401.818) -- 0:03:21
Average standard deviation of split frequencies: 0.010714
65500 -- (-1397.313) [-1391.216] (-1398.082) (-1408.697) * (-1406.245) (-1392.106) (-1397.650) [-1388.620] -- 0:03:19
66000 -- (-1392.471) (-1390.496) (-1393.073) [-1408.286] * (-1402.042) (-1395.360) [-1396.355] (-1391.950) -- 0:03:18
66500 -- [-1390.423] (-1398.695) (-1389.701) (-1403.400) * (-1398.094) (-1392.059) [-1395.949] (-1387.305) -- 0:03:16
67000 -- (-1394.089) [-1388.101] (-1396.859) (-1402.760) * (-1400.623) (-1390.335) (-1396.318) [-1384.949] -- 0:03:14
67500 -- (-1397.561) [-1390.973] (-1406.861) (-1398.987) * (-1395.585) [-1395.362] (-1390.360) (-1393.137) -- 0:03:13
68000 -- (-1394.887) (-1395.152) (-1391.479) [-1393.478] * (-1395.802) (-1392.282) [-1393.487] (-1387.531) -- 0:03:11
68500 -- [-1391.662] (-1399.586) (-1390.202) (-1396.263) * (-1395.235) [-1394.048] (-1392.779) (-1391.601) -- 0:03:10
69000 -- [-1393.201] (-1400.069) (-1390.962) (-1395.545) * (-1402.543) (-1392.177) [-1391.420] (-1393.238) -- 0:03:08
69500 -- (-1396.053) (-1403.965) (-1391.085) [-1393.246] * (-1395.228) (-1396.663) [-1403.324] (-1399.141) -- 0:03:07
70000 -- (-1396.896) (-1397.346) [-1389.709] (-1397.234) * [-1391.447] (-1400.766) (-1407.899) (-1394.866) -- 0:03:19
Average standard deviation of split frequencies: 0.025571
70500 -- (-1398.596) (-1392.971) [-1396.007] (-1400.530) * (-1396.020) [-1389.619] (-1396.297) (-1395.903) -- 0:03:17
71000 -- (-1401.524) [-1390.967] (-1394.737) (-1405.742) * [-1391.731] (-1392.816) (-1402.208) (-1392.982) -- 0:03:16
71500 -- (-1396.477) (-1392.241) [-1388.932] (-1398.510) * (-1392.972) (-1396.993) (-1404.854) [-1390.612] -- 0:03:14
72000 -- (-1399.307) [-1392.421] (-1393.286) (-1395.075) * (-1392.407) [-1393.309] (-1404.210) (-1398.618) -- 0:03:13
72500 -- (-1391.839) (-1394.921) [-1394.321] (-1402.325) * (-1401.656) [-1397.933] (-1395.911) (-1400.297) -- 0:03:11
73000 -- (-1403.651) (-1406.851) [-1395.291] (-1394.244) * (-1398.811) [-1391.824] (-1397.921) (-1393.732) -- 0:03:10
73500 -- (-1394.879) (-1396.443) [-1394.201] (-1394.604) * (-1405.372) (-1389.614) [-1396.914] (-1395.994) -- 0:03:09
74000 -- [-1392.844] (-1392.667) (-1405.045) (-1395.758) * (-1401.577) [-1394.201] (-1396.760) (-1395.338) -- 0:03:07
74500 -- (-1395.876) [-1393.082] (-1393.639) (-1393.386) * (-1397.809) [-1392.330] (-1401.981) (-1393.799) -- 0:03:18
75000 -- (-1400.628) [-1391.224] (-1393.753) (-1391.563) * (-1412.637) [-1397.099] (-1397.044) (-1390.832) -- 0:03:17
Average standard deviation of split frequencies: 0.022743
75500 -- [-1402.839] (-1392.961) (-1401.623) (-1391.423) * [-1399.117] (-1390.218) (-1396.042) (-1391.104) -- 0:03:15
76000 -- (-1397.356) [-1392.393] (-1395.705) (-1386.569) * [-1391.313] (-1400.897) (-1401.771) (-1393.269) -- 0:03:14
76500 -- (-1395.151) [-1392.071] (-1392.648) (-1393.475) * (-1393.975) (-1397.926) (-1402.475) [-1392.685] -- 0:03:13
77000 -- (-1406.958) (-1397.774) [-1391.066] (-1397.071) * (-1397.753) [-1393.737] (-1399.862) (-1391.331) -- 0:03:11
77500 -- [-1392.871] (-1400.099) (-1390.102) (-1406.581) * [-1387.929] (-1393.240) (-1398.691) (-1396.493) -- 0:03:10
78000 -- [-1390.192] (-1403.602) (-1392.093) (-1405.296) * (-1393.438) [-1389.855] (-1392.376) (-1392.863) -- 0:03:09
78500 -- (-1389.800) [-1388.284] (-1397.006) (-1407.319) * (-1397.140) (-1392.412) (-1394.499) [-1396.519] -- 0:03:07
79000 -- (-1389.880) [-1395.808] (-1395.453) (-1401.466) * (-1412.266) [-1392.378] (-1395.835) (-1390.251) -- 0:03:18
79500 -- (-1388.501) (-1392.463) (-1389.213) [-1394.871] * (-1400.097) [-1393.345] (-1395.776) (-1392.044) -- 0:03:16
80000 -- (-1392.839) [-1393.199] (-1392.778) (-1396.592) * [-1397.100] (-1399.189) (-1391.130) (-1399.073) -- 0:03:15
Average standard deviation of split frequencies: 0.021427
80500 -- (-1389.563) [-1393.150] (-1395.334) (-1395.451) * (-1397.030) (-1397.374) [-1396.258] (-1393.125) -- 0:03:14
81000 -- (-1394.132) (-1397.107) (-1394.937) [-1392.306] * (-1391.250) (-1399.689) [-1390.759] (-1391.179) -- 0:03:12
81500 -- (-1388.192) (-1395.123) [-1390.804] (-1394.292) * [-1398.018] (-1392.910) (-1391.499) (-1403.499) -- 0:03:11
82000 -- (-1390.390) [-1394.889] (-1393.149) (-1410.465) * (-1394.319) (-1390.132) [-1391.856] (-1393.651) -- 0:03:10
82500 -- (-1390.132) [-1392.258] (-1394.351) (-1391.939) * (-1397.161) [-1404.525] (-1398.089) (-1395.809) -- 0:03:09
83000 -- (-1390.454) (-1402.660) [-1393.369] (-1390.087) * [-1392.476] (-1396.481) (-1397.014) (-1398.154) -- 0:03:07
83500 -- (-1396.679) (-1396.744) [-1391.732] (-1398.510) * [-1388.573] (-1396.761) (-1415.513) (-1397.071) -- 0:03:06
84000 -- (-1397.803) (-1400.849) [-1390.898] (-1398.555) * (-1400.222) (-1394.320) (-1400.340) [-1392.358] -- 0:03:16
84500 -- (-1388.787) (-1393.061) (-1407.314) [-1389.783] * (-1392.294) (-1393.535) [-1384.712] (-1398.611) -- 0:03:15
85000 -- (-1395.719) (-1396.785) (-1402.181) [-1399.280] * (-1393.083) (-1389.863) (-1395.037) [-1388.433] -- 0:03:13
Average standard deviation of split frequencies: 0.015531
85500 -- [-1399.645] (-1395.333) (-1400.422) (-1400.223) * (-1396.553) (-1399.222) (-1397.794) [-1392.052] -- 0:03:12
86000 -- [-1395.364] (-1399.126) (-1400.073) (-1400.041) * (-1396.321) [-1389.419] (-1390.791) (-1400.374) -- 0:03:11
86500 -- (-1390.284) [-1392.203] (-1398.776) (-1397.100) * (-1396.913) (-1391.715) (-1392.452) [-1395.462] -- 0:03:10
87000 -- (-1401.040) (-1390.744) [-1396.222] (-1393.047) * (-1393.788) (-1393.262) [-1393.463] (-1396.765) -- 0:03:08
87500 -- (-1397.533) (-1396.981) [-1393.119] (-1396.960) * (-1394.610) (-1396.376) (-1399.352) [-1400.660] -- 0:03:07
88000 -- (-1397.208) (-1402.143) (-1396.109) [-1401.926] * (-1393.969) [-1395.233] (-1395.226) (-1390.524) -- 0:03:06
88500 -- (-1395.244) (-1398.627) [-1395.008] (-1397.241) * (-1394.790) [-1391.918] (-1391.063) (-1393.323) -- 0:03:05
89000 -- (-1393.933) (-1401.406) [-1396.318] (-1399.133) * (-1396.468) (-1390.985) (-1393.466) [-1388.071] -- 0:03:14
89500 -- [-1393.686] (-1389.684) (-1394.949) (-1397.855) * (-1393.517) (-1400.888) [-1403.362] (-1396.166) -- 0:03:13
90000 -- (-1400.598) (-1390.038) [-1397.348] (-1396.139) * (-1395.158) (-1402.644) (-1390.574) [-1391.686] -- 0:03:12
Average standard deviation of split frequencies: 0.016464
90500 -- [-1397.157] (-1390.088) (-1391.230) (-1402.632) * (-1398.506) (-1395.426) [-1388.728] (-1404.322) -- 0:03:10
91000 -- [-1394.891] (-1392.324) (-1397.352) (-1390.927) * [-1390.035] (-1397.057) (-1391.796) (-1395.368) -- 0:03:09
91500 -- (-1400.118) (-1397.407) (-1393.675) [-1391.375] * [-1392.708] (-1393.985) (-1400.431) (-1390.862) -- 0:03:08
92000 -- [-1397.439] (-1398.044) (-1387.481) (-1392.567) * (-1393.387) [-1391.803] (-1399.789) (-1391.282) -- 0:03:07
92500 -- (-1397.145) (-1392.806) [-1391.460] (-1388.924) * (-1396.088) (-1400.847) (-1392.630) [-1390.232] -- 0:03:06
93000 -- (-1397.123) [-1401.002] (-1390.526) (-1399.400) * (-1405.675) (-1392.709) [-1396.364] (-1397.592) -- 0:03:05
93500 -- (-1400.066) [-1396.502] (-1393.434) (-1396.643) * (-1401.543) (-1388.633) [-1399.562] (-1400.901) -- 0:03:04
94000 -- (-1398.244) (-1398.464) [-1398.205] (-1393.184) * (-1401.905) [-1392.933] (-1395.388) (-1401.935) -- 0:03:12
94500 -- (-1386.143) [-1395.210] (-1398.420) (-1403.402) * (-1392.686) (-1393.418) [-1394.076] (-1400.244) -- 0:03:11
95000 -- (-1393.199) [-1393.833] (-1401.302) (-1395.614) * (-1390.391) [-1390.420] (-1388.636) (-1393.087) -- 0:03:10
Average standard deviation of split frequencies: 0.017187
95500 -- (-1401.722) (-1390.323) [-1395.814] (-1406.371) * [-1392.235] (-1387.695) (-1391.258) (-1396.024) -- 0:03:09
96000 -- [-1391.139] (-1389.641) (-1395.573) (-1404.758) * (-1399.367) (-1406.677) (-1393.625) [-1399.007] -- 0:03:08
96500 -- [-1395.858] (-1401.154) (-1397.215) (-1403.995) * [-1390.466] (-1403.020) (-1397.419) (-1394.427) -- 0:03:07
97000 -- [-1392.749] (-1403.012) (-1400.376) (-1401.855) * (-1390.336) (-1390.292) (-1402.554) [-1392.401] -- 0:03:06
97500 -- (-1397.781) (-1396.047) (-1407.895) [-1396.218] * [-1392.686] (-1401.812) (-1394.053) (-1396.986) -- 0:03:05
98000 -- (-1390.468) [-1390.191] (-1401.015) (-1391.395) * (-1391.136) [-1393.784] (-1395.208) (-1390.696) -- 0:03:04
98500 -- [-1400.334] (-1387.227) (-1393.349) (-1403.830) * (-1397.695) (-1397.465) [-1392.913] (-1395.065) -- 0:03:03
99000 -- (-1395.431) (-1399.179) [-1390.773] (-1391.676) * (-1390.833) (-1406.777) (-1391.775) [-1389.993] -- 0:03:11
99500 -- (-1391.048) [-1393.411] (-1400.265) (-1396.938) * (-1398.622) [-1386.927] (-1396.541) (-1394.764) -- 0:03:10
100000 -- (-1397.494) (-1398.044) (-1399.160) [-1395.178] * [-1394.774] (-1393.920) (-1390.050) (-1392.348) -- 0:03:09
Average standard deviation of split frequencies: 0.017951
100500 -- (-1396.025) [-1393.832] (-1394.875) (-1397.299) * (-1395.712) [-1392.617] (-1393.718) (-1394.247) -- 0:03:07
101000 -- (-1401.980) (-1396.158) [-1394.055] (-1396.643) * (-1391.255) (-1390.315) [-1393.465] (-1392.027) -- 0:03:06
101500 -- (-1401.381) [-1394.681] (-1394.564) (-1395.309) * (-1395.226) [-1401.560] (-1404.509) (-1392.172) -- 0:03:05
102000 -- [-1401.892] (-1392.929) (-1391.174) (-1395.409) * (-1388.829) (-1395.960) [-1396.390] (-1403.084) -- 0:03:04
102500 -- (-1399.767) [-1389.084] (-1395.399) (-1394.529) * (-1396.500) [-1397.992] (-1400.068) (-1398.897) -- 0:03:03
103000 -- [-1397.554] (-1398.221) (-1389.458) (-1398.169) * [-1398.424] (-1393.039) (-1396.134) (-1389.784) -- 0:03:02
103500 -- (-1399.837) (-1398.094) [-1389.045] (-1396.165) * (-1399.275) [-1390.687] (-1393.452) (-1389.218) -- 0:03:01
104000 -- [-1395.119] (-1397.217) (-1391.352) (-1398.927) * (-1391.880) [-1399.888] (-1396.177) (-1390.308) -- 0:03:09
104500 -- (-1396.011) [-1397.692] (-1391.004) (-1399.627) * (-1393.227) (-1399.092) [-1391.953] (-1392.265) -- 0:03:08
105000 -- (-1392.642) (-1392.150) [-1392.170] (-1394.379) * [-1395.140] (-1397.997) (-1387.904) (-1390.951) -- 0:03:07
Average standard deviation of split frequencies: 0.021495
105500 -- [-1392.154] (-1400.897) (-1397.172) (-1402.421) * (-1395.275) (-1395.839) (-1395.945) [-1388.281] -- 0:03:06
106000 -- (-1397.156) [-1393.323] (-1397.240) (-1406.726) * (-1386.229) (-1393.279) (-1393.948) [-1397.582] -- 0:03:05
106500 -- (-1402.440) (-1397.018) [-1389.830] (-1398.149) * (-1389.515) [-1392.958] (-1393.029) (-1394.798) -- 0:03:04
107000 -- [-1394.159] (-1388.387) (-1393.087) (-1402.480) * (-1395.980) (-1395.536) [-1395.730] (-1392.295) -- 0:03:03
107500 -- [-1398.901] (-1397.077) (-1390.597) (-1399.431) * (-1396.392) (-1392.310) [-1396.194] (-1396.966) -- 0:03:02
108000 -- (-1394.110) [-1394.234] (-1390.362) (-1399.558) * (-1402.154) [-1393.129] (-1392.706) (-1393.881) -- 0:03:09
108500 -- [-1390.754] (-1388.335) (-1392.633) (-1395.318) * (-1391.950) [-1390.930] (-1398.731) (-1394.393) -- 0:03:08
109000 -- [-1390.573] (-1395.210) (-1396.330) (-1399.778) * [-1388.551] (-1390.299) (-1392.792) (-1391.034) -- 0:03:08
109500 -- [-1396.285] (-1394.487) (-1391.951) (-1399.264) * (-1399.747) [-1390.450] (-1394.671) (-1398.686) -- 0:03:07
110000 -- (-1396.822) [-1392.091] (-1403.075) (-1394.364) * [-1392.940] (-1398.687) (-1394.911) (-1398.310) -- 0:03:06
Average standard deviation of split frequencies: 0.018459
110500 -- (-1400.398) (-1397.366) [-1397.214] (-1388.812) * [-1393.047] (-1393.945) (-1408.750) (-1395.349) -- 0:03:05
111000 -- (-1396.288) [-1390.946] (-1399.976) (-1390.260) * (-1392.571) (-1397.655) [-1393.269] (-1397.474) -- 0:03:04
111500 -- [-1395.762] (-1389.296) (-1393.940) (-1400.442) * [-1399.722] (-1398.820) (-1398.905) (-1396.709) -- 0:03:03
112000 -- (-1397.422) (-1390.045) (-1394.278) [-1399.967] * (-1393.348) (-1394.627) [-1396.410] (-1393.781) -- 0:03:10
112500 -- (-1397.670) (-1394.339) [-1393.036] (-1400.251) * (-1392.284) (-1394.227) [-1391.006] (-1387.135) -- 0:03:09
113000 -- (-1393.961) (-1392.712) (-1392.592) [-1398.527] * (-1395.621) (-1392.776) [-1390.838] (-1400.395) -- 0:03:08
113500 -- [-1397.912] (-1393.028) (-1400.093) (-1397.145) * (-1393.815) (-1390.867) [-1396.311] (-1412.932) -- 0:03:07
114000 -- [-1392.098] (-1399.894) (-1396.382) (-1401.878) * [-1394.004] (-1394.762) (-1398.215) (-1401.141) -- 0:03:06
114500 -- (-1405.821) (-1403.876) [-1397.714] (-1402.838) * [-1399.415] (-1398.233) (-1410.868) (-1395.563) -- 0:03:05
115000 -- [-1404.248] (-1401.372) (-1402.648) (-1402.642) * (-1398.741) (-1397.282) (-1403.623) [-1396.877] -- 0:03:04
Average standard deviation of split frequencies: 0.016255
115500 -- (-1404.890) [-1399.248] (-1395.649) (-1396.830) * [-1392.177] (-1389.970) (-1401.007) (-1403.378) -- 0:03:11
116000 -- (-1397.904) (-1398.106) (-1395.703) [-1401.256] * (-1390.573) (-1397.715) (-1405.261) [-1396.809] -- 0:03:10
116500 -- (-1401.843) [-1389.781] (-1400.792) (-1405.919) * (-1396.310) (-1393.434) (-1401.021) [-1396.746] -- 0:03:09
117000 -- (-1392.501) (-1395.219) (-1388.823) [-1391.101] * [-1386.469] (-1399.424) (-1395.832) (-1402.683) -- 0:03:08
117500 -- [-1389.403] (-1394.649) (-1388.596) (-1389.341) * [-1386.950] (-1396.979) (-1400.531) (-1403.649) -- 0:03:07
118000 -- [-1391.793] (-1403.203) (-1391.579) (-1392.713) * (-1388.389) [-1395.181] (-1394.840) (-1398.128) -- 0:03:06
118500 -- [-1397.371] (-1392.278) (-1389.704) (-1393.494) * [-1389.716] (-1395.586) (-1397.533) (-1397.870) -- 0:03:05
119000 -- (-1389.097) (-1396.293) (-1392.271) [-1396.872] * [-1389.370] (-1393.128) (-1393.855) (-1392.318) -- 0:03:05
119500 -- [-1392.084] (-1399.367) (-1397.779) (-1398.156) * (-1394.512) [-1398.791] (-1402.878) (-1395.091) -- 0:03:04
120000 -- (-1397.191) (-1400.040) (-1392.584) [-1391.155] * (-1391.440) [-1398.642] (-1405.808) (-1405.254) -- 0:03:03
Average standard deviation of split frequencies: 0.014324
120500 -- (-1389.549) (-1389.424) [-1389.841] (-1398.247) * (-1391.284) (-1398.110) [-1406.333] (-1406.066) -- 0:03:09
121000 -- [-1396.471] (-1392.453) (-1397.263) (-1395.617) * (-1390.019) [-1386.589] (-1397.051) (-1405.925) -- 0:03:08
121500 -- [-1396.132] (-1396.608) (-1409.762) (-1393.628) * (-1393.707) [-1392.592] (-1394.436) (-1399.965) -- 0:03:07
122000 -- [-1392.012] (-1398.445) (-1392.477) (-1403.883) * (-1398.226) (-1396.102) (-1394.000) [-1395.589] -- 0:03:07
122500 -- (-1399.169) (-1396.253) (-1394.959) [-1395.623] * (-1391.990) [-1390.200] (-1395.450) (-1396.950) -- 0:03:06
123000 -- [-1396.817] (-1398.439) (-1398.650) (-1392.709) * (-1389.952) [-1389.564] (-1400.254) (-1391.951) -- 0:03:05
123500 -- (-1399.202) (-1394.409) [-1393.024] (-1394.111) * [-1388.954] (-1392.668) (-1398.633) (-1390.305) -- 0:03:04
124000 -- (-1392.083) (-1401.014) [-1393.046] (-1396.210) * (-1396.291) [-1393.083] (-1393.799) (-1393.006) -- 0:03:03
124500 -- (-1398.209) [-1389.348] (-1397.383) (-1403.578) * [-1394.375] (-1393.783) (-1393.246) (-1402.138) -- 0:03:02
125000 -- [-1391.332] (-1391.707) (-1394.120) (-1394.201) * (-1399.813) (-1395.897) (-1397.124) [-1392.677] -- 0:03:02
Average standard deviation of split frequencies: 0.014342
125500 -- [-1390.331] (-1386.633) (-1389.960) (-1398.678) * (-1396.864) (-1393.746) (-1399.123) [-1390.383] -- 0:03:08
126000 -- (-1391.093) [-1392.916] (-1393.231) (-1395.149) * (-1402.882) (-1393.117) (-1393.852) [-1393.484] -- 0:03:07
126500 -- (-1396.957) (-1395.720) [-1391.539] (-1392.648) * [-1397.246] (-1391.891) (-1395.610) (-1395.281) -- 0:03:06
127000 -- (-1397.756) (-1399.022) (-1389.282) [-1395.171] * [-1398.770] (-1396.635) (-1390.620) (-1392.017) -- 0:03:05
127500 -- (-1400.729) (-1391.551) (-1393.579) [-1387.452] * [-1395.669] (-1398.010) (-1399.370) (-1395.468) -- 0:03:04
128000 -- (-1393.590) (-1390.688) (-1391.190) [-1393.143] * (-1396.932) [-1395.210] (-1399.371) (-1388.271) -- 0:03:03
128500 -- (-1393.133) (-1388.862) [-1400.629] (-1392.914) * (-1395.938) [-1395.124] (-1393.342) (-1394.476) -- 0:03:03
129000 -- (-1392.801) (-1398.377) (-1394.316) [-1397.838] * (-1403.958) (-1391.147) (-1391.078) [-1390.964] -- 0:03:02
129500 -- [-1394.919] (-1396.065) (-1399.766) (-1395.081) * (-1396.681) (-1400.889) [-1392.766] (-1393.639) -- 0:03:01
130000 -- [-1394.075] (-1389.872) (-1398.947) (-1399.416) * (-1392.003) (-1406.107) (-1394.304) [-1394.781] -- 0:03:07
Average standard deviation of split frequencies: 0.013829
130500 -- (-1390.854) [-1393.608] (-1397.405) (-1395.192) * (-1394.296) (-1396.802) (-1392.566) [-1393.542] -- 0:03:06
131000 -- [-1390.424] (-1394.277) (-1389.149) (-1400.580) * [-1390.152] (-1402.112) (-1397.475) (-1394.278) -- 0:03:05
131500 -- (-1392.633) [-1392.047] (-1395.866) (-1393.145) * [-1390.955] (-1395.351) (-1398.127) (-1399.254) -- 0:03:04
132000 -- (-1395.059) (-1394.212) [-1389.357] (-1397.896) * (-1398.139) (-1401.162) [-1403.405] (-1394.521) -- 0:03:04
132500 -- (-1396.607) (-1399.860) [-1388.199] (-1392.893) * (-1393.220) (-1395.173) (-1394.078) [-1395.101] -- 0:03:03
133000 -- (-1393.457) (-1399.604) [-1391.182] (-1396.830) * (-1395.437) [-1397.621] (-1398.187) (-1391.430) -- 0:03:02
133500 -- (-1392.036) (-1392.222) (-1395.534) [-1394.622] * (-1394.868) [-1389.951] (-1400.583) (-1389.818) -- 0:03:01
134000 -- (-1393.707) [-1388.969] (-1395.180) (-1392.357) * (-1404.386) (-1393.228) (-1396.479) [-1389.093] -- 0:03:00
134500 -- (-1388.910) (-1394.309) [-1391.949] (-1390.679) * (-1398.464) (-1399.345) (-1400.238) [-1388.739] -- 0:03:00
135000 -- (-1395.517) (-1401.562) [-1387.690] (-1397.106) * [-1390.555] (-1385.977) (-1399.499) (-1392.019) -- 0:03:05
Average standard deviation of split frequencies: 0.009821
135500 -- (-1393.946) (-1396.603) [-1397.815] (-1395.002) * (-1408.151) [-1387.475] (-1399.327) (-1390.431) -- 0:03:05
136000 -- (-1390.854) [-1395.082] (-1395.314) (-1399.212) * (-1391.997) (-1388.876) [-1396.140] (-1392.802) -- 0:03:04
136500 -- (-1391.972) (-1393.990) [-1391.897] (-1396.072) * (-1395.749) [-1389.108] (-1401.446) (-1400.001) -- 0:03:03
137000 -- (-1392.388) [-1393.111] (-1387.928) (-1398.383) * (-1395.106) (-1386.687) [-1390.339] (-1391.717) -- 0:03:02
137500 -- [-1407.975] (-1389.376) (-1389.624) (-1389.951) * (-1394.580) (-1395.989) [-1394.625] (-1392.425) -- 0:03:01
138000 -- (-1402.962) (-1402.341) (-1392.747) [-1393.265] * (-1394.519) [-1394.990] (-1391.532) (-1393.572) -- 0:03:01
138500 -- (-1393.849) (-1397.839) (-1397.337) [-1391.616] * (-1404.898) (-1398.127) (-1396.031) [-1393.667] -- 0:03:00
139000 -- (-1398.405) (-1393.936) (-1392.880) [-1391.196] * (-1399.050) [-1392.173] (-1394.159) (-1392.260) -- 0:02:59
139500 -- (-1399.043) (-1392.078) (-1393.083) [-1391.125] * (-1395.657) (-1393.889) [-1394.524] (-1397.806) -- 0:03:05
140000 -- [-1394.505] (-1401.101) (-1388.695) (-1392.301) * (-1391.943) (-1398.757) [-1400.950] (-1396.890) -- 0:03:04
Average standard deviation of split frequencies: 0.011171
140500 -- (-1398.331) (-1399.970) (-1394.701) [-1397.252] * (-1388.255) [-1391.390] (-1397.839) (-1396.846) -- 0:03:03
141000 -- [-1391.184] (-1396.899) (-1392.990) (-1398.398) * (-1394.701) [-1397.122] (-1391.165) (-1393.781) -- 0:03:02
141500 -- (-1398.993) (-1397.180) (-1400.908) [-1398.651] * (-1396.766) (-1394.951) (-1398.338) [-1394.808] -- 0:03:02
142000 -- (-1395.690) (-1396.204) (-1400.257) [-1393.944] * (-1395.328) [-1396.351] (-1398.379) (-1395.187) -- 0:03:01
142500 -- [-1393.769] (-1392.583) (-1393.086) (-1395.125) * (-1398.683) (-1400.539) (-1396.684) [-1393.054] -- 0:03:00
143000 -- [-1395.877] (-1400.941) (-1392.542) (-1402.413) * (-1402.888) [-1395.255] (-1390.956) (-1391.116) -- 0:03:05
143500 -- (-1400.547) (-1405.612) (-1397.647) [-1404.657] * (-1397.466) (-1399.346) [-1394.678] (-1389.812) -- 0:03:05
144000 -- (-1392.205) (-1396.583) (-1388.849) [-1391.200] * (-1398.342) (-1401.210) (-1389.440) [-1394.028] -- 0:03:04
144500 -- (-1401.442) (-1396.528) [-1391.601] (-1394.143) * (-1394.551) [-1391.657] (-1399.622) (-1391.532) -- 0:03:03
145000 -- (-1391.610) (-1391.130) (-1398.801) [-1396.763] * (-1392.336) [-1392.896] (-1394.030) (-1389.863) -- 0:03:02
Average standard deviation of split frequencies: 0.013453
145500 -- (-1391.899) (-1392.264) [-1398.186] (-1396.795) * (-1403.618) [-1389.691] (-1399.256) (-1389.761) -- 0:03:02
146000 -- (-1399.441) (-1390.761) (-1395.666) [-1396.748] * (-1400.972) [-1392.090] (-1391.002) (-1406.282) -- 0:03:01
146500 -- [-1396.700] (-1394.020) (-1392.376) (-1397.556) * [-1398.675] (-1395.888) (-1396.223) (-1395.796) -- 0:03:00
147000 -- (-1399.570) [-1389.041] (-1403.079) (-1397.612) * [-1391.927] (-1392.085) (-1396.600) (-1387.068) -- 0:02:59
147500 -- (-1396.210) [-1392.255] (-1396.859) (-1400.259) * (-1395.873) (-1387.636) [-1395.151] (-1391.931) -- 0:02:59
148000 -- (-1403.539) (-1386.952) [-1403.728] (-1398.199) * (-1397.813) [-1389.914] (-1391.022) (-1393.295) -- 0:03:04
148500 -- (-1389.107) [-1393.773] (-1388.746) (-1401.349) * (-1393.469) (-1398.227) (-1409.548) [-1389.717] -- 0:03:03
149000 -- (-1388.801) [-1398.605] (-1397.450) (-1404.789) * (-1392.413) [-1390.643] (-1397.931) (-1399.063) -- 0:03:02
149500 -- (-1394.555) [-1399.384] (-1388.687) (-1393.839) * (-1395.018) (-1392.701) (-1395.923) [-1390.446] -- 0:03:02
150000 -- (-1395.858) (-1401.932) (-1394.271) [-1393.680] * (-1391.674) (-1392.777) (-1394.618) [-1397.764] -- 0:03:01
Average standard deviation of split frequencies: 0.014080
150500 -- [-1397.350] (-1393.925) (-1389.584) (-1389.146) * [-1392.229] (-1393.108) (-1391.494) (-1400.282) -- 0:03:00
151000 -- [-1396.334] (-1397.881) (-1397.956) (-1396.181) * (-1390.219) (-1395.469) (-1388.457) [-1395.020] -- 0:02:59
151500 -- (-1395.234) (-1397.310) [-1399.809] (-1395.515) * (-1391.493) (-1394.846) [-1393.729] (-1402.730) -- 0:02:59
152000 -- (-1397.303) (-1396.876) (-1397.914) [-1391.904] * [-1390.641] (-1394.257) (-1392.777) (-1392.543) -- 0:02:58
152500 -- (-1402.401) (-1401.383) [-1392.733] (-1395.590) * [-1393.710] (-1396.040) (-1394.854) (-1392.764) -- 0:02:57
153000 -- [-1391.736] (-1395.822) (-1401.329) (-1388.720) * (-1405.028) [-1396.272] (-1390.921) (-1401.868) -- 0:03:02
153500 -- (-1397.860) [-1404.754] (-1400.232) (-1392.317) * (-1397.237) [-1391.901] (-1398.508) (-1401.078) -- 0:03:01
154000 -- (-1399.018) [-1391.581] (-1393.318) (-1392.865) * (-1395.181) (-1393.983) (-1404.150) [-1393.822] -- 0:03:01
154500 -- (-1392.296) [-1393.621] (-1393.531) (-1395.264) * [-1395.007] (-1391.327) (-1393.805) (-1402.552) -- 0:03:00
155000 -- (-1393.218) (-1392.256) [-1397.362] (-1398.808) * (-1394.859) (-1395.217) [-1392.647] (-1402.035) -- 0:02:59
Average standard deviation of split frequencies: 0.018131
155500 -- (-1392.829) (-1393.467) [-1389.857] (-1398.336) * (-1401.051) (-1391.779) [-1388.263] (-1396.997) -- 0:02:59
156000 -- (-1398.904) (-1392.535) [-1394.292] (-1396.098) * [-1401.433] (-1390.484) (-1402.600) (-1394.498) -- 0:02:58
156500 -- (-1396.032) [-1392.988] (-1391.022) (-1396.613) * (-1405.090) [-1397.771] (-1392.352) (-1404.660) -- 0:02:57
157000 -- (-1403.953) (-1393.635) (-1397.281) [-1400.496] * (-1405.014) [-1394.515] (-1392.589) (-1394.330) -- 0:02:57
157500 -- (-1404.321) (-1394.698) (-1389.521) [-1393.054] * (-1405.360) [-1392.326] (-1393.509) (-1398.400) -- 0:02:56
158000 -- (-1393.449) (-1407.428) (-1391.801) [-1392.869] * (-1407.125) [-1390.342] (-1394.480) (-1394.081) -- 0:03:01
158500 -- [-1391.119] (-1393.616) (-1397.148) (-1395.485) * [-1390.207] (-1393.124) (-1399.909) (-1397.568) -- 0:03:00
159000 -- [-1395.875] (-1398.427) (-1396.035) (-1398.194) * (-1401.513) (-1397.424) (-1394.121) [-1390.691] -- 0:02:59
159500 -- (-1390.708) [-1395.008] (-1392.772) (-1392.802) * (-1395.744) [-1401.424] (-1393.610) (-1392.651) -- 0:02:59
160000 -- (-1392.663) (-1406.291) [-1387.630] (-1401.438) * (-1397.421) [-1390.611] (-1393.144) (-1385.897) -- 0:02:58
Average standard deviation of split frequencies: 0.015648
160500 -- (-1395.533) (-1397.106) (-1394.146) [-1389.900] * (-1392.347) (-1398.593) (-1393.619) [-1389.580] -- 0:02:57
161000 -- (-1403.447) (-1395.163) (-1394.658) [-1392.626] * [-1396.187] (-1399.253) (-1394.676) (-1390.027) -- 0:02:57
161500 -- (-1401.624) [-1397.134] (-1396.843) (-1392.554) * (-1395.999) (-1400.190) [-1394.244] (-1391.026) -- 0:02:56
162000 -- (-1401.885) (-1396.498) [-1397.919] (-1395.224) * (-1401.168) (-1398.924) [-1393.505] (-1387.712) -- 0:02:55
162500 -- (-1392.922) (-1393.499) [-1393.762] (-1392.700) * (-1395.579) [-1392.599] (-1392.416) (-1392.927) -- 0:02:55
163000 -- (-1396.256) [-1389.555] (-1389.963) (-1391.940) * (-1393.575) (-1396.907) (-1393.301) [-1401.899] -- 0:02:59
163500 -- (-1393.942) (-1396.514) (-1394.256) [-1397.450] * (-1399.524) (-1395.222) [-1393.539] (-1393.709) -- 0:02:59
164000 -- (-1394.820) (-1400.725) [-1392.110] (-1395.444) * [-1395.526] (-1395.166) (-1400.207) (-1397.093) -- 0:02:58
164500 -- (-1401.687) [-1395.280] (-1393.463) (-1394.234) * [-1396.649] (-1393.269) (-1397.395) (-1397.606) -- 0:02:57
165000 -- (-1391.919) [-1391.913] (-1395.426) (-1398.795) * (-1412.083) (-1391.827) (-1395.724) [-1391.035] -- 0:02:57
Average standard deviation of split frequencies: 0.015146
165500 -- [-1391.198] (-1399.398) (-1395.617) (-1400.383) * [-1398.868] (-1400.909) (-1392.182) (-1388.213) -- 0:02:56
166000 -- (-1388.971) [-1396.246] (-1397.221) (-1395.164) * [-1394.995] (-1393.104) (-1399.830) (-1393.912) -- 0:02:55
166500 -- (-1398.405) (-1408.587) [-1389.138] (-1395.010) * (-1394.990) (-1397.795) [-1391.687] (-1391.477) -- 0:02:55
167000 -- [-1388.041] (-1399.252) (-1389.370) (-1397.176) * (-1395.399) [-1390.280] (-1396.740) (-1401.415) -- 0:02:54
167500 -- (-1387.833) [-1401.830] (-1397.762) (-1391.516) * [-1397.047] (-1385.857) (-1393.349) (-1393.688) -- 0:02:53
168000 -- (-1397.752) (-1394.432) (-1392.889) [-1390.462] * (-1397.749) [-1395.466] (-1387.086) (-1393.788) -- 0:02:58
168500 -- (-1394.303) [-1389.089] (-1394.457) (-1391.428) * (-1396.035) (-1400.258) (-1398.786) [-1398.083] -- 0:02:57
169000 -- [-1391.867] (-1391.641) (-1392.070) (-1406.080) * (-1394.683) (-1395.479) [-1392.008] (-1400.137) -- 0:02:57
169500 -- (-1397.110) (-1408.237) (-1405.005) [-1396.789] * (-1396.157) (-1393.750) [-1390.141] (-1399.372) -- 0:02:56
170000 -- (-1394.309) (-1401.668) [-1396.375] (-1385.876) * [-1392.924] (-1394.689) (-1389.951) (-1389.838) -- 0:02:55
Average standard deviation of split frequencies: 0.012890
170500 -- (-1402.086) (-1401.086) (-1389.393) [-1389.568] * [-1394.719] (-1394.678) (-1389.420) (-1395.174) -- 0:02:55
171000 -- (-1396.838) [-1398.434] (-1403.764) (-1393.757) * (-1396.022) (-1393.498) [-1401.931] (-1390.642) -- 0:02:54
171500 -- (-1395.137) (-1396.233) (-1401.712) [-1392.453] * (-1398.486) (-1399.554) [-1392.047] (-1406.867) -- 0:02:53
172000 -- (-1399.657) [-1392.427] (-1391.773) (-1394.856) * (-1401.931) (-1396.775) (-1394.586) [-1392.472] -- 0:02:53
172500 -- [-1391.786] (-1400.363) (-1411.559) (-1392.564) * (-1404.405) (-1396.395) [-1391.793] (-1399.498) -- 0:02:52
173000 -- (-1391.824) [-1393.259] (-1398.129) (-1398.344) * (-1399.029) [-1392.433] (-1389.542) (-1391.339) -- 0:02:56
173500 -- (-1393.665) (-1396.505) [-1396.685] (-1391.195) * (-1391.549) (-1392.935) [-1388.395] (-1401.273) -- 0:02:56
174000 -- (-1398.972) (-1395.051) (-1403.865) [-1389.913] * (-1390.762) (-1396.758) [-1393.548] (-1393.405) -- 0:02:55
174500 -- (-1398.765) [-1401.036] (-1390.384) (-1399.135) * (-1393.839) [-1392.939] (-1393.032) (-1395.695) -- 0:02:55
175000 -- (-1397.528) [-1392.781] (-1403.190) (-1397.201) * (-1398.845) (-1395.664) [-1398.694] (-1395.327) -- 0:02:54
Average standard deviation of split frequencies: 0.009375
175500 -- [-1399.757] (-1394.286) (-1392.321) (-1390.299) * (-1396.671) (-1398.663) [-1394.536] (-1393.460) -- 0:02:53
176000 -- [-1395.517] (-1400.014) (-1393.441) (-1394.864) * (-1399.494) (-1389.766) [-1396.044] (-1402.777) -- 0:02:53
176500 -- (-1400.658) (-1396.604) [-1398.576] (-1399.795) * (-1396.664) (-1402.018) (-1396.901) [-1391.636] -- 0:02:52
177000 -- [-1392.851] (-1401.811) (-1392.517) (-1392.884) * (-1388.915) [-1392.827] (-1392.345) (-1396.145) -- 0:02:52
177500 -- [-1391.555] (-1398.125) (-1391.468) (-1395.587) * (-1392.983) [-1392.515] (-1394.296) (-1406.463) -- 0:02:51
178000 -- (-1401.594) [-1405.938] (-1392.964) (-1393.648) * (-1395.126) (-1392.026) [-1393.986] (-1393.002) -- 0:02:55
178500 -- (-1409.539) (-1410.528) [-1391.723] (-1392.726) * [-1392.405] (-1398.606) (-1394.850) (-1393.180) -- 0:02:54
179000 -- (-1398.447) (-1395.009) (-1401.490) [-1393.428] * (-1396.575) (-1396.313) [-1387.989] (-1399.539) -- 0:02:54
179500 -- (-1400.638) [-1396.817] (-1396.202) (-1395.569) * [-1388.948] (-1396.354) (-1403.148) (-1392.554) -- 0:02:53
180000 -- [-1392.591] (-1399.690) (-1408.660) (-1396.691) * (-1396.924) (-1389.734) (-1398.947) [-1395.743] -- 0:02:53
Average standard deviation of split frequencies: 0.008263
180500 -- (-1392.503) [-1396.805] (-1396.030) (-1400.239) * [-1393.469] (-1397.144) (-1389.096) (-1396.616) -- 0:02:52
181000 -- (-1397.495) [-1391.428] (-1389.828) (-1397.021) * (-1394.178) (-1395.705) [-1386.230] (-1394.503) -- 0:02:51
181500 -- (-1398.097) (-1390.872) [-1391.421] (-1394.434) * [-1393.955] (-1403.117) (-1400.345) (-1388.973) -- 0:02:51
182000 -- (-1399.754) (-1400.686) (-1392.353) [-1403.809] * (-1398.333) (-1388.704) [-1394.842] (-1395.779) -- 0:02:50
182500 -- (-1394.602) (-1395.720) (-1402.199) [-1390.084] * (-1391.606) (-1396.133) (-1389.140) [-1395.277] -- 0:02:50
183000 -- (-1400.535) (-1394.915) [-1398.342] (-1406.451) * (-1395.301) (-1396.081) (-1393.773) [-1395.115] -- 0:02:54
183500 -- (-1413.563) (-1398.889) [-1402.145] (-1401.406) * [-1392.120] (-1395.738) (-1393.440) (-1392.710) -- 0:02:53
184000 -- (-1402.362) [-1389.078] (-1392.689) (-1401.408) * (-1398.220) [-1393.260] (-1402.629) (-1394.475) -- 0:02:52
184500 -- (-1398.819) (-1394.344) (-1401.406) [-1394.532] * (-1393.419) (-1396.392) (-1393.671) [-1395.553] -- 0:02:52
185000 -- [-1399.300] (-1394.268) (-1390.912) (-1391.698) * (-1403.845) (-1397.443) (-1390.202) [-1398.812] -- 0:02:51
Average standard deviation of split frequencies: 0.007181
185500 -- (-1402.734) (-1396.977) [-1392.813] (-1388.041) * (-1391.390) [-1392.095] (-1397.193) (-1391.554) -- 0:02:51
186000 -- (-1402.072) (-1391.222) [-1388.574] (-1396.782) * [-1390.462] (-1396.345) (-1391.484) (-1393.037) -- 0:02:50
186500 -- [-1393.320] (-1393.519) (-1398.842) (-1394.147) * (-1392.728) [-1393.870] (-1390.572) (-1397.940) -- 0:02:50
187000 -- (-1395.799) (-1401.406) [-1394.880] (-1389.351) * [-1391.724] (-1394.073) (-1399.100) (-1393.393) -- 0:02:49
187500 -- (-1391.775) (-1397.332) (-1392.285) [-1394.823] * [-1389.654] (-1391.341) (-1394.159) (-1398.834) -- 0:02:49
188000 -- (-1400.608) (-1392.709) (-1391.692) [-1393.685] * (-1395.669) [-1390.770] (-1389.408) (-1398.245) -- 0:02:52
188500 -- (-1399.795) (-1396.384) [-1394.984] (-1390.328) * (-1392.530) (-1390.766) [-1392.358] (-1397.642) -- 0:02:52
189000 -- [-1396.135] (-1387.701) (-1393.252) (-1402.944) * (-1398.940) (-1393.377) [-1392.647] (-1390.460) -- 0:02:51
189500 -- (-1387.072) [-1389.725] (-1393.226) (-1396.636) * (-1395.757) [-1399.215] (-1398.879) (-1392.274) -- 0:02:51
190000 -- (-1392.056) [-1386.036] (-1392.801) (-1395.943) * [-1392.640] (-1395.667) (-1400.126) (-1392.223) -- 0:02:50
Average standard deviation of split frequencies: 0.007829
190500 -- (-1394.004) [-1389.079] (-1397.412) (-1402.786) * [-1396.010] (-1395.866) (-1400.750) (-1388.865) -- 0:02:49
191000 -- (-1389.570) (-1399.393) (-1392.618) [-1396.970] * (-1391.022) (-1402.941) [-1389.357] (-1391.166) -- 0:02:49
191500 -- (-1392.678) (-1393.687) [-1391.521] (-1391.959) * (-1398.402) (-1397.844) (-1397.755) [-1389.361] -- 0:02:48
192000 -- (-1394.022) [-1393.453] (-1391.678) (-1388.937) * (-1400.686) [-1391.112] (-1392.844) (-1391.596) -- 0:02:48
192500 -- (-1395.757) (-1396.745) [-1390.814] (-1391.457) * (-1395.690) (-1390.340) (-1390.940) [-1396.661] -- 0:02:47
193000 -- (-1392.378) [-1393.779] (-1394.112) (-1395.446) * (-1401.592) (-1393.705) [-1389.409] (-1398.189) -- 0:02:51
193500 -- (-1388.120) [-1394.702] (-1398.936) (-1396.637) * (-1402.660) (-1391.632) (-1391.573) [-1393.507] -- 0:02:50
194000 -- (-1403.959) [-1400.797] (-1392.903) (-1392.684) * [-1389.579] (-1390.927) (-1399.000) (-1393.180) -- 0:02:50
194500 -- [-1389.125] (-1394.273) (-1399.954) (-1410.313) * (-1395.579) (-1396.808) [-1393.831] (-1389.314) -- 0:02:49
195000 -- (-1393.835) [-1389.506] (-1399.138) (-1399.106) * (-1394.003) (-1390.719) (-1396.770) [-1396.973] -- 0:02:49
Average standard deviation of split frequencies: 0.009220
195500 -- (-1389.561) (-1400.612) (-1392.095) [-1396.815] * (-1393.977) [-1389.146] (-1397.475) (-1394.859) -- 0:02:48
196000 -- (-1392.771) (-1397.368) (-1391.012) [-1398.434] * (-1392.637) (-1398.299) [-1390.580] (-1397.502) -- 0:02:48
196500 -- [-1392.436] (-1393.773) (-1397.131) (-1396.228) * [-1391.016] (-1385.323) (-1399.172) (-1394.065) -- 0:02:47
197000 -- (-1398.900) (-1394.325) [-1394.482] (-1391.836) * (-1397.124) [-1395.187] (-1398.403) (-1389.765) -- 0:02:47
197500 -- [-1395.713] (-1396.272) (-1389.110) (-1398.118) * [-1394.205] (-1388.291) (-1389.352) (-1404.772) -- 0:02:46
198000 -- (-1394.566) [-1392.570] (-1391.716) (-1397.902) * [-1392.386] (-1398.959) (-1397.558) (-1395.500) -- 0:02:46
198500 -- (-1408.440) [-1388.689] (-1395.847) (-1393.876) * [-1396.289] (-1392.918) (-1393.649) (-1412.157) -- 0:02:49
199000 -- [-1390.905] (-1400.647) (-1396.554) (-1397.950) * (-1396.009) [-1389.804] (-1401.177) (-1403.558) -- 0:02:49
199500 -- [-1392.426] (-1398.526) (-1388.789) (-1387.448) * [-1394.623] (-1398.481) (-1394.831) (-1392.460) -- 0:02:48
200000 -- [-1394.718] (-1396.184) (-1390.157) (-1402.701) * (-1393.532) (-1398.843) (-1391.803) [-1397.121] -- 0:02:48
Average standard deviation of split frequencies: 0.009788
200500 -- (-1398.077) (-1389.416) (-1405.329) [-1399.588] * (-1396.464) (-1399.095) [-1395.307] (-1392.824) -- 0:02:47
201000 -- (-1398.284) [-1389.449] (-1401.053) (-1392.046) * (-1403.806) (-1399.425) (-1395.162) [-1395.188] -- 0:02:46
201500 -- (-1397.530) (-1395.764) [-1391.465] (-1397.039) * (-1398.802) (-1393.836) [-1392.140] (-1391.494) -- 0:02:46
202000 -- (-1396.138) [-1394.244] (-1397.067) (-1392.663) * (-1397.476) [-1401.255] (-1393.410) (-1389.503) -- 0:02:45
202500 -- (-1398.548) (-1388.245) (-1399.633) [-1393.525] * (-1392.616) [-1392.868] (-1393.522) (-1392.706) -- 0:02:49
203000 -- (-1393.960) (-1397.349) [-1394.012] (-1386.919) * (-1394.060) (-1399.469) [-1389.781] (-1393.023) -- 0:02:48
203500 -- (-1392.654) (-1394.291) (-1390.008) [-1388.333] * (-1404.448) (-1390.597) (-1389.736) [-1390.962] -- 0:02:48
204000 -- (-1390.495) [-1391.069] (-1396.879) (-1399.618) * (-1393.165) (-1391.246) (-1391.638) [-1390.049] -- 0:02:47
204500 -- (-1405.696) (-1394.160) [-1387.526] (-1391.781) * (-1400.296) (-1399.487) [-1393.006] (-1394.165) -- 0:02:47
205000 -- (-1402.960) [-1389.625] (-1391.975) (-1395.348) * [-1399.911] (-1399.443) (-1393.590) (-1398.231) -- 0:02:46
Average standard deviation of split frequencies: 0.011823
205500 -- (-1397.326) (-1390.348) (-1398.596) [-1389.769] * (-1397.592) (-1394.852) [-1401.420] (-1404.200) -- 0:02:46
206000 -- (-1394.256) (-1401.507) [-1396.268] (-1390.791) * (-1402.487) [-1390.798] (-1391.960) (-1394.323) -- 0:02:45
206500 -- (-1397.713) (-1397.035) (-1404.458) [-1394.316] * (-1396.336) [-1390.361] (-1388.812) (-1391.211) -- 0:02:45
207000 -- (-1402.356) (-1395.033) (-1399.161) [-1391.518] * (-1402.887) [-1389.750] (-1393.624) (-1395.597) -- 0:02:44
207500 -- (-1393.845) (-1399.669) (-1394.018) [-1395.399] * [-1393.529] (-1395.700) (-1395.976) (-1392.501) -- 0:02:48
208000 -- (-1394.240) [-1388.711] (-1392.579) (-1396.141) * [-1388.485] (-1388.691) (-1398.950) (-1391.028) -- 0:02:47
208500 -- (-1397.110) (-1392.362) (-1404.298) [-1389.658] * (-1394.626) [-1393.074] (-1392.132) (-1398.178) -- 0:02:47
209000 -- (-1403.969) [-1393.430] (-1393.543) (-1396.647) * (-1392.126) [-1392.830] (-1403.220) (-1399.537) -- 0:02:46
209500 -- [-1399.613] (-1392.410) (-1399.547) (-1395.219) * (-1390.490) [-1388.325] (-1403.688) (-1406.278) -- 0:02:46
210000 -- (-1405.504) (-1402.058) [-1391.879] (-1390.921) * (-1399.674) (-1393.717) (-1398.273) [-1388.086] -- 0:02:45
Average standard deviation of split frequencies: 0.010070
210500 -- (-1395.190) (-1394.560) [-1394.180] (-1388.257) * [-1389.856] (-1392.468) (-1394.743) (-1389.730) -- 0:02:45
211000 -- (-1403.481) [-1393.742] (-1404.281) (-1399.159) * (-1395.738) [-1396.650] (-1390.701) (-1399.312) -- 0:02:44
211500 -- (-1417.065) [-1393.501] (-1393.189) (-1394.509) * [-1397.356] (-1395.901) (-1399.060) (-1398.377) -- 0:02:44
212000 -- (-1401.793) (-1400.442) (-1408.837) [-1391.918] * [-1398.891] (-1397.189) (-1391.178) (-1405.583) -- 0:02:47
212500 -- (-1400.239) [-1389.445] (-1397.408) (-1398.140) * (-1398.011) (-1392.722) (-1392.492) [-1392.965] -- 0:02:46
213000 -- (-1394.294) (-1394.245) (-1392.873) [-1393.535] * (-1395.029) [-1395.160] (-1395.858) (-1399.872) -- 0:02:46
213500 -- (-1399.270) [-1401.087] (-1399.608) (-1393.363) * [-1392.672] (-1399.497) (-1389.859) (-1397.218) -- 0:02:45
214000 -- (-1392.314) (-1395.244) [-1396.449] (-1393.329) * [-1396.212] (-1392.066) (-1395.491) (-1396.337) -- 0:02:45
214500 -- [-1391.282] (-1387.713) (-1400.741) (-1392.639) * (-1390.678) [-1396.809] (-1393.661) (-1398.954) -- 0:02:44
215000 -- [-1393.292] (-1396.468) (-1408.650) (-1393.325) * (-1389.864) (-1395.720) [-1391.889] (-1399.524) -- 0:02:44
Average standard deviation of split frequencies: 0.011276
215500 -- (-1398.599) (-1398.598) (-1394.280) [-1389.693] * (-1390.016) (-1395.868) [-1395.117] (-1400.737) -- 0:02:43
216000 -- (-1392.205) (-1388.360) [-1393.075] (-1398.464) * [-1393.363] (-1396.158) (-1402.823) (-1398.601) -- 0:02:43
216500 -- (-1392.932) [-1391.868] (-1394.435) (-1397.139) * (-1393.870) (-1399.315) (-1397.863) [-1399.636] -- 0:02:42
217000 -- (-1397.141) (-1397.908) (-1393.553) [-1389.296] * (-1394.532) (-1396.919) [-1395.987] (-1401.699) -- 0:02:45
217500 -- (-1399.412) (-1389.649) [-1388.152] (-1403.535) * [-1391.260] (-1402.222) (-1400.593) (-1395.856) -- 0:02:45
218000 -- (-1399.681) (-1387.898) [-1386.521] (-1397.403) * [-1390.821] (-1394.527) (-1405.222) (-1406.950) -- 0:02:45
218500 -- (-1394.788) [-1395.151] (-1393.067) (-1397.786) * (-1401.253) (-1401.831) [-1394.595] (-1398.022) -- 0:02:44
219000 -- (-1400.026) [-1389.959] (-1396.013) (-1387.234) * (-1409.195) [-1392.498] (-1398.096) (-1392.261) -- 0:02:44
219500 -- (-1400.758) (-1395.417) [-1397.076] (-1392.299) * (-1397.539) (-1395.330) (-1392.781) [-1396.508] -- 0:02:43
220000 -- [-1395.631] (-1395.217) (-1402.670) (-1394.595) * (-1391.549) (-1398.525) [-1387.962] (-1396.426) -- 0:02:43
Average standard deviation of split frequencies: 0.013174
220500 -- (-1406.950) (-1397.325) [-1394.780] (-1395.973) * [-1391.317] (-1395.243) (-1392.756) (-1400.005) -- 0:02:42
221000 -- (-1394.532) (-1394.980) [-1398.091] (-1391.661) * (-1393.349) (-1397.262) [-1390.524] (-1394.646) -- 0:02:42
221500 -- (-1401.172) (-1392.450) (-1400.875) [-1396.771] * (-1397.363) (-1393.626) [-1399.495] (-1402.462) -- 0:02:41
222000 -- [-1392.526] (-1396.224) (-1395.391) (-1402.407) * (-1391.624) (-1393.462) [-1395.606] (-1392.044) -- 0:02:44
222500 -- (-1396.372) (-1389.956) (-1395.661) [-1392.684] * [-1392.497] (-1393.659) (-1395.804) (-1396.003) -- 0:02:44
223000 -- [-1394.805] (-1396.622) (-1400.211) (-1391.843) * [-1390.449] (-1393.670) (-1394.261) (-1401.335) -- 0:02:43
223500 -- [-1393.136] (-1392.293) (-1398.716) (-1401.549) * (-1396.133) [-1391.276] (-1390.669) (-1394.045) -- 0:02:43
224000 -- (-1392.922) [-1397.663] (-1390.643) (-1398.876) * (-1391.099) [-1388.788] (-1391.094) (-1396.574) -- 0:02:42
224500 -- (-1395.558) (-1396.696) (-1405.748) [-1392.956] * [-1389.410] (-1393.286) (-1391.653) (-1394.212) -- 0:02:42
225000 -- (-1399.433) [-1396.104] (-1385.695) (-1393.377) * (-1393.854) (-1392.518) [-1392.464] (-1404.429) -- 0:02:41
Average standard deviation of split frequencies: 0.012863
225500 -- (-1389.425) [-1392.261] (-1402.935) (-1395.486) * (-1396.321) (-1391.088) [-1390.374] (-1390.538) -- 0:02:41
226000 -- (-1393.603) (-1392.873) [-1390.187] (-1400.536) * (-1392.385) (-1394.214) (-1395.557) [-1393.781] -- 0:02:40
226500 -- (-1397.322) [-1394.146] (-1397.326) (-1389.980) * (-1397.308) (-1397.720) [-1398.452] (-1395.855) -- 0:02:40
227000 -- (-1394.601) (-1398.763) (-1395.993) [-1391.220] * (-1390.741) [-1405.415] (-1394.130) (-1402.772) -- 0:02:43
227500 -- [-1391.569] (-1409.172) (-1392.421) (-1407.562) * (-1403.652) [-1394.378] (-1392.594) (-1393.474) -- 0:02:42
228000 -- (-1393.590) [-1389.718] (-1398.255) (-1398.105) * [-1394.287] (-1393.153) (-1399.480) (-1395.369) -- 0:02:42
228500 -- (-1394.591) (-1394.937) (-1397.243) [-1396.901] * (-1389.793) (-1397.553) (-1389.412) [-1391.968] -- 0:02:42
229000 -- [-1394.671] (-1389.086) (-1395.196) (-1404.071) * (-1393.815) (-1400.013) (-1391.670) [-1393.505] -- 0:02:41
229500 -- [-1392.931] (-1397.912) (-1394.593) (-1396.580) * (-1393.697) [-1404.569] (-1397.112) (-1397.100) -- 0:02:41
230000 -- (-1401.689) (-1396.440) [-1395.046] (-1395.759) * (-1389.666) (-1405.822) [-1399.675] (-1389.624) -- 0:02:40
Average standard deviation of split frequencies: 0.010559
230500 -- (-1405.701) (-1396.028) (-1396.100) [-1393.716] * (-1403.789) (-1400.152) [-1394.057] (-1395.764) -- 0:02:40
231000 -- [-1392.041] (-1404.152) (-1400.207) (-1397.388) * [-1396.487] (-1398.769) (-1396.279) (-1392.125) -- 0:02:39
231500 -- (-1398.833) (-1396.070) (-1396.872) [-1397.783] * [-1391.260] (-1393.243) (-1389.737) (-1398.684) -- 0:02:39
232000 -- (-1394.877) (-1387.903) [-1387.012] (-1402.561) * [-1389.895] (-1392.373) (-1392.519) (-1393.404) -- 0:02:42
232500 -- (-1413.242) (-1403.800) [-1399.673] (-1404.577) * (-1393.344) (-1402.649) (-1399.919) [-1397.922] -- 0:02:41
233000 -- (-1398.640) [-1393.677] (-1393.748) (-1397.206) * (-1391.529) [-1389.316] (-1390.563) (-1397.562) -- 0:02:41
233500 -- (-1406.610) (-1399.311) [-1392.281] (-1395.181) * (-1391.142) [-1388.785] (-1398.959) (-1391.248) -- 0:02:40
234000 -- (-1401.487) (-1392.245) [-1390.402] (-1395.212) * (-1390.206) (-1395.978) (-1400.926) [-1397.228] -- 0:02:40
234500 -- [-1389.609] (-1389.938) (-1392.818) (-1407.590) * (-1395.130) [-1389.457] (-1401.855) (-1392.932) -- 0:02:39
235000 -- (-1395.838) [-1390.724] (-1390.596) (-1406.375) * (-1403.512) (-1392.600) [-1394.580] (-1394.358) -- 0:02:39
Average standard deviation of split frequencies: 0.010986
235500 -- (-1402.978) [-1392.970] (-1397.820) (-1399.142) * (-1402.759) (-1395.825) (-1392.872) [-1400.126] -- 0:02:39
236000 -- (-1398.426) [-1395.441] (-1400.489) (-1398.026) * (-1391.829) [-1389.058] (-1391.669) (-1398.197) -- 0:02:38
236500 -- (-1399.172) [-1388.202] (-1392.437) (-1394.279) * (-1394.886) (-1393.847) [-1392.839] (-1400.066) -- 0:02:38
237000 -- [-1392.678] (-1391.882) (-1398.609) (-1398.518) * [-1396.826] (-1395.064) (-1388.403) (-1402.191) -- 0:02:40
237500 -- (-1388.818) (-1395.233) [-1395.421] (-1393.057) * (-1397.249) (-1399.186) (-1391.720) [-1401.065] -- 0:02:40
238000 -- (-1394.690) (-1396.545) [-1391.333] (-1390.877) * (-1414.191) [-1394.354] (-1392.175) (-1390.776) -- 0:02:40
238500 -- (-1394.485) (-1392.188) (-1388.938) [-1393.793] * (-1398.655) (-1399.259) (-1389.916) [-1390.620] -- 0:02:39
239000 -- [-1395.682] (-1393.754) (-1396.291) (-1393.060) * (-1397.957) [-1397.925] (-1392.526) (-1395.408) -- 0:02:39
239500 -- [-1397.845] (-1398.345) (-1391.919) (-1391.430) * (-1397.740) [-1395.145] (-1403.475) (-1397.471) -- 0:02:38
240000 -- (-1409.241) (-1396.214) (-1402.544) [-1394.908] * (-1403.603) (-1395.764) (-1394.127) [-1395.151] -- 0:02:38
Average standard deviation of split frequencies: 0.010120
240500 -- (-1395.346) [-1388.253] (-1401.268) (-1397.560) * [-1400.078] (-1406.735) (-1392.347) (-1401.935) -- 0:02:37
241000 -- (-1391.234) (-1390.809) [-1395.948] (-1393.566) * (-1400.101) (-1393.930) [-1392.088] (-1399.086) -- 0:02:37
241500 -- (-1391.450) (-1397.374) (-1396.706) [-1392.106] * (-1404.029) [-1391.166] (-1391.368) (-1393.462) -- 0:02:40
242000 -- [-1392.461] (-1395.786) (-1397.484) (-1394.782) * (-1399.253) [-1391.376] (-1399.156) (-1399.888) -- 0:02:39
242500 -- [-1388.492] (-1394.585) (-1394.738) (-1393.943) * (-1390.405) [-1395.665] (-1395.088) (-1392.232) -- 0:02:39
243000 -- (-1394.977) (-1396.947) [-1390.267] (-1397.144) * (-1399.151) (-1392.691) (-1392.210) [-1387.078] -- 0:02:38
243500 -- (-1392.189) (-1401.578) [-1396.472] (-1389.470) * (-1400.513) [-1390.899] (-1402.391) (-1390.084) -- 0:02:38
244000 -- (-1389.350) (-1395.413) (-1393.438) [-1388.740] * (-1397.425) (-1391.960) (-1395.984) [-1392.023] -- 0:02:38
244500 -- (-1393.831) (-1399.416) (-1405.525) [-1391.615] * (-1405.813) (-1398.612) (-1397.394) [-1389.194] -- 0:02:37
245000 -- [-1390.629] (-1398.326) (-1400.884) (-1394.177) * (-1395.921) (-1392.715) (-1401.078) [-1391.628] -- 0:02:37
Average standard deviation of split frequencies: 0.009901
245500 -- (-1394.351) (-1397.747) [-1396.695] (-1399.917) * (-1390.958) (-1396.643) (-1394.475) [-1390.785] -- 0:02:36
246000 -- (-1395.686) (-1393.165) (-1394.709) [-1395.303] * (-1394.321) [-1391.032] (-1394.971) (-1389.813) -- 0:02:36
246500 -- (-1394.658) [-1391.430] (-1401.364) (-1392.007) * (-1394.140) (-1400.893) [-1390.424] (-1401.199) -- 0:02:35
247000 -- (-1396.549) (-1389.339) [-1396.733] (-1402.233) * (-1408.737) [-1394.921] (-1394.282) (-1401.263) -- 0:02:38
247500 -- (-1399.114) [-1393.815] (-1397.259) (-1394.659) * (-1395.197) (-1394.429) [-1388.347] (-1392.825) -- 0:02:38
248000 -- [-1401.650] (-1397.451) (-1397.483) (-1391.225) * [-1391.992] (-1400.233) (-1393.952) (-1405.618) -- 0:02:37
248500 -- (-1392.950) [-1402.104] (-1397.959) (-1397.170) * [-1390.230] (-1396.118) (-1395.210) (-1392.115) -- 0:02:37
249000 -- (-1394.908) (-1398.136) [-1395.989] (-1396.275) * [-1389.004] (-1398.858) (-1396.390) (-1399.287) -- 0:02:36
249500 -- (-1398.567) (-1391.171) [-1395.996] (-1396.625) * (-1394.248) (-1398.032) (-1398.484) [-1400.687] -- 0:02:36
250000 -- (-1401.671) (-1399.324) (-1391.475) [-1393.824] * (-1391.191) [-1399.576] (-1392.369) (-1394.530) -- 0:02:36
Average standard deviation of split frequencies: 0.009090
250500 -- (-1394.080) (-1394.520) [-1395.401] (-1402.098) * (-1393.836) (-1395.139) (-1391.240) [-1395.804] -- 0:02:35
251000 -- [-1391.730] (-1404.783) (-1397.833) (-1403.434) * (-1392.025) (-1400.419) (-1391.669) [-1393.676] -- 0:02:35
251500 -- [-1391.264] (-1407.322) (-1390.755) (-1397.865) * [-1391.023] (-1394.878) (-1392.456) (-1393.139) -- 0:02:34
252000 -- [-1393.740] (-1400.673) (-1394.136) (-1398.808) * (-1403.723) (-1396.093) (-1390.696) [-1399.384] -- 0:02:37
252500 -- [-1400.087] (-1393.986) (-1395.570) (-1396.858) * (-1398.834) (-1397.127) (-1398.648) [-1392.897] -- 0:02:36
253000 -- (-1397.626) (-1401.830) (-1397.977) [-1387.163] * (-1397.496) (-1397.466) [-1389.964] (-1394.703) -- 0:02:36
253500 -- [-1389.962] (-1398.326) (-1407.959) (-1397.829) * [-1394.470] (-1396.503) (-1396.240) (-1390.230) -- 0:02:36
254000 -- (-1391.039) (-1399.115) (-1401.212) [-1388.434] * (-1396.436) (-1394.398) (-1403.551) [-1391.179] -- 0:02:35
254500 -- (-1395.930) (-1401.623) (-1404.521) [-1386.726] * [-1394.403] (-1399.857) (-1403.133) (-1393.911) -- 0:02:35
255000 -- (-1398.522) (-1388.649) (-1393.760) [-1391.550] * [-1397.014] (-1397.976) (-1394.411) (-1392.688) -- 0:02:34
Average standard deviation of split frequencies: 0.008900
255500 -- (-1404.745) (-1393.268) [-1391.450] (-1393.958) * (-1394.277) [-1393.398] (-1389.537) (-1396.175) -- 0:02:34
256000 -- [-1396.929] (-1394.774) (-1393.343) (-1389.782) * (-1400.779) (-1390.020) [-1392.584] (-1398.188) -- 0:02:34
256500 -- (-1402.035) (-1397.426) (-1403.072) [-1391.972] * (-1394.806) (-1393.750) [-1396.581] (-1396.706) -- 0:02:36
257000 -- (-1403.633) [-1393.378] (-1392.118) (-1388.934) * (-1403.360) [-1397.331] (-1401.693) (-1394.830) -- 0:02:36
257500 -- (-1403.752) (-1399.035) (-1392.851) [-1396.776] * (-1391.983) (-1395.395) (-1394.174) [-1390.236] -- 0:02:35
258000 -- (-1400.448) (-1397.534) (-1397.249) [-1392.079] * (-1397.487) [-1397.967] (-1391.532) (-1401.358) -- 0:02:35
258500 -- (-1393.265) [-1389.810] (-1393.042) (-1392.523) * (-1395.340) (-1397.135) (-1390.558) [-1393.421] -- 0:02:34
259000 -- (-1395.708) (-1390.437) (-1403.683) [-1403.279] * (-1390.664) (-1394.634) [-1392.675] (-1406.990) -- 0:02:34
259500 -- [-1388.784] (-1392.793) (-1403.187) (-1394.835) * (-1397.712) [-1391.816] (-1395.246) (-1393.432) -- 0:02:34
260000 -- (-1395.335) [-1389.781] (-1394.426) (-1394.595) * (-1398.254) (-1392.475) [-1392.558] (-1393.203) -- 0:02:33
Average standard deviation of split frequencies: 0.008439
260500 -- [-1393.823] (-1404.947) (-1401.883) (-1393.105) * (-1396.753) [-1394.374] (-1394.317) (-1398.805) -- 0:02:33
261000 -- (-1392.239) (-1395.372) (-1396.595) [-1391.554] * (-1400.092) (-1401.064) (-1395.986) [-1391.776] -- 0:02:32
261500 -- [-1397.809] (-1390.858) (-1399.480) (-1390.927) * [-1395.593] (-1394.892) (-1392.480) (-1392.721) -- 0:02:35
262000 -- (-1389.962) [-1397.353] (-1394.009) (-1393.671) * (-1395.600) [-1401.949] (-1391.923) (-1389.895) -- 0:02:34
262500 -- (-1392.032) (-1391.928) [-1394.693] (-1391.228) * (-1396.049) (-1404.351) (-1397.975) [-1390.889] -- 0:02:34
263000 -- [-1390.352] (-1395.939) (-1400.073) (-1404.642) * (-1394.576) (-1391.196) (-1392.798) [-1390.369] -- 0:02:34
263500 -- [-1396.830] (-1397.043) (-1389.408) (-1410.771) * [-1397.808] (-1394.622) (-1398.033) (-1400.453) -- 0:02:33
264000 -- [-1388.678] (-1399.735) (-1392.389) (-1399.413) * (-1402.540) (-1398.789) [-1393.789] (-1393.347) -- 0:02:33
264500 -- (-1398.514) (-1391.438) [-1392.542] (-1405.716) * (-1397.696) (-1396.422) (-1397.562) [-1401.655] -- 0:02:32
265000 -- [-1397.380] (-1393.464) (-1395.928) (-1404.867) * [-1397.345] (-1400.060) (-1398.139) (-1406.480) -- 0:02:32
Average standard deviation of split frequencies: 0.006498
265500 -- (-1393.654) [-1393.645] (-1394.754) (-1398.217) * (-1399.021) (-1393.559) (-1400.061) [-1394.108] -- 0:02:32
266000 -- (-1400.005) [-1390.581] (-1405.863) (-1391.559) * (-1406.238) (-1395.358) [-1387.298] (-1402.187) -- 0:02:31
266500 -- (-1398.077) (-1392.145) [-1401.181] (-1399.031) * [-1396.583] (-1404.785) (-1398.365) (-1399.398) -- 0:02:34
267000 -- (-1398.301) [-1389.872] (-1397.345) (-1400.346) * (-1394.488) (-1400.072) [-1393.562] (-1391.643) -- 0:02:33
267500 -- (-1410.837) (-1389.533) [-1397.640] (-1395.609) * (-1402.339) (-1397.303) [-1402.111] (-1395.619) -- 0:02:33
268000 -- [-1400.509] (-1393.572) (-1403.712) (-1404.556) * (-1394.702) (-1391.435) [-1395.662] (-1402.941) -- 0:02:32
268500 -- (-1398.177) (-1395.489) (-1395.084) [-1393.309] * (-1393.541) [-1392.474] (-1396.250) (-1392.776) -- 0:02:32
269000 -- (-1399.781) (-1404.414) [-1390.036] (-1403.011) * (-1396.600) (-1399.030) [-1404.386] (-1387.170) -- 0:02:32
269500 -- [-1395.631] (-1396.358) (-1394.695) (-1402.424) * [-1395.029] (-1395.279) (-1398.253) (-1392.930) -- 0:02:31
270000 -- (-1406.483) [-1399.499] (-1388.777) (-1391.686) * [-1395.364] (-1395.392) (-1401.718) (-1386.112) -- 0:02:31
Average standard deviation of split frequencies: 0.007257
270500 -- (-1396.531) (-1401.564) (-1391.043) [-1388.015] * [-1390.948] (-1400.161) (-1401.716) (-1400.686) -- 0:02:31
271000 -- (-1394.950) (-1392.779) [-1394.626] (-1398.541) * (-1401.516) (-1395.247) [-1395.554] (-1397.597) -- 0:02:30
271500 -- (-1397.963) (-1389.657) (-1395.082) [-1391.461] * (-1397.926) [-1401.094] (-1393.259) (-1390.716) -- 0:02:32
272000 -- [-1395.974] (-1395.416) (-1396.052) (-1393.906) * (-1400.552) [-1394.278] (-1400.883) (-1392.035) -- 0:02:32
272500 -- (-1399.007) (-1394.970) [-1394.441] (-1394.537) * (-1397.049) (-1396.480) [-1398.949] (-1390.989) -- 0:02:32
273000 -- [-1392.963] (-1393.738) (-1393.442) (-1389.073) * (-1396.915) (-1395.659) [-1389.804] (-1398.653) -- 0:02:31
273500 -- (-1395.445) (-1386.572) (-1402.618) [-1393.712] * (-1397.221) (-1392.241) [-1394.078] (-1394.393) -- 0:02:31
274000 -- (-1401.282) (-1399.492) [-1390.337] (-1390.729) * [-1390.689] (-1398.376) (-1397.669) (-1394.433) -- 0:02:31
274500 -- [-1397.878] (-1400.930) (-1391.773) (-1389.060) * (-1394.309) [-1387.652] (-1394.026) (-1399.226) -- 0:02:30
275000 -- (-1405.421) [-1395.611] (-1392.449) (-1393.376) * (-1396.664) [-1403.010] (-1391.797) (-1400.941) -- 0:02:30
Average standard deviation of split frequencies: 0.007686
275500 -- (-1394.396) [-1389.203] (-1392.850) (-1395.173) * (-1399.386) [-1390.664] (-1394.198) (-1400.507) -- 0:02:29
276000 -- (-1400.342) (-1391.438) (-1392.181) [-1397.933] * (-1389.853) (-1394.213) (-1392.940) [-1391.234] -- 0:02:29
276500 -- (-1397.842) [-1389.021] (-1390.085) (-1396.940) * [-1392.003] (-1395.460) (-1391.572) (-1399.793) -- 0:02:29
277000 -- (-1395.131) (-1396.140) [-1393.713] (-1389.805) * (-1390.779) (-1397.891) (-1397.870) [-1391.842] -- 0:02:31
277500 -- (-1396.455) [-1395.409] (-1394.282) (-1388.766) * (-1396.216) (-1403.239) [-1392.717] (-1402.161) -- 0:02:31
278000 -- [-1395.593] (-1403.305) (-1402.378) (-1398.182) * (-1393.372) (-1403.259) [-1388.824] (-1396.530) -- 0:02:30
278500 -- (-1398.665) [-1390.649] (-1405.977) (-1399.896) * (-1394.850) (-1397.698) [-1390.830] (-1394.209) -- 0:02:30
279000 -- (-1404.923) [-1384.478] (-1407.931) (-1398.939) * (-1391.064) (-1395.798) [-1395.449] (-1403.272) -- 0:02:29
279500 -- [-1392.731] (-1393.900) (-1399.149) (-1395.495) * [-1387.834] (-1391.807) (-1388.663) (-1400.913) -- 0:02:29
280000 -- (-1395.656) (-1390.816) (-1393.362) [-1394.865] * [-1391.650] (-1390.623) (-1391.146) (-1398.243) -- 0:02:29
Average standard deviation of split frequencies: 0.006998
280500 -- [-1389.723] (-1402.734) (-1391.839) (-1401.202) * [-1388.720] (-1396.704) (-1399.288) (-1390.406) -- 0:02:28
281000 -- [-1392.810] (-1391.190) (-1395.986) (-1392.770) * (-1391.436) (-1404.330) [-1394.081] (-1391.727) -- 0:02:28
281500 -- (-1390.125) (-1398.096) (-1397.304) [-1398.153] * (-1395.893) (-1394.981) [-1393.582] (-1400.797) -- 0:02:28
282000 -- (-1392.804) (-1393.580) (-1399.953) [-1390.799] * (-1390.494) (-1391.301) (-1391.027) [-1397.791] -- 0:02:30
282500 -- (-1392.539) [-1394.090] (-1401.587) (-1392.788) * (-1394.357) (-1395.652) [-1390.036] (-1393.994) -- 0:02:29
283000 -- (-1391.801) (-1398.139) [-1392.796] (-1396.291) * (-1387.222) [-1397.256] (-1395.163) (-1391.839) -- 0:02:29
283500 -- (-1398.261) (-1397.010) [-1394.031] (-1396.317) * [-1397.546] (-1394.005) (-1398.198) (-1394.002) -- 0:02:29
284000 -- (-1390.081) [-1393.787] (-1393.843) (-1396.609) * (-1385.650) (-1399.555) (-1394.130) [-1393.333] -- 0:02:28
284500 -- (-1389.996) (-1391.879) [-1392.440] (-1392.830) * [-1391.719] (-1393.415) (-1398.249) (-1388.946) -- 0:02:28
285000 -- [-1390.499] (-1390.113) (-1391.526) (-1390.365) * (-1394.859) [-1395.512] (-1395.298) (-1401.656) -- 0:02:28
Average standard deviation of split frequencies: 0.006868
285500 -- [-1390.789] (-1393.393) (-1388.397) (-1391.592) * (-1394.909) [-1390.208] (-1396.394) (-1394.738) -- 0:02:27
286000 -- (-1395.151) (-1391.460) (-1392.868) [-1400.615] * (-1397.884) (-1395.926) [-1393.368] (-1400.057) -- 0:02:27
286500 -- (-1396.992) (-1390.159) [-1395.888] (-1393.258) * (-1393.138) [-1389.884] (-1388.957) (-1394.691) -- 0:02:26
287000 -- [-1391.899] (-1397.405) (-1397.971) (-1399.418) * (-1399.276) (-1395.047) [-1390.133] (-1395.651) -- 0:02:29
287500 -- [-1394.068] (-1392.344) (-1401.189) (-1400.741) * [-1392.675] (-1399.551) (-1391.040) (-1398.702) -- 0:02:28
288000 -- (-1394.155) [-1392.807] (-1402.337) (-1398.697) * (-1393.508) [-1396.353] (-1390.955) (-1397.209) -- 0:02:28
288500 -- (-1393.642) [-1389.070] (-1391.350) (-1400.370) * [-1393.244] (-1396.003) (-1393.785) (-1395.312) -- 0:02:27
289000 -- (-1394.910) (-1396.384) [-1396.278] (-1398.372) * (-1396.132) [-1390.494] (-1393.841) (-1397.800) -- 0:02:27
289500 -- [-1394.021] (-1392.665) (-1395.838) (-1397.892) * (-1403.627) [-1395.062] (-1392.990) (-1401.249) -- 0:02:27
290000 -- (-1400.819) (-1395.190) [-1393.817] (-1390.474) * (-1400.676) (-1403.235) (-1393.841) [-1392.297] -- 0:02:26
Average standard deviation of split frequencies: 0.007298
290500 -- [-1392.135] (-1392.198) (-1392.282) (-1398.445) * [-1386.732] (-1390.755) (-1391.366) (-1402.076) -- 0:02:26
291000 -- [-1396.296] (-1398.933) (-1397.396) (-1397.547) * (-1392.835) (-1393.913) [-1395.167] (-1392.115) -- 0:02:26
291500 -- (-1399.723) [-1397.895] (-1394.697) (-1391.257) * (-1402.487) [-1400.361] (-1401.044) (-1391.004) -- 0:02:25
292000 -- (-1398.177) (-1394.806) (-1389.449) [-1393.780] * (-1395.049) (-1396.260) [-1391.114] (-1391.341) -- 0:02:27
292500 -- (-1397.921) (-1396.618) [-1394.264] (-1389.998) * (-1405.170) [-1401.183] (-1413.092) (-1396.723) -- 0:02:27
293000 -- [-1389.609] (-1398.399) (-1393.816) (-1392.845) * (-1395.540) (-1402.891) (-1400.670) [-1392.085] -- 0:02:27
293500 -- (-1389.272) [-1393.315] (-1400.431) (-1400.780) * (-1396.520) [-1390.703] (-1391.492) (-1396.472) -- 0:02:26
294000 -- (-1405.228) (-1392.413) [-1391.508] (-1392.915) * (-1394.418) (-1396.678) (-1389.910) [-1390.996] -- 0:02:26
294500 -- (-1391.393) (-1397.210) [-1389.203] (-1397.305) * (-1401.096) (-1388.422) [-1390.481] (-1390.444) -- 0:02:26
295000 -- (-1390.691) (-1391.087) (-1393.716) [-1397.507] * (-1399.308) (-1388.611) (-1394.885) [-1397.070] -- 0:02:25
Average standard deviation of split frequencies: 0.007167
295500 -- (-1398.239) (-1401.683) [-1395.374] (-1391.211) * (-1392.552) [-1388.770] (-1394.825) (-1395.315) -- 0:02:25
296000 -- (-1392.499) (-1403.031) (-1390.500) [-1388.573] * [-1398.971] (-1397.197) (-1402.518) (-1394.666) -- 0:02:25
296500 -- (-1397.643) (-1395.825) (-1391.515) [-1392.580] * (-1407.369) (-1396.628) (-1405.938) [-1392.340] -- 0:02:24
297000 -- (-1394.497) (-1393.060) (-1397.361) [-1393.789] * (-1401.180) (-1415.971) [-1395.200] (-1390.430) -- 0:02:26
297500 -- (-1402.929) (-1394.628) [-1390.993] (-1397.426) * (-1405.728) (-1399.135) [-1396.131] (-1393.810) -- 0:02:26
298000 -- (-1393.369) (-1395.860) (-1388.453) [-1394.637] * (-1404.191) (-1396.713) (-1405.140) [-1392.590] -- 0:02:26
298500 -- (-1404.881) (-1395.370) (-1391.739) [-1389.818] * (-1401.619) (-1395.044) [-1394.996] (-1394.813) -- 0:02:25
299000 -- [-1396.436] (-1390.037) (-1401.454) (-1397.476) * (-1397.585) (-1393.568) (-1394.124) [-1393.251] -- 0:02:25
299500 -- (-1396.717) (-1395.333) (-1386.759) [-1391.968] * (-1396.743) (-1398.737) [-1400.589] (-1400.670) -- 0:02:25
300000 -- (-1403.520) [-1390.489] (-1393.079) (-1394.851) * (-1402.574) (-1401.919) [-1391.967] (-1397.176) -- 0:02:24
Average standard deviation of split frequencies: 0.007055
300500 -- [-1392.124] (-1392.447) (-1390.833) (-1398.806) * (-1399.625) (-1397.641) [-1397.253] (-1402.783) -- 0:02:24
301000 -- (-1400.757) (-1393.141) [-1390.133] (-1390.623) * (-1391.821) [-1393.964] (-1402.774) (-1395.114) -- 0:02:23
301500 -- (-1395.713) (-1392.953) (-1393.303) [-1390.023] * [-1396.081] (-1395.880) (-1397.943) (-1398.622) -- 0:02:23
302000 -- (-1390.304) (-1399.679) [-1401.145] (-1396.768) * (-1391.919) (-1407.345) (-1404.497) [-1394.470] -- 0:02:25
302500 -- [-1387.897] (-1397.424) (-1397.249) (-1406.926) * (-1400.930) (-1414.522) [-1398.420] (-1391.758) -- 0:02:25
303000 -- [-1393.015] (-1403.113) (-1398.115) (-1403.648) * (-1393.821) [-1395.174] (-1398.116) (-1398.563) -- 0:02:24
303500 -- [-1389.813] (-1396.204) (-1391.877) (-1394.272) * (-1399.876) (-1400.505) [-1394.390] (-1399.900) -- 0:02:24
304000 -- (-1388.937) [-1396.089] (-1393.015) (-1396.531) * (-1398.187) (-1399.791) [-1390.302] (-1394.876) -- 0:02:24
304500 -- (-1392.299) (-1391.307) [-1394.420] (-1386.527) * (-1404.581) (-1397.855) [-1392.427] (-1399.311) -- 0:02:23
305000 -- [-1403.673] (-1394.235) (-1398.891) (-1399.059) * (-1397.785) (-1398.130) [-1394.231] (-1392.512) -- 0:02:23
Average standard deviation of split frequencies: 0.006419
305500 -- (-1388.208) (-1394.349) (-1395.320) [-1391.333] * (-1399.125) (-1394.114) [-1392.363] (-1390.773) -- 0:02:23
306000 -- [-1397.193] (-1390.103) (-1397.864) (-1398.503) * (-1393.968) (-1395.783) (-1395.359) [-1397.137] -- 0:02:22
306500 -- (-1394.389) [-1394.090] (-1394.241) (-1389.851) * (-1400.153) [-1395.278] (-1400.149) (-1395.689) -- 0:02:22
307000 -- (-1388.961) [-1387.538] (-1392.531) (-1391.758) * [-1395.440] (-1389.276) (-1400.163) (-1405.191) -- 0:02:24
307500 -- (-1394.746) [-1398.305] (-1406.140) (-1390.755) * (-1399.416) (-1396.769) (-1398.175) [-1404.517] -- 0:02:24
308000 -- [-1387.041] (-1389.226) (-1408.697) (-1394.274) * (-1390.963) [-1393.776] (-1393.419) (-1392.099) -- 0:02:23
308500 -- (-1387.219) [-1394.672] (-1397.538) (-1391.355) * [-1388.738] (-1401.240) (-1390.040) (-1390.338) -- 0:02:23
309000 -- [-1390.581] (-1397.333) (-1390.692) (-1394.233) * (-1393.627) (-1394.999) [-1389.071] (-1389.097) -- 0:02:23
309500 -- (-1401.072) (-1398.247) [-1394.593] (-1394.188) * [-1393.702] (-1399.526) (-1399.246) (-1395.306) -- 0:02:22
310000 -- [-1394.596] (-1398.753) (-1391.768) (-1396.329) * (-1393.566) (-1406.000) [-1391.897] (-1396.359) -- 0:02:22
Average standard deviation of split frequencies: 0.007840
310500 -- [-1388.397] (-1394.621) (-1394.520) (-1399.807) * (-1397.241) (-1401.098) [-1387.487] (-1395.530) -- 0:02:22
311000 -- (-1395.696) (-1401.717) (-1396.540) [-1396.953] * (-1399.066) (-1395.835) (-1391.094) [-1390.875] -- 0:02:21
311500 -- (-1389.487) (-1398.700) [-1399.173] (-1391.655) * (-1396.408) [-1391.296] (-1394.970) (-1402.011) -- 0:02:21
312000 -- [-1395.488] (-1391.673) (-1391.264) (-1390.482) * (-1397.358) [-1393.064] (-1398.102) (-1397.442) -- 0:02:23
312500 -- (-1390.926) (-1401.631) [-1392.275] (-1389.426) * [-1390.882] (-1393.978) (-1395.952) (-1401.935) -- 0:02:23
313000 -- (-1407.349) (-1398.638) (-1395.104) [-1397.416] * (-1403.849) (-1394.902) (-1394.024) [-1391.577] -- 0:02:22
313500 -- (-1392.479) (-1392.951) [-1388.031] (-1393.055) * [-1391.732] (-1393.376) (-1393.931) (-1393.344) -- 0:02:22
314000 -- (-1398.028) [-1391.716] (-1405.973) (-1390.508) * (-1399.165) (-1400.474) [-1393.095] (-1395.360) -- 0:02:22
314500 -- [-1394.822] (-1392.011) (-1394.709) (-1397.759) * (-1398.040) (-1395.048) [-1392.839] (-1390.495) -- 0:02:21
315000 -- (-1400.333) (-1391.955) [-1395.665] (-1392.928) * [-1396.919] (-1388.669) (-1398.306) (-1398.114) -- 0:02:21
Average standard deviation of split frequencies: 0.006713
315500 -- (-1403.749) (-1390.276) [-1390.183] (-1395.675) * [-1393.306] (-1397.392) (-1397.020) (-1389.930) -- 0:02:21
316000 -- [-1390.555] (-1395.358) (-1405.494) (-1389.074) * [-1389.836] (-1396.289) (-1396.955) (-1390.357) -- 0:02:20
316500 -- (-1406.873) (-1392.619) [-1400.697] (-1397.243) * (-1392.037) [-1390.676] (-1394.680) (-1404.051) -- 0:02:20
317000 -- [-1401.140] (-1400.788) (-1393.329) (-1395.245) * [-1393.283] (-1396.779) (-1393.228) (-1397.341) -- 0:02:22
317500 -- (-1401.164) (-1402.904) [-1392.792] (-1397.858) * [-1389.514] (-1404.263) (-1393.773) (-1403.118) -- 0:02:21
318000 -- (-1394.758) [-1391.622] (-1404.915) (-1390.959) * (-1389.119) (-1393.825) (-1392.384) [-1391.018] -- 0:02:21
318500 -- (-1395.536) (-1393.131) (-1400.757) [-1397.415] * (-1399.818) (-1400.733) [-1391.806] (-1393.782) -- 0:02:21
319000 -- (-1397.735) (-1399.074) [-1391.718] (-1394.570) * (-1397.366) (-1391.907) [-1392.835] (-1395.022) -- 0:02:20
319500 -- [-1402.815] (-1405.781) (-1398.209) (-1413.087) * [-1397.770] (-1396.547) (-1402.973) (-1389.657) -- 0:02:20
320000 -- (-1402.052) (-1395.519) [-1398.655] (-1401.818) * [-1397.074] (-1395.580) (-1391.911) (-1403.663) -- 0:02:20
Average standard deviation of split frequencies: 0.005145
320500 -- [-1397.961] (-1405.201) (-1396.910) (-1399.012) * [-1395.426] (-1396.071) (-1394.738) (-1396.024) -- 0:02:19
321000 -- (-1403.381) (-1396.518) [-1388.464] (-1397.883) * (-1395.479) (-1394.618) [-1390.328] (-1412.336) -- 0:02:19
321500 -- (-1400.556) (-1404.512) [-1389.305] (-1398.484) * (-1399.896) (-1392.386) (-1396.898) [-1402.756] -- 0:02:21
322000 -- (-1391.606) (-1396.752) (-1397.407) [-1390.946] * (-1399.185) (-1392.866) (-1393.363) [-1398.204] -- 0:02:21
322500 -- (-1392.717) (-1398.649) [-1391.298] (-1397.822) * (-1393.030) (-1392.303) (-1390.181) [-1396.625] -- 0:02:20
323000 -- (-1400.827) [-1387.046] (-1394.652) (-1394.447) * (-1402.495) [-1392.024] (-1410.470) (-1402.687) -- 0:02:20
323500 -- (-1398.664) [-1392.176] (-1389.907) (-1396.377) * (-1402.555) (-1394.927) (-1388.842) [-1392.212] -- 0:02:20
324000 -- [-1397.140] (-1386.964) (-1390.388) (-1401.939) * (-1391.815) [-1400.340] (-1405.930) (-1396.038) -- 0:02:19
324500 -- (-1401.952) (-1391.708) (-1395.282) [-1392.054] * (-1395.637) [-1392.770] (-1396.334) (-1390.941) -- 0:02:19
325000 -- (-1405.765) [-1392.910] (-1390.296) (-1393.080) * (-1392.628) (-1393.546) (-1399.036) [-1391.557] -- 0:02:19
Average standard deviation of split frequencies: 0.005543
325500 -- (-1395.681) (-1396.056) (-1396.357) [-1398.549] * (-1391.607) (-1389.314) [-1400.667] (-1402.532) -- 0:02:18
326000 -- (-1389.427) (-1392.690) [-1390.765] (-1397.660) * (-1391.655) (-1399.005) [-1399.851] (-1394.532) -- 0:02:18
326500 -- (-1393.915) (-1394.463) [-1394.264] (-1400.850) * (-1398.160) (-1404.951) (-1396.121) [-1390.564] -- 0:02:18
327000 -- (-1398.753) [-1397.783] (-1393.922) (-1390.177) * [-1391.974] (-1392.278) (-1399.416) (-1396.844) -- 0:02:19
327500 -- (-1394.727) [-1390.392] (-1392.077) (-1393.536) * [-1393.383] (-1387.206) (-1398.409) (-1393.548) -- 0:02:19
328000 -- (-1395.367) (-1398.557) [-1391.736] (-1405.506) * (-1388.117) (-1391.233) [-1396.713] (-1398.771) -- 0:02:19
328500 -- (-1398.288) (-1395.312) [-1393.467] (-1393.712) * (-1388.421) [-1393.923] (-1396.240) (-1397.923) -- 0:02:19
329000 -- (-1400.205) [-1393.261] (-1397.701) (-1396.413) * (-1395.507) (-1395.217) [-1393.863] (-1400.936) -- 0:02:18
329500 -- (-1389.531) (-1393.694) (-1410.832) [-1399.065] * [-1392.702] (-1404.900) (-1396.095) (-1393.446) -- 0:02:18
330000 -- (-1401.813) (-1397.378) [-1395.425] (-1397.080) * (-1393.603) (-1397.267) [-1386.858] (-1395.669) -- 0:02:18
Average standard deviation of split frequencies: 0.006415
330500 -- (-1411.036) [-1392.319] (-1397.378) (-1400.977) * [-1387.718] (-1395.479) (-1397.398) (-1395.520) -- 0:02:17
331000 -- (-1393.521) (-1391.608) (-1397.096) [-1395.260] * [-1392.099] (-1391.870) (-1392.907) (-1395.692) -- 0:02:17
331500 -- (-1393.581) [-1392.318] (-1392.341) (-1393.571) * [-1393.570] (-1394.689) (-1394.445) (-1396.829) -- 0:02:19
332000 -- (-1389.471) (-1403.665) (-1391.030) [-1398.173] * (-1394.739) (-1395.852) [-1391.370] (-1397.919) -- 0:02:18
332500 -- (-1390.922) [-1393.966] (-1393.770) (-1402.098) * (-1396.304) [-1387.123] (-1391.506) (-1392.383) -- 0:02:18
333000 -- [-1393.127] (-1394.977) (-1394.851) (-1406.848) * (-1397.677) [-1394.406] (-1394.231) (-1393.800) -- 0:02:18
333500 -- [-1385.979] (-1399.244) (-1389.314) (-1394.544) * [-1391.461] (-1397.951) (-1396.309) (-1390.296) -- 0:02:17
334000 -- (-1390.870) (-1395.132) (-1391.388) [-1394.722] * (-1397.968) (-1394.190) (-1391.944) [-1385.025] -- 0:02:17
334500 -- (-1396.737) (-1395.080) (-1401.026) [-1390.861] * (-1394.724) [-1389.918] (-1404.980) (-1406.290) -- 0:02:17
335000 -- (-1390.734) (-1397.185) (-1399.799) [-1394.057] * (-1390.190) [-1393.026] (-1401.413) (-1399.001) -- 0:02:16
Average standard deviation of split frequencies: 0.008418
335500 -- (-1399.174) [-1392.540] (-1395.442) (-1403.128) * [-1404.232] (-1407.507) (-1389.908) (-1396.497) -- 0:02:16
336000 -- (-1396.007) [-1391.127] (-1393.706) (-1395.511) * (-1400.097) [-1402.184] (-1397.377) (-1394.611) -- 0:02:16
336500 -- [-1389.329] (-1402.484) (-1389.694) (-1391.495) * (-1406.256) (-1403.721) [-1401.974] (-1392.320) -- 0:02:18
337000 -- (-1403.771) (-1395.523) [-1389.322] (-1401.143) * (-1394.123) [-1398.786] (-1392.778) (-1397.446) -- 0:02:17
337500 -- (-1397.907) (-1397.681) (-1400.798) [-1393.592] * (-1403.599) (-1393.568) (-1391.429) [-1394.817] -- 0:02:17
338000 -- (-1396.831) (-1397.888) [-1391.301] (-1391.153) * [-1387.981] (-1396.369) (-1395.766) (-1395.802) -- 0:02:17
338500 -- (-1397.770) [-1395.272] (-1393.967) (-1394.002) * [-1394.792] (-1397.664) (-1397.332) (-1394.052) -- 0:02:16
339000 -- (-1388.305) [-1389.002] (-1396.814) (-1388.608) * (-1391.261) (-1396.863) (-1397.074) [-1393.266] -- 0:02:16
339500 -- (-1392.657) (-1394.346) [-1396.309] (-1392.620) * [-1393.510] (-1404.460) (-1394.330) (-1401.466) -- 0:02:16
340000 -- (-1398.307) (-1390.945) [-1397.529] (-1390.853) * [-1387.774] (-1391.689) (-1394.277) (-1407.239) -- 0:02:15
Average standard deviation of split frequencies: 0.005996
340500 -- [-1398.271] (-1397.655) (-1402.180) (-1399.102) * [-1387.126] (-1394.523) (-1395.860) (-1394.254) -- 0:02:15
341000 -- (-1399.294) (-1397.731) (-1396.432) [-1390.243] * [-1390.965] (-1397.554) (-1397.426) (-1397.593) -- 0:02:15
341500 -- (-1397.603) (-1393.967) (-1392.605) [-1397.444] * (-1393.228) (-1403.722) (-1393.598) [-1398.497] -- 0:02:16
342000 -- [-1390.052] (-1392.939) (-1391.200) (-1396.124) * [-1397.812] (-1391.772) (-1390.962) (-1393.972) -- 0:02:16
342500 -- [-1398.564] (-1389.705) (-1390.999) (-1399.912) * (-1396.898) (-1386.393) [-1388.990] (-1404.688) -- 0:02:16
343000 -- (-1393.401) (-1394.809) [-1394.397] (-1397.906) * [-1389.189] (-1392.545) (-1402.984) (-1398.531) -- 0:02:15
343500 -- (-1392.678) [-1400.419] (-1393.820) (-1404.593) * (-1390.171) (-1401.481) (-1391.729) [-1401.349] -- 0:02:15
344000 -- (-1396.220) (-1394.073) (-1393.255) [-1396.736] * [-1389.606] (-1406.570) (-1394.973) (-1397.913) -- 0:02:15
344500 -- (-1396.366) (-1404.049) [-1396.364] (-1402.528) * (-1397.201) (-1401.966) [-1390.948] (-1388.381) -- 0:02:15
345000 -- (-1392.195) (-1403.822) (-1400.107) [-1393.725] * (-1398.543) (-1400.505) (-1396.442) [-1391.213] -- 0:02:14
Average standard deviation of split frequencies: 0.006358
345500 -- [-1391.590] (-1395.185) (-1392.336) (-1396.928) * [-1400.402] (-1388.576) (-1402.197) (-1386.351) -- 0:02:14
346000 -- [-1394.504] (-1389.315) (-1403.295) (-1392.386) * (-1389.626) (-1393.959) (-1398.112) [-1398.066] -- 0:02:14
346500 -- (-1395.657) [-1396.930] (-1394.466) (-1395.726) * (-1399.794) (-1402.219) (-1395.784) [-1391.127] -- 0:02:15
347000 -- (-1400.699) (-1392.761) (-1393.923) [-1390.938] * (-1394.938) (-1400.472) (-1396.362) [-1389.614] -- 0:02:15
347500 -- (-1397.485) [-1393.833] (-1397.224) (-1394.784) * (-1398.395) (-1396.578) (-1394.917) [-1387.792] -- 0:02:15
348000 -- [-1395.200] (-1394.624) (-1394.771) (-1394.704) * (-1402.117) (-1407.004) (-1395.709) [-1393.087] -- 0:02:14
348500 -- [-1390.525] (-1393.805) (-1405.295) (-1389.064) * (-1405.951) (-1399.268) [-1399.953] (-1393.582) -- 0:02:14
349000 -- (-1391.465) (-1394.867) [-1401.241] (-1388.500) * (-1396.749) (-1396.963) (-1396.068) [-1389.866] -- 0:02:14
349500 -- (-1389.521) [-1395.029] (-1394.914) (-1393.165) * (-1391.148) (-1394.627) [-1400.082] (-1397.082) -- 0:02:14
350000 -- (-1395.739) (-1394.452) (-1398.574) [-1389.948] * [-1388.681] (-1391.766) (-1395.356) (-1399.091) -- 0:02:13
Average standard deviation of split frequencies: 0.006722
350500 -- (-1394.728) (-1395.031) (-1397.244) [-1392.694] * (-1397.377) [-1397.896] (-1395.306) (-1392.810) -- 0:02:13
351000 -- [-1394.422] (-1397.173) (-1392.320) (-1398.228) * (-1395.397) (-1393.659) (-1392.849) [-1390.938] -- 0:02:13
351500 -- [-1396.204] (-1398.855) (-1399.709) (-1393.537) * (-1393.391) (-1394.690) [-1396.509] (-1399.197) -- 0:02:14
352000 -- [-1391.731] (-1398.745) (-1399.069) (-1399.423) * (-1390.396) (-1393.226) [-1396.120] (-1400.157) -- 0:02:14
352500 -- (-1392.403) [-1394.901] (-1398.662) (-1391.233) * (-1391.646) [-1395.606] (-1396.619) (-1416.042) -- 0:02:14
353000 -- [-1389.088] (-1394.706) (-1408.312) (-1394.936) * (-1395.697) (-1394.058) (-1394.200) [-1397.886] -- 0:02:13
353500 -- (-1395.778) [-1394.991] (-1399.169) (-1392.927) * (-1397.830) (-1397.733) [-1388.856] (-1395.074) -- 0:02:13
354000 -- [-1392.727] (-1390.708) (-1394.908) (-1397.047) * (-1398.486) (-1393.040) [-1391.543] (-1400.699) -- 0:02:13
354500 -- (-1391.249) [-1394.359] (-1400.164) (-1400.932) * (-1399.929) [-1395.427] (-1395.625) (-1391.896) -- 0:02:12
355000 -- (-1399.114) (-1402.831) [-1390.499] (-1398.785) * [-1393.855] (-1393.426) (-1388.544) (-1397.966) -- 0:02:12
Average standard deviation of split frequencies: 0.007062
355500 -- (-1398.761) (-1398.281) (-1396.229) [-1394.645] * (-1394.528) [-1395.272] (-1393.151) (-1399.139) -- 0:02:12
356000 -- [-1398.340] (-1392.882) (-1401.908) (-1392.905) * [-1390.971] (-1402.586) (-1394.549) (-1398.545) -- 0:02:12
356500 -- (-1396.038) [-1388.770] (-1395.578) (-1386.462) * (-1397.515) [-1392.482] (-1398.108) (-1396.864) -- 0:02:13
357000 -- (-1391.287) [-1390.992] (-1404.629) (-1390.060) * (-1395.598) [-1403.557] (-1397.062) (-1395.646) -- 0:02:13
357500 -- (-1392.584) [-1393.570] (-1394.736) (-1395.805) * (-1393.982) (-1396.654) [-1393.243] (-1400.137) -- 0:02:12
358000 -- (-1396.344) (-1398.995) (-1390.769) [-1392.838] * [-1393.778] (-1390.097) (-1400.554) (-1400.117) -- 0:02:12
358500 -- [-1401.500] (-1395.612) (-1395.740) (-1395.772) * (-1395.110) [-1392.659] (-1396.846) (-1392.803) -- 0:02:12
359000 -- (-1393.712) (-1395.599) (-1391.977) [-1389.751] * (-1395.661) (-1399.822) [-1397.681] (-1395.082) -- 0:02:12
359500 -- (-1396.901) (-1396.487) [-1391.779] (-1392.993) * [-1395.363] (-1393.146) (-1408.848) (-1396.035) -- 0:02:11
360000 -- [-1391.068] (-1410.299) (-1395.299) (-1395.296) * (-1403.535) [-1400.878] (-1395.384) (-1397.405) -- 0:02:11
Average standard deviation of split frequencies: 0.007842
360500 -- (-1390.802) (-1394.604) [-1387.282] (-1391.883) * [-1401.778] (-1393.650) (-1399.118) (-1396.523) -- 0:02:11
361000 -- (-1397.128) (-1399.990) (-1397.343) [-1391.172] * (-1400.003) [-1396.169] (-1403.891) (-1401.210) -- 0:02:10
361500 -- (-1390.532) [-1393.211] (-1398.453) (-1397.131) * (-1397.982) (-1396.519) [-1397.839] (-1392.388) -- 0:02:12
362000 -- [-1397.834] (-1395.486) (-1401.160) (-1402.935) * (-1394.006) (-1393.513) (-1396.879) [-1392.404] -- 0:02:12
362500 -- (-1400.489) [-1391.500] (-1402.251) (-1397.913) * (-1397.766) (-1389.741) [-1390.623] (-1393.963) -- 0:02:11
363000 -- (-1390.929) (-1391.083) (-1396.514) [-1391.462] * [-1401.648] (-1392.267) (-1397.987) (-1391.507) -- 0:02:11
363500 -- (-1390.997) (-1392.359) (-1402.695) [-1389.876] * (-1409.679) (-1394.205) [-1394.844] (-1390.024) -- 0:02:11
364000 -- (-1397.980) (-1400.357) [-1399.400] (-1393.314) * (-1396.516) (-1403.264) [-1393.845] (-1393.736) -- 0:02:11
364500 -- [-1394.924] (-1400.634) (-1395.642) (-1393.895) * (-1398.607) [-1395.778] (-1398.877) (-1398.808) -- 0:02:10
365000 -- (-1404.167) (-1393.694) [-1399.074] (-1387.311) * (-1401.284) (-1391.942) [-1393.768] (-1391.665) -- 0:02:10
Average standard deviation of split frequencies: 0.006440
365500 -- (-1403.323) (-1389.280) (-1397.060) [-1390.078] * [-1395.873] (-1394.391) (-1394.509) (-1395.805) -- 0:02:10
366000 -- (-1403.727) (-1393.175) (-1392.801) [-1396.114] * [-1395.381] (-1391.727) (-1397.306) (-1394.952) -- 0:02:09
366500 -- (-1400.451) (-1399.190) [-1387.599] (-1397.285) * (-1404.481) [-1397.461] (-1396.713) (-1395.443) -- 0:02:11
367000 -- (-1394.239) (-1402.072) (-1395.695) [-1393.871] * [-1401.782] (-1396.909) (-1399.927) (-1397.374) -- 0:02:11
367500 -- (-1394.300) (-1395.616) [-1394.143] (-1395.413) * (-1395.921) (-1399.314) (-1399.262) [-1390.949] -- 0:02:10
368000 -- (-1388.665) (-1392.787) (-1394.768) [-1394.859] * (-1403.021) [-1392.115] (-1393.212) (-1396.395) -- 0:02:10
368500 -- [-1395.581] (-1396.430) (-1394.746) (-1395.158) * (-1403.605) [-1393.387] (-1396.376) (-1386.691) -- 0:02:10
369000 -- (-1393.099) [-1388.325] (-1395.371) (-1396.695) * (-1407.011) (-1401.664) [-1393.741] (-1394.873) -- 0:02:09
369500 -- (-1392.485) (-1395.828) (-1395.929) [-1395.053] * [-1389.501] (-1401.008) (-1396.783) (-1391.215) -- 0:02:09
370000 -- (-1401.621) (-1407.909) [-1395.898] (-1403.227) * (-1395.293) (-1392.001) (-1391.005) [-1394.029] -- 0:02:09
Average standard deviation of split frequencies: 0.006783
370500 -- [-1396.081] (-1389.370) (-1396.882) (-1395.158) * (-1406.072) [-1394.591] (-1394.059) (-1396.321) -- 0:02:09
371000 -- [-1389.058] (-1392.756) (-1396.078) (-1395.746) * (-1388.345) [-1392.226] (-1392.717) (-1392.046) -- 0:02:08
371500 -- (-1397.424) (-1396.899) [-1404.550] (-1395.043) * (-1393.859) (-1393.117) [-1396.480] (-1396.875) -- 0:02:10
372000 -- [-1393.236] (-1391.789) (-1396.753) (-1392.822) * [-1392.537] (-1396.233) (-1401.722) (-1398.303) -- 0:02:09
372500 -- [-1391.843] (-1398.105) (-1395.566) (-1396.887) * (-1393.787) [-1392.230] (-1398.180) (-1392.131) -- 0:02:09
373000 -- [-1391.872] (-1398.168) (-1395.384) (-1393.561) * (-1398.306) [-1394.591] (-1397.494) (-1398.905) -- 0:02:09
373500 -- (-1396.039) (-1396.059) (-1388.894) [-1391.605] * [-1390.692] (-1393.293) (-1394.045) (-1395.921) -- 0:02:09
374000 -- (-1392.137) (-1396.310) (-1390.139) [-1395.054] * (-1395.542) [-1392.354] (-1400.282) (-1394.400) -- 0:02:08
374500 -- (-1394.473) [-1393.259] (-1387.800) (-1395.349) * [-1396.133] (-1389.385) (-1389.240) (-1390.636) -- 0:02:08
375000 -- [-1392.359] (-1397.310) (-1398.605) (-1393.909) * (-1391.761) (-1398.206) [-1404.913] (-1399.227) -- 0:02:08
Average standard deviation of split frequencies: 0.007522
375500 -- [-1394.515] (-1392.250) (-1390.884) (-1394.982) * (-1398.167) (-1394.899) [-1395.541] (-1393.572) -- 0:02:08
376000 -- (-1398.440) (-1394.050) (-1391.547) [-1395.769] * (-1396.654) (-1391.760) (-1395.728) [-1389.018] -- 0:02:07
376500 -- (-1398.780) [-1398.138] (-1402.037) (-1396.777) * (-1391.289) (-1395.293) (-1391.101) [-1400.527] -- 0:02:09
377000 -- (-1400.660) (-1395.209) [-1390.798] (-1386.976) * (-1398.406) (-1393.642) (-1396.119) [-1393.925] -- 0:02:08
377500 -- (-1395.795) (-1395.264) (-1395.482) [-1398.085] * [-1389.103] (-1408.990) (-1391.050) (-1403.514) -- 0:02:08
378000 -- (-1393.580) (-1405.061) (-1394.908) [-1391.100] * (-1392.547) (-1398.654) [-1400.558] (-1393.438) -- 0:02:08
378500 -- (-1394.955) [-1396.365] (-1398.643) (-1396.142) * [-1387.476] (-1401.251) (-1407.133) (-1392.865) -- 0:02:08
379000 -- (-1398.706) [-1398.650] (-1400.305) (-1391.860) * (-1397.229) [-1396.214] (-1391.047) (-1402.778) -- 0:02:07
379500 -- (-1403.455) (-1396.719) (-1389.938) [-1398.103] * (-1393.190) [-1389.347] (-1390.153) (-1399.625) -- 0:02:07
380000 -- (-1400.516) (-1403.090) (-1386.928) [-1394.588] * (-1394.356) (-1392.533) [-1397.739] (-1403.759) -- 0:02:07
Average standard deviation of split frequencies: 0.008669
380500 -- (-1393.317) (-1408.232) (-1391.522) [-1394.527] * (-1394.245) (-1396.499) (-1390.123) [-1392.793] -- 0:02:06
381000 -- (-1399.450) (-1403.759) [-1393.115] (-1389.584) * [-1387.701] (-1397.584) (-1392.681) (-1397.989) -- 0:02:06
381500 -- (-1397.494) (-1393.455) (-1392.424) [-1392.041] * (-1391.971) (-1387.428) (-1389.956) [-1388.323] -- 0:02:08
382000 -- (-1394.482) (-1396.467) (-1404.665) [-1390.597] * (-1392.042) [-1391.751] (-1395.903) (-1398.334) -- 0:02:07
382500 -- [-1392.575] (-1406.804) (-1403.966) (-1391.816) * (-1393.461) [-1392.456] (-1411.000) (-1395.638) -- 0:02:07
383000 -- (-1393.978) (-1400.118) [-1400.786] (-1392.470) * (-1388.601) (-1395.572) (-1394.459) [-1389.248] -- 0:02:07
383500 -- (-1398.122) (-1397.509) [-1396.646] (-1397.473) * (-1395.734) [-1390.847] (-1391.100) (-1392.647) -- 0:02:06
384000 -- [-1400.224] (-1394.640) (-1394.793) (-1398.651) * (-1392.326) (-1393.427) (-1393.597) [-1394.893] -- 0:02:06
384500 -- [-1407.820] (-1395.056) (-1388.769) (-1394.811) * (-1394.547) [-1393.235] (-1398.787) (-1391.009) -- 0:02:06
385000 -- (-1402.245) (-1388.873) (-1398.000) [-1401.761] * (-1401.157) (-1399.711) (-1397.720) [-1393.344] -- 0:02:06
Average standard deviation of split frequencies: 0.007328
385500 -- [-1390.670] (-1394.655) (-1397.095) (-1403.931) * (-1396.847) (-1395.729) [-1392.705] (-1395.077) -- 0:02:05
386000 -- [-1391.257] (-1402.888) (-1395.003) (-1399.883) * [-1397.280] (-1403.912) (-1390.162) (-1401.030) -- 0:02:07
386500 -- [-1392.408] (-1393.464) (-1393.526) (-1395.107) * (-1395.608) [-1388.009] (-1399.067) (-1392.890) -- 0:02:06
387000 -- (-1395.607) [-1392.272] (-1390.879) (-1395.857) * [-1390.986] (-1395.950) (-1401.799) (-1390.806) -- 0:02:06
387500 -- (-1390.581) (-1399.344) [-1392.435] (-1394.911) * (-1388.884) (-1398.853) [-1394.931] (-1389.704) -- 0:02:06
388000 -- (-1394.535) (-1392.693) (-1388.182) [-1392.171] * (-1392.400) (-1395.784) [-1391.317] (-1394.414) -- 0:02:06
388500 -- (-1394.147) (-1394.383) (-1391.028) [-1393.747] * (-1398.155) (-1393.064) [-1395.230] (-1400.010) -- 0:02:05
389000 -- (-1393.153) (-1402.198) (-1402.450) [-1390.274] * (-1393.218) [-1394.605] (-1399.597) (-1399.096) -- 0:02:05
389500 -- (-1390.778) (-1395.693) (-1387.621) [-1393.225] * (-1400.293) (-1389.624) (-1389.251) [-1387.845] -- 0:02:05
390000 -- (-1400.761) [-1392.951] (-1390.102) (-1397.903) * (-1398.032) (-1395.084) (-1402.841) [-1394.846] -- 0:02:05
Average standard deviation of split frequencies: 0.006436
390500 -- (-1399.949) (-1395.922) [-1391.997] (-1396.143) * [-1392.097] (-1393.203) (-1392.987) (-1393.888) -- 0:02:04
391000 -- (-1400.006) (-1392.746) [-1391.641] (-1398.162) * (-1406.543) (-1390.595) [-1392.290] (-1393.415) -- 0:02:04
391500 -- (-1399.474) [-1390.780] (-1394.996) (-1397.586) * [-1395.654] (-1395.139) (-1390.515) (-1387.701) -- 0:02:05
392000 -- [-1391.558] (-1389.293) (-1399.045) (-1400.880) * (-1403.427) [-1397.089] (-1401.559) (-1405.240) -- 0:02:05
392500 -- (-1395.195) (-1398.217) (-1397.673) [-1392.614] * [-1392.036] (-1395.365) (-1392.805) (-1395.167) -- 0:02:05
393000 -- (-1397.757) [-1392.596] (-1398.250) (-1392.596) * (-1392.185) (-1396.792) [-1398.300] (-1391.223) -- 0:02:05
393500 -- (-1399.221) (-1401.280) (-1395.906) [-1390.881] * [-1394.379] (-1398.711) (-1401.752) (-1394.719) -- 0:02:04
394000 -- (-1395.545) (-1406.237) (-1390.051) [-1397.990] * [-1396.800] (-1396.666) (-1398.854) (-1396.060) -- 0:02:04
394500 -- (-1402.514) [-1395.422] (-1403.002) (-1402.464) * [-1388.625] (-1399.766) (-1398.610) (-1394.516) -- 0:02:04
395000 -- (-1391.100) (-1393.952) [-1394.339] (-1395.398) * (-1394.460) [-1394.302] (-1396.605) (-1393.210) -- 0:02:04
Average standard deviation of split frequencies: 0.005952
395500 -- [-1390.093] (-1395.765) (-1388.691) (-1400.470) * (-1403.965) (-1388.725) (-1399.201) [-1393.118] -- 0:02:03
396000 -- (-1403.944) (-1393.303) [-1392.479] (-1404.655) * (-1401.570) [-1394.492] (-1393.960) (-1396.852) -- 0:02:03
396500 -- (-1405.085) [-1392.747] (-1392.529) (-1401.485) * (-1392.145) [-1397.736] (-1400.644) (-1398.520) -- 0:02:04
397000 -- (-1395.424) (-1387.988) [-1388.496] (-1396.854) * (-1395.909) (-1393.884) [-1391.560] (-1405.150) -- 0:02:04
397500 -- [-1394.097] (-1389.630) (-1392.820) (-1397.382) * (-1392.296) (-1401.134) (-1395.854) [-1387.813] -- 0:02:04
398000 -- (-1389.175) (-1393.381) [-1393.986] (-1397.223) * (-1401.034) [-1393.610] (-1395.573) (-1389.718) -- 0:02:04
398500 -- (-1393.368) [-1392.425] (-1392.108) (-1389.476) * [-1396.702] (-1390.026) (-1397.394) (-1397.393) -- 0:02:03
399000 -- (-1397.282) (-1398.197) (-1399.239) [-1393.649] * [-1389.283] (-1399.300) (-1395.085) (-1401.734) -- 0:02:03
399500 -- (-1397.702) [-1390.524] (-1399.562) (-1393.605) * [-1398.732] (-1397.229) (-1399.707) (-1395.693) -- 0:02:03
400000 -- (-1402.748) [-1389.050] (-1398.989) (-1393.154) * [-1402.806] (-1389.286) (-1404.325) (-1400.044) -- 0:02:03
Average standard deviation of split frequencies: 0.005883
400500 -- (-1394.412) [-1398.007] (-1392.112) (-1390.120) * (-1400.727) (-1393.048) [-1401.370] (-1395.226) -- 0:02:02
401000 -- (-1393.346) (-1395.724) [-1397.049] (-1389.795) * (-1397.938) [-1393.608] (-1407.542) (-1389.987) -- 0:02:03
401500 -- (-1394.395) (-1390.370) [-1396.500] (-1396.318) * (-1401.265) (-1406.363) [-1392.128] (-1392.688) -- 0:02:03
402000 -- (-1401.173) (-1400.553) (-1391.896) [-1392.274] * (-1401.377) (-1394.349) [-1390.347] (-1389.154) -- 0:02:03
402500 -- (-1393.041) [-1400.721] (-1389.287) (-1396.232) * (-1400.416) (-1392.766) [-1395.606] (-1393.466) -- 0:02:03
403000 -- [-1393.795] (-1393.985) (-1392.484) (-1393.509) * (-1397.915) (-1395.008) (-1397.633) [-1392.572] -- 0:02:02
403500 -- (-1393.394) (-1389.745) [-1394.123] (-1396.686) * (-1398.529) (-1401.158) (-1392.937) [-1391.101] -- 0:02:02
404000 -- (-1391.367) [-1391.886] (-1390.778) (-1396.842) * (-1393.865) (-1390.234) (-1392.769) [-1396.520] -- 0:02:02
404500 -- (-1390.399) (-1391.362) [-1391.131] (-1396.451) * (-1402.480) (-1390.307) [-1394.118] (-1390.111) -- 0:02:02
405000 -- (-1396.021) (-1396.660) (-1395.534) [-1397.060] * (-1393.943) [-1390.114] (-1393.219) (-1394.090) -- 0:02:01
Average standard deviation of split frequencies: 0.007160
405500 -- (-1389.817) [-1391.903] (-1386.602) (-1394.982) * (-1406.692) (-1398.525) (-1403.995) [-1392.667] -- 0:02:01
406000 -- [-1387.392] (-1393.168) (-1394.131) (-1396.007) * [-1396.661] (-1396.987) (-1402.866) (-1390.534) -- 0:02:01
406500 -- (-1397.513) (-1395.001) [-1394.200] (-1397.639) * (-1393.930) (-1394.013) [-1392.725] (-1391.038) -- 0:02:02
407000 -- (-1398.240) (-1404.682) (-1391.037) [-1388.433] * (-1399.791) (-1393.997) (-1398.535) [-1394.984] -- 0:02:02
407500 -- (-1390.379) (-1401.189) (-1395.744) [-1392.922] * (-1399.415) (-1389.931) (-1393.306) [-1391.059] -- 0:02:02
408000 -- [-1392.144] (-1398.811) (-1400.316) (-1391.234) * (-1398.058) (-1393.939) [-1388.337] (-1396.043) -- 0:02:01
408500 -- (-1393.849) (-1397.229) [-1395.332] (-1397.948) * (-1396.799) (-1393.648) (-1387.597) [-1391.853] -- 0:02:01
409000 -- (-1393.956) [-1390.076] (-1393.567) (-1390.680) * [-1391.707] (-1396.340) (-1398.905) (-1393.154) -- 0:02:01
409500 -- [-1389.191] (-1413.393) (-1391.851) (-1394.360) * (-1392.593) [-1390.379] (-1402.059) (-1391.970) -- 0:02:01
410000 -- (-1387.132) [-1396.783] (-1405.000) (-1392.074) * (-1392.324) (-1392.022) (-1392.336) [-1389.720] -- 0:02:00
Average standard deviation of split frequencies: 0.007844
410500 -- [-1395.838] (-1393.897) (-1400.289) (-1404.927) * [-1390.468] (-1406.471) (-1394.125) (-1395.759) -- 0:02:00
411000 -- (-1396.242) (-1397.337) (-1398.787) [-1397.463] * (-1391.667) (-1398.131) [-1395.180] (-1395.748) -- 0:02:01
411500 -- (-1396.556) (-1391.897) (-1396.310) [-1392.363] * [-1391.441] (-1399.212) (-1399.248) (-1393.703) -- 0:02:01
412000 -- (-1393.686) (-1398.977) (-1394.712) [-1393.420] * (-1390.802) [-1397.649] (-1394.573) (-1400.953) -- 0:02:01
412500 -- [-1398.418] (-1396.952) (-1392.801) (-1390.306) * (-1389.275) (-1397.384) [-1395.377] (-1392.482) -- 0:02:01
413000 -- (-1413.473) (-1393.577) [-1395.890] (-1393.467) * (-1395.726) (-1401.341) (-1394.775) [-1388.388] -- 0:02:00
413500 -- [-1393.042] (-1402.479) (-1393.166) (-1391.045) * [-1389.732] (-1398.446) (-1394.409) (-1392.654) -- 0:02:00
414000 -- (-1399.065) (-1396.823) [-1390.633] (-1396.763) * (-1390.061) (-1394.260) (-1390.496) [-1392.621] -- 0:02:00
414500 -- (-1395.172) (-1392.022) (-1395.562) [-1402.733] * (-1390.265) (-1404.774) [-1393.342] (-1392.338) -- 0:02:00
415000 -- (-1394.722) [-1393.513] (-1397.932) (-1396.007) * [-1391.009] (-1405.341) (-1396.607) (-1394.217) -- 0:01:59
Average standard deviation of split frequencies: 0.007366
415500 -- (-1391.821) (-1397.290) [-1396.767] (-1397.233) * (-1394.457) (-1396.312) [-1403.597] (-1402.784) -- 0:01:59
416000 -- (-1398.295) (-1389.949) (-1405.854) [-1389.094] * (-1391.574) (-1397.062) (-1402.113) [-1392.690] -- 0:02:00
416500 -- (-1400.338) (-1392.319) [-1393.302] (-1390.352) * (-1391.367) [-1404.167] (-1400.786) (-1397.354) -- 0:02:00
417000 -- [-1394.223] (-1385.504) (-1392.892) (-1390.086) * (-1391.789) (-1391.532) [-1395.408] (-1402.137) -- 0:02:00
417500 -- (-1407.087) [-1387.378] (-1393.724) (-1395.572) * (-1406.536) [-1392.138] (-1396.354) (-1398.619) -- 0:01:59
418000 -- [-1393.861] (-1398.773) (-1399.871) (-1398.321) * (-1404.492) [-1392.159] (-1392.242) (-1395.681) -- 0:01:59
418500 -- (-1403.501) (-1391.481) [-1394.715] (-1397.463) * (-1393.297) [-1387.163] (-1391.607) (-1401.241) -- 0:01:59
419000 -- (-1397.867) (-1398.833) (-1400.803) [-1393.437] * (-1398.572) (-1397.970) [-1389.054] (-1392.328) -- 0:01:59
419500 -- (-1391.422) (-1393.358) [-1394.073] (-1393.788) * (-1391.840) (-1395.384) [-1393.398] (-1400.588) -- 0:01:59
420000 -- (-1394.950) [-1391.919] (-1398.117) (-1396.981) * [-1391.878] (-1392.969) (-1399.971) (-1389.594) -- 0:01:58
Average standard deviation of split frequencies: 0.007097
420500 -- (-1393.021) (-1393.004) (-1401.986) [-1391.620] * (-1403.037) [-1393.313] (-1397.622) (-1394.747) -- 0:01:58
421000 -- [-1394.621] (-1395.880) (-1400.830) (-1400.089) * (-1409.875) [-1396.686] (-1396.303) (-1397.507) -- 0:01:59
421500 -- (-1393.158) (-1394.352) (-1403.880) [-1392.273] * [-1390.217] (-1400.619) (-1392.405) (-1401.105) -- 0:01:59
422000 -- (-1392.332) (-1404.917) [-1393.779] (-1393.840) * [-1389.853] (-1396.471) (-1390.798) (-1394.853) -- 0:01:59
422500 -- (-1396.944) (-1394.439) [-1395.082] (-1395.198) * (-1395.969) (-1395.327) (-1392.450) [-1398.182] -- 0:01:58
423000 -- (-1393.583) (-1395.168) (-1394.954) [-1389.988] * (-1392.733) (-1387.788) [-1387.025] (-1395.090) -- 0:01:58
423500 -- [-1393.241] (-1397.225) (-1390.664) (-1392.299) * (-1407.184) (-1394.658) [-1392.125] (-1396.557) -- 0:01:58
424000 -- (-1401.624) (-1393.424) [-1391.070] (-1392.058) * [-1398.713] (-1395.605) (-1392.354) (-1405.826) -- 0:01:58
424500 -- (-1395.486) (-1396.302) [-1395.989] (-1393.376) * (-1401.200) (-1400.004) [-1396.379] (-1394.172) -- 0:01:57
425000 -- (-1402.803) [-1394.801] (-1395.966) (-1398.652) * (-1396.101) [-1388.846] (-1394.479) (-1396.167) -- 0:01:57
Average standard deviation of split frequencies: 0.008115
425500 -- (-1400.800) (-1393.493) [-1400.453] (-1395.125) * (-1402.227) [-1394.731] (-1397.577) (-1391.779) -- 0:01:57
426000 -- (-1392.917) (-1396.259) (-1394.715) [-1391.323] * (-1394.834) (-1395.733) [-1389.644] (-1397.783) -- 0:01:58
426500 -- (-1394.358) [-1396.197] (-1394.096) (-1396.122) * (-1389.709) (-1393.695) (-1399.411) [-1397.800] -- 0:01:58
427000 -- [-1393.161] (-1394.630) (-1399.033) (-1392.882) * [-1390.875] (-1396.553) (-1392.540) (-1393.898) -- 0:01:58
427500 -- [-1392.323] (-1393.369) (-1400.857) (-1400.074) * [-1394.547] (-1396.748) (-1391.267) (-1393.490) -- 0:01:57
428000 -- (-1392.204) (-1409.070) [-1395.065] (-1395.615) * (-1393.245) (-1395.639) (-1391.795) [-1397.685] -- 0:01:57
428500 -- [-1391.761] (-1393.780) (-1398.208) (-1401.781) * (-1390.718) (-1405.468) (-1391.685) [-1394.169] -- 0:01:57
429000 -- [-1392.205] (-1392.073) (-1397.683) (-1396.869) * [-1388.817] (-1400.370) (-1397.622) (-1397.888) -- 0:01:57
429500 -- (-1392.838) [-1398.494] (-1386.933) (-1393.741) * (-1396.208) [-1399.239] (-1392.676) (-1397.978) -- 0:01:56
430000 -- (-1390.112) (-1404.887) [-1389.644] (-1396.551) * [-1389.133] (-1407.711) (-1398.952) (-1395.983) -- 0:01:56
Average standard deviation of split frequencies: 0.007662
430500 -- (-1393.958) [-1397.345] (-1391.429) (-1394.937) * (-1392.125) (-1398.214) (-1392.832) [-1396.002] -- 0:01:56
431000 -- [-1392.514] (-1397.123) (-1394.167) (-1396.493) * (-1390.904) (-1399.163) [-1385.358] (-1394.370) -- 0:01:57
431500 -- (-1395.697) [-1394.227] (-1393.179) (-1396.371) * (-1389.692) [-1396.563] (-1398.455) (-1394.095) -- 0:01:57
432000 -- (-1396.296) (-1392.356) (-1395.969) [-1392.318] * [-1389.497] (-1393.489) (-1396.994) (-1409.412) -- 0:01:57
432500 -- (-1400.369) (-1400.324) (-1402.868) [-1399.085] * (-1394.417) (-1402.347) [-1394.402] (-1388.712) -- 0:01:56
433000 -- (-1402.943) (-1396.340) [-1391.537] (-1401.817) * (-1390.402) (-1390.304) (-1391.197) [-1400.951] -- 0:01:56
433500 -- [-1394.177] (-1390.447) (-1390.785) (-1398.552) * (-1396.354) [-1392.136] (-1398.763) (-1396.154) -- 0:01:56
434000 -- (-1398.945) [-1387.058] (-1390.994) (-1399.305) * [-1391.891] (-1403.520) (-1397.472) (-1386.472) -- 0:01:56
434500 -- [-1396.419] (-1393.564) (-1396.167) (-1393.501) * (-1396.934) [-1393.357] (-1393.258) (-1396.877) -- 0:01:55
435000 -- (-1397.427) [-1391.271] (-1393.829) (-1398.046) * (-1397.178) (-1395.667) [-1391.573] (-1388.240) -- 0:01:55
Average standard deviation of split frequencies: 0.007028
435500 -- (-1398.773) [-1389.482] (-1394.134) (-1393.555) * (-1390.001) [-1393.462] (-1394.006) (-1387.205) -- 0:01:55
436000 -- (-1398.057) [-1388.279] (-1395.211) (-1398.929) * (-1392.864) (-1401.598) (-1393.282) [-1394.463] -- 0:01:56
436500 -- [-1392.749] (-1390.473) (-1406.033) (-1397.593) * (-1403.491) (-1391.919) [-1384.931] (-1400.636) -- 0:01:56
437000 -- (-1398.762) [-1391.319] (-1393.203) (-1405.272) * [-1393.182] (-1393.164) (-1390.603) (-1390.182) -- 0:01:55
437500 -- (-1387.223) (-1397.457) (-1391.244) [-1397.028] * (-1394.775) (-1399.776) [-1392.735] (-1394.152) -- 0:01:55
438000 -- (-1401.726) [-1399.362] (-1392.137) (-1394.319) * [-1396.673] (-1398.977) (-1394.114) (-1394.237) -- 0:01:55
438500 -- (-1408.117) [-1397.650] (-1394.001) (-1391.106) * (-1394.075) (-1393.493) [-1387.991] (-1395.830) -- 0:01:55
439000 -- (-1405.722) (-1400.905) (-1395.041) [-1391.196] * (-1390.976) (-1393.850) (-1396.493) [-1392.078] -- 0:01:55
439500 -- (-1402.924) [-1391.672] (-1392.625) (-1407.361) * [-1398.361] (-1392.279) (-1403.822) (-1392.420) -- 0:01:54
440000 -- (-1410.822) [-1391.303] (-1393.797) (-1395.794) * (-1396.190) (-1391.253) [-1390.711] (-1392.711) -- 0:01:54
Average standard deviation of split frequencies: 0.005527
440500 -- (-1394.817) (-1398.331) [-1394.836] (-1398.588) * (-1397.233) (-1395.304) (-1388.633) [-1397.335] -- 0:01:55
441000 -- (-1400.150) (-1388.284) [-1393.442] (-1394.660) * (-1395.235) (-1393.220) [-1391.894] (-1394.224) -- 0:01:55
441500 -- (-1399.766) [-1388.660] (-1403.867) (-1395.377) * (-1388.781) (-1393.269) [-1389.840] (-1399.645) -- 0:01:55
442000 -- (-1396.038) (-1393.885) (-1390.793) [-1391.518] * (-1392.151) (-1392.350) (-1392.593) [-1395.607] -- 0:01:54
442500 -- [-1395.693] (-1394.867) (-1398.354) (-1396.145) * (-1394.994) (-1392.669) [-1391.584] (-1391.001) -- 0:01:54
443000 -- (-1402.229) [-1394.978] (-1393.693) (-1398.188) * (-1394.106) [-1391.146] (-1395.572) (-1393.013) -- 0:01:54
443500 -- (-1396.918) [-1392.868] (-1401.070) (-1396.150) * [-1391.764] (-1388.364) (-1387.892) (-1390.720) -- 0:01:54
444000 -- (-1392.228) (-1405.706) [-1391.221] (-1396.737) * (-1394.229) (-1398.915) (-1391.259) [-1396.304] -- 0:01:53
444500 -- (-1392.771) (-1400.011) [-1389.875] (-1398.207) * (-1399.016) (-1412.947) (-1387.963) [-1389.329] -- 0:01:53
445000 -- (-1397.266) (-1400.084) [-1391.932] (-1402.337) * [-1395.410] (-1395.847) (-1391.586) (-1388.002) -- 0:01:54
Average standard deviation of split frequencies: 0.006870
445500 -- (-1399.297) [-1391.026] (-1395.722) (-1394.382) * (-1398.724) (-1404.623) (-1394.277) [-1389.673] -- 0:01:54
446000 -- [-1396.741] (-1391.567) (-1391.244) (-1394.039) * (-1397.105) [-1391.512] (-1400.588) (-1396.044) -- 0:01:54
446500 -- (-1393.669) (-1394.609) [-1390.827] (-1398.784) * (-1397.849) (-1404.489) (-1396.061) [-1390.002] -- 0:01:54
447000 -- (-1393.804) (-1396.201) (-1390.981) [-1391.790] * [-1392.714] (-1392.047) (-1402.524) (-1397.702) -- 0:01:53
447500 -- (-1394.576) (-1391.313) [-1396.951] (-1404.246) * (-1388.447) [-1393.242] (-1391.393) (-1392.182) -- 0:01:53
448000 -- (-1396.361) (-1397.678) (-1396.251) [-1398.896] * (-1393.981) [-1393.063] (-1400.482) (-1397.443) -- 0:01:53
448500 -- [-1390.366] (-1401.254) (-1404.196) (-1395.015) * (-1394.958) (-1396.270) [-1392.696] (-1394.077) -- 0:01:53
449000 -- (-1402.205) (-1391.317) (-1391.015) [-1396.473] * (-1395.976) (-1399.513) [-1393.846] (-1394.411) -- 0:01:52
449500 -- (-1402.406) (-1392.388) (-1403.109) [-1391.422] * [-1397.429] (-1401.781) (-1396.138) (-1397.412) -- 0:01:52
450000 -- (-1404.259) (-1392.308) [-1386.377] (-1394.957) * (-1387.925) [-1391.442] (-1395.524) (-1386.625) -- 0:01:53
Average standard deviation of split frequencies: 0.005753
450500 -- (-1398.458) [-1389.805] (-1391.188) (-1393.017) * (-1400.435) (-1397.934) (-1398.276) [-1389.426] -- 0:01:53
451000 -- [-1392.249] (-1396.712) (-1396.267) (-1404.583) * (-1400.149) [-1398.203] (-1394.315) (-1394.243) -- 0:01:53
451500 -- (-1399.631) [-1394.324] (-1400.367) (-1387.454) * [-1387.588] (-1402.273) (-1390.947) (-1388.259) -- 0:01:52
452000 -- (-1398.473) (-1392.652) [-1394.836] (-1402.091) * (-1390.462) [-1393.821] (-1390.530) (-1394.914) -- 0:01:52
452500 -- (-1389.189) (-1392.731) [-1393.269] (-1391.962) * (-1391.980) (-1401.249) [-1400.376] (-1389.254) -- 0:01:52
453000 -- [-1393.013] (-1393.265) (-1394.504) (-1393.097) * (-1394.326) (-1397.124) (-1394.543) [-1393.044] -- 0:01:52
453500 -- (-1395.221) [-1390.375] (-1396.138) (-1398.408) * [-1389.449] (-1390.576) (-1394.724) (-1394.253) -- 0:01:52
454000 -- (-1401.005) (-1394.601) (-1397.827) [-1392.444] * [-1391.190] (-1393.595) (-1397.383) (-1391.983) -- 0:01:51
454500 -- [-1392.894] (-1392.986) (-1394.404) (-1397.947) * (-1396.522) [-1389.540] (-1395.724) (-1399.838) -- 0:01:51
455000 -- [-1392.109] (-1394.039) (-1398.291) (-1392.253) * [-1392.381] (-1388.488) (-1413.475) (-1392.373) -- 0:01:52
Average standard deviation of split frequencies: 0.006030
455500 -- (-1398.173) [-1392.801] (-1401.837) (-1397.400) * (-1393.386) (-1390.505) [-1390.113] (-1398.202) -- 0:01:52
456000 -- (-1395.369) (-1387.690) (-1393.991) [-1396.410] * [-1394.026] (-1395.695) (-1395.682) (-1401.417) -- 0:01:52
456500 -- (-1399.049) (-1394.087) [-1399.218] (-1395.432) * (-1397.042) (-1392.685) [-1393.689] (-1398.345) -- 0:01:51
457000 -- (-1395.247) (-1413.845) [-1391.978] (-1393.573) * (-1403.188) [-1391.575] (-1396.731) (-1394.625) -- 0:01:51
457500 -- [-1393.823] (-1398.709) (-1390.727) (-1390.377) * [-1389.754] (-1390.495) (-1392.947) (-1392.567) -- 0:01:51
458000 -- (-1393.845) (-1392.125) (-1391.044) [-1393.431] * (-1390.308) (-1395.883) [-1389.859] (-1393.417) -- 0:01:51
458500 -- (-1397.872) [-1392.267] (-1391.104) (-1391.352) * (-1395.272) [-1396.570] (-1398.105) (-1390.327) -- 0:01:51
459000 -- (-1390.869) (-1402.683) (-1390.574) [-1397.294] * (-1393.203) [-1391.220] (-1396.688) (-1394.036) -- 0:01:50
459500 -- (-1389.598) (-1403.902) [-1394.100] (-1402.023) * [-1389.342] (-1395.313) (-1402.453) (-1388.704) -- 0:01:50
460000 -- (-1392.584) (-1397.245) (-1400.784) [-1391.265] * (-1397.466) (-1402.568) (-1397.242) [-1391.364] -- 0:01:51
Average standard deviation of split frequencies: 0.008016
460500 -- (-1399.282) (-1396.097) (-1392.278) [-1394.830] * (-1390.681) (-1395.166) [-1397.702] (-1410.923) -- 0:01:51
461000 -- (-1401.626) (-1393.317) [-1395.067] (-1392.640) * (-1396.944) (-1404.567) [-1395.523] (-1401.769) -- 0:01:51
461500 -- (-1404.847) [-1391.160] (-1390.764) (-1392.340) * (-1393.205) (-1395.031) [-1389.262] (-1395.572) -- 0:01:50
462000 -- (-1401.760) (-1390.660) (-1393.230) [-1392.881] * [-1391.758] (-1403.544) (-1390.332) (-1394.445) -- 0:01:50
462500 -- (-1401.860) (-1396.334) [-1394.463] (-1392.792) * (-1397.892) [-1390.516] (-1389.701) (-1393.877) -- 0:01:50
463000 -- (-1395.868) (-1399.942) [-1395.691] (-1391.892) * (-1395.316) (-1392.062) (-1388.651) [-1399.261] -- 0:01:50
463500 -- [-1386.401] (-1390.650) (-1401.550) (-1393.961) * (-1393.803) [-1392.316] (-1400.933) (-1398.685) -- 0:01:49
464000 -- [-1389.094] (-1391.385) (-1398.066) (-1395.081) * (-1390.713) (-1396.004) (-1398.615) [-1392.596] -- 0:01:49
464500 -- [-1395.481] (-1397.117) (-1394.601) (-1403.480) * (-1396.332) (-1396.643) [-1390.299] (-1397.705) -- 0:01:49
465000 -- (-1396.379) (-1390.575) (-1388.872) [-1398.369] * (-1390.283) [-1394.824] (-1392.525) (-1401.119) -- 0:01:50
Average standard deviation of split frequencies: 0.007250
465500 -- [-1388.452] (-1391.620) (-1393.370) (-1398.645) * [-1392.101] (-1392.774) (-1399.726) (-1397.716) -- 0:01:50
466000 -- [-1393.091] (-1399.647) (-1394.186) (-1395.336) * [-1398.927] (-1396.322) (-1399.344) (-1400.606) -- 0:01:50
466500 -- [-1398.225] (-1401.119) (-1394.028) (-1401.119) * (-1405.685) [-1394.770] (-1389.189) (-1389.984) -- 0:01:49
467000 -- (-1397.362) [-1390.568] (-1393.315) (-1395.107) * (-1391.446) [-1394.650] (-1396.956) (-1403.506) -- 0:01:49
467500 -- [-1396.854] (-1391.968) (-1392.600) (-1408.610) * [-1395.662] (-1396.029) (-1397.052) (-1396.682) -- 0:01:49
468000 -- (-1398.039) (-1389.080) [-1390.826] (-1397.217) * (-1392.420) [-1397.227] (-1401.158) (-1389.217) -- 0:01:49
468500 -- (-1404.584) [-1390.325] (-1395.316) (-1402.203) * (-1394.786) (-1394.835) [-1396.234] (-1393.153) -- 0:01:48
469000 -- [-1394.432] (-1396.440) (-1393.120) (-1406.645) * (-1398.944) (-1391.141) [-1393.803] (-1391.034) -- 0:01:48
469500 -- [-1393.933] (-1396.756) (-1393.620) (-1400.054) * [-1399.605] (-1394.924) (-1391.194) (-1397.540) -- 0:01:48
470000 -- (-1396.616) [-1397.054] (-1393.549) (-1402.725) * (-1395.890) (-1395.138) [-1396.128] (-1395.003) -- 0:01:49
Average standard deviation of split frequencies: 0.008847
470500 -- (-1393.150) (-1392.354) [-1389.142] (-1402.397) * (-1397.081) (-1399.299) [-1397.899] (-1395.947) -- 0:01:49
471000 -- [-1388.093] (-1397.137) (-1394.751) (-1399.427) * (-1393.265) (-1398.394) (-1394.285) [-1391.993] -- 0:01:48
471500 -- (-1393.026) (-1392.125) (-1393.727) [-1390.696] * (-1399.403) (-1400.764) [-1391.900] (-1399.730) -- 0:01:48
472000 -- (-1397.843) (-1396.758) [-1405.288] (-1393.966) * [-1393.257] (-1396.458) (-1389.668) (-1398.722) -- 0:01:48
472500 -- (-1393.488) [-1395.482] (-1395.539) (-1397.356) * [-1391.831] (-1388.272) (-1399.106) (-1401.366) -- 0:01:48
473000 -- (-1393.241) (-1397.284) [-1395.613] (-1397.559) * (-1391.707) [-1394.090] (-1393.770) (-1411.606) -- 0:01:48
473500 -- [-1391.462] (-1391.708) (-1391.944) (-1402.865) * (-1393.612) [-1390.557] (-1404.499) (-1395.976) -- 0:01:47
474000 -- (-1396.391) (-1392.426) (-1398.826) [-1385.504] * (-1392.603) (-1392.925) (-1393.449) [-1396.108] -- 0:01:47
474500 -- (-1397.194) (-1397.214) (-1394.957) [-1390.139] * (-1393.821) [-1393.772] (-1397.905) (-1391.602) -- 0:01:47
475000 -- [-1400.575] (-1393.441) (-1391.448) (-1401.091) * (-1389.119) (-1399.731) (-1397.761) [-1388.092] -- 0:01:48
Average standard deviation of split frequencies: 0.008418
475500 -- (-1390.946) (-1396.869) [-1393.965] (-1397.121) * (-1397.066) (-1393.722) [-1394.068] (-1396.542) -- 0:01:48
476000 -- (-1390.246) (-1395.362) [-1393.973] (-1394.810) * (-1393.933) [-1390.967] (-1389.634) (-1394.080) -- 0:01:47
476500 -- (-1393.432) (-1393.482) [-1393.792] (-1390.858) * (-1392.455) (-1399.533) [-1389.970] (-1389.614) -- 0:01:47
477000 -- [-1390.198] (-1394.245) (-1393.289) (-1390.940) * (-1396.461) [-1396.153] (-1390.998) (-1398.334) -- 0:01:47
477500 -- [-1399.203] (-1394.761) (-1400.714) (-1391.413) * [-1387.210] (-1398.426) (-1395.997) (-1390.478) -- 0:01:47
478000 -- (-1390.123) (-1395.675) [-1390.707] (-1395.084) * (-1395.878) (-1390.853) (-1395.253) [-1392.243] -- 0:01:47
478500 -- (-1399.272) [-1389.665] (-1395.519) (-1396.192) * [-1395.412] (-1391.607) (-1392.589) (-1399.157) -- 0:01:46
479000 -- (-1402.604) (-1400.765) [-1392.648] (-1396.913) * (-1402.371) [-1392.264] (-1390.397) (-1388.176) -- 0:01:46
479500 -- [-1390.756] (-1390.443) (-1392.518) (-1408.637) * (-1399.541) (-1395.557) (-1394.061) [-1391.542] -- 0:01:46
480000 -- (-1399.713) (-1391.856) [-1388.696] (-1395.386) * [-1395.309] (-1393.665) (-1398.019) (-1392.314) -- 0:01:47
Average standard deviation of split frequencies: 0.008009
480500 -- [-1391.453] (-1397.440) (-1401.925) (-1398.262) * [-1394.123] (-1399.433) (-1399.254) (-1390.575) -- 0:01:47
481000 -- [-1394.332] (-1395.355) (-1388.124) (-1391.397) * [-1398.211] (-1396.477) (-1399.102) (-1395.414) -- 0:01:46
481500 -- (-1394.446) (-1400.051) (-1388.687) [-1391.662] * (-1399.415) [-1386.013] (-1401.929) (-1390.086) -- 0:01:46
482000 -- [-1398.993] (-1402.385) (-1410.679) (-1394.182) * (-1395.080) (-1397.213) [-1394.111] (-1399.000) -- 0:01:46
482500 -- (-1389.647) (-1395.396) [-1388.856] (-1394.421) * (-1393.794) (-1396.332) [-1388.482] (-1402.404) -- 0:01:46
483000 -- [-1389.677] (-1390.355) (-1392.419) (-1405.459) * [-1397.114] (-1399.777) (-1392.191) (-1394.125) -- 0:01:45
483500 -- (-1390.475) (-1396.207) [-1394.003] (-1396.819) * (-1399.227) (-1400.452) (-1393.988) [-1399.972] -- 0:01:45
484000 -- [-1396.951] (-1392.102) (-1392.714) (-1397.836) * (-1396.480) (-1393.446) [-1393.072] (-1393.041) -- 0:01:45
484500 -- (-1397.478) (-1395.317) (-1391.480) [-1389.622] * (-1398.995) (-1387.887) (-1393.662) [-1398.367] -- 0:01:45
485000 -- (-1395.533) (-1392.592) [-1395.840] (-1393.815) * [-1391.734] (-1396.455) (-1395.453) (-1395.632) -- 0:01:46
Average standard deviation of split frequencies: 0.008568
485500 -- (-1396.405) (-1394.624) [-1397.579] (-1396.999) * (-1393.475) [-1394.275] (-1395.291) (-1397.404) -- 0:01:45
486000 -- [-1387.896] (-1390.363) (-1397.868) (-1400.800) * (-1393.249) [-1391.436] (-1389.467) (-1399.172) -- 0:01:45
486500 -- (-1397.679) [-1388.768] (-1392.333) (-1395.951) * (-1399.658) (-1388.507) (-1394.851) [-1393.836] -- 0:01:45
487000 -- (-1396.490) (-1392.093) (-1397.057) [-1389.187] * (-1398.650) [-1393.935] (-1394.554) (-1392.146) -- 0:01:45
487500 -- (-1396.229) (-1396.890) (-1395.477) [-1393.394] * (-1399.675) [-1389.248] (-1396.652) (-1407.332) -- 0:01:45
488000 -- (-1394.913) [-1394.050] (-1397.783) (-1398.690) * (-1405.972) [-1388.483] (-1397.015) (-1393.899) -- 0:01:44
488500 -- [-1393.821] (-1395.216) (-1397.584) (-1395.716) * (-1393.466) (-1394.380) [-1390.630] (-1395.134) -- 0:01:44
489000 -- (-1403.521) [-1394.178] (-1396.574) (-1400.360) * (-1387.310) (-1396.588) (-1390.407) [-1389.140] -- 0:01:44
489500 -- (-1400.594) (-1391.485) [-1395.000] (-1394.786) * (-1397.036) (-1397.331) (-1390.208) [-1399.067] -- 0:01:44
490000 -- [-1397.236] (-1408.510) (-1395.534) (-1394.672) * (-1396.279) (-1400.344) [-1396.471] (-1399.743) -- 0:01:45
Average standard deviation of split frequencies: 0.008487
490500 -- (-1390.862) (-1403.960) [-1387.907] (-1397.787) * (-1393.148) (-1396.556) [-1391.305] (-1405.510) -- 0:01:44
491000 -- [-1395.803] (-1399.456) (-1399.122) (-1392.083) * (-1402.000) (-1408.909) (-1392.936) [-1399.325] -- 0:01:44
491500 -- [-1403.400] (-1402.406) (-1395.773) (-1389.986) * (-1399.695) (-1393.204) (-1394.971) [-1397.786] -- 0:01:44
492000 -- (-1398.456) [-1390.639] (-1403.380) (-1396.181) * [-1398.309] (-1399.199) (-1397.546) (-1394.625) -- 0:01:44
492500 -- (-1392.198) [-1391.357] (-1393.956) (-1399.601) * (-1400.044) [-1393.526] (-1390.114) (-1402.422) -- 0:01:44
493000 -- (-1396.165) (-1395.930) (-1394.742) [-1395.873] * (-1392.969) (-1392.724) (-1398.035) [-1398.139] -- 0:01:43
493500 -- (-1390.349) (-1395.186) (-1390.840) [-1390.504] * (-1398.820) (-1401.227) [-1399.115] (-1392.585) -- 0:01:43
494000 -- [-1387.805] (-1392.976) (-1391.892) (-1394.703) * (-1398.543) (-1392.952) [-1394.438] (-1388.250) -- 0:01:43
494500 -- [-1396.974] (-1398.357) (-1401.088) (-1400.325) * (-1391.655) [-1392.011] (-1400.506) (-1396.163) -- 0:01:43
495000 -- [-1395.598] (-1396.237) (-1389.013) (-1394.519) * [-1392.209] (-1397.521) (-1397.346) (-1390.017) -- 0:01:44
Average standard deviation of split frequencies: 0.008712
495500 -- (-1394.406) (-1393.672) (-1400.529) [-1393.435] * (-1403.348) [-1397.211] (-1392.165) (-1398.343) -- 0:01:43
496000 -- (-1391.896) [-1389.512] (-1400.081) (-1397.629) * [-1392.145] (-1395.113) (-1392.899) (-1400.839) -- 0:01:43
496500 -- (-1391.943) [-1390.773] (-1401.757) (-1395.863) * [-1407.128] (-1402.604) (-1390.437) (-1398.705) -- 0:01:43
497000 -- (-1394.068) (-1394.651) (-1394.424) [-1399.114] * [-1392.908] (-1397.356) (-1403.720) (-1396.364) -- 0:01:43
497500 -- [-1391.973] (-1401.118) (-1390.238) (-1398.330) * (-1396.486) (-1396.669) (-1390.851) [-1394.997] -- 0:01:43
498000 -- (-1392.683) (-1395.656) (-1396.361) [-1395.665] * [-1391.885] (-1395.513) (-1396.652) (-1389.808) -- 0:01:42
498500 -- (-1394.115) (-1400.130) [-1390.482] (-1391.559) * (-1392.016) (-1397.764) [-1393.550] (-1392.030) -- 0:01:42
499000 -- (-1394.888) (-1392.306) (-1401.035) [-1396.772] * (-1395.779) (-1390.407) [-1388.331] (-1391.151) -- 0:01:42
499500 -- (-1392.317) [-1389.040] (-1396.962) (-1391.741) * [-1392.382] (-1401.834) (-1391.947) (-1392.335) -- 0:01:42
500000 -- [-1395.014] (-1395.022) (-1398.417) (-1393.353) * [-1399.745] (-1396.592) (-1396.141) (-1404.411) -- 0:01:43
Average standard deviation of split frequencies: 0.008631
500500 -- [-1390.702] (-1397.932) (-1403.809) (-1394.001) * [-1392.025] (-1391.638) (-1395.465) (-1397.827) -- 0:01:42
501000 -- [-1398.414] (-1396.980) (-1405.750) (-1395.268) * (-1395.118) (-1395.180) (-1393.216) [-1394.105] -- 0:01:42
501500 -- (-1396.132) [-1392.417] (-1391.627) (-1392.791) * [-1393.873] (-1393.555) (-1392.270) (-1398.262) -- 0:01:42
502000 -- (-1398.092) [-1393.285] (-1400.124) (-1403.202) * (-1399.566) (-1395.021) (-1389.689) [-1392.323] -- 0:01:42
502500 -- [-1390.922] (-1398.910) (-1395.707) (-1393.999) * (-1393.356) (-1388.658) (-1388.616) [-1393.988] -- 0:01:41
503000 -- [-1391.885] (-1405.222) (-1400.780) (-1410.491) * (-1395.837) (-1389.798) (-1392.277) [-1396.049] -- 0:01:41
503500 -- (-1396.188) [-1391.992] (-1396.736) (-1403.977) * (-1400.760) (-1394.501) [-1394.275] (-1396.771) -- 0:01:41
504000 -- (-1390.703) (-1391.937) [-1396.758] (-1409.838) * (-1390.764) (-1398.752) (-1396.298) [-1391.722] -- 0:01:41
504500 -- (-1401.005) [-1399.079] (-1399.381) (-1405.686) * [-1392.994] (-1388.773) (-1400.372) (-1395.074) -- 0:01:41
505000 -- (-1395.808) (-1401.115) (-1398.143) [-1398.560] * (-1400.200) (-1397.681) [-1399.637] (-1390.929) -- 0:01:41
Average standard deviation of split frequencies: 0.009161
505500 -- (-1402.058) (-1394.346) [-1397.145] (-1407.154) * (-1394.820) [-1398.372] (-1399.454) (-1398.082) -- 0:01:41
506000 -- (-1398.939) (-1401.029) [-1389.345] (-1405.453) * [-1398.666] (-1396.903) (-1396.792) (-1393.348) -- 0:01:41
506500 -- [-1393.067] (-1407.655) (-1394.358) (-1392.982) * (-1393.304) (-1394.179) [-1389.956] (-1394.010) -- 0:01:41
507000 -- (-1395.693) (-1404.411) [-1395.154] (-1397.143) * (-1394.268) [-1389.839] (-1400.407) (-1404.008) -- 0:01:41
507500 -- (-1393.965) (-1401.395) [-1389.979] (-1393.034) * [-1398.862] (-1399.476) (-1397.442) (-1391.451) -- 0:01:40
508000 -- [-1391.284] (-1397.764) (-1390.082) (-1390.303) * (-1390.896) [-1393.377] (-1398.370) (-1394.398) -- 0:01:40
508500 -- (-1398.014) (-1394.924) (-1398.156) [-1388.512] * (-1396.843) [-1386.800] (-1393.097) (-1396.304) -- 0:01:40
509000 -- (-1403.213) (-1395.319) [-1394.177] (-1395.940) * (-1393.437) [-1400.629] (-1388.292) (-1393.082) -- 0:01:40
509500 -- (-1395.343) (-1397.052) (-1395.105) [-1390.474] * (-1401.467) [-1391.717] (-1396.298) (-1389.563) -- 0:01:40
510000 -- [-1392.317] (-1394.785) (-1397.693) (-1398.657) * (-1392.288) (-1392.026) [-1388.841] (-1396.243) -- 0:01:40
Average standard deviation of split frequencies: 0.009077
510500 -- (-1391.016) (-1397.128) [-1392.696] (-1393.760) * (-1398.729) (-1403.319) (-1395.514) [-1398.412] -- 0:01:40
511000 -- (-1392.345) (-1397.817) (-1394.180) [-1394.435] * (-1397.539) [-1394.952] (-1395.847) (-1390.761) -- 0:01:40
511500 -- (-1401.019) [-1392.771] (-1393.420) (-1397.568) * (-1395.277) (-1394.968) (-1394.129) [-1394.319] -- 0:01:40
512000 -- (-1397.324) (-1402.711) (-1398.441) [-1398.439] * (-1398.546) [-1392.793] (-1390.977) (-1395.614) -- 0:01:40
512500 -- (-1400.464) (-1390.868) [-1395.922] (-1405.540) * (-1390.123) (-1390.052) (-1397.837) [-1393.682] -- 0:01:39
513000 -- (-1395.455) (-1394.073) [-1393.960] (-1395.602) * (-1392.007) (-1391.162) (-1393.852) [-1389.701] -- 0:01:39
513500 -- (-1391.119) (-1395.225) [-1393.339] (-1394.210) * (-1395.061) (-1398.666) (-1394.648) [-1390.528] -- 0:01:39
514000 -- [-1401.730] (-1392.428) (-1403.906) (-1401.444) * (-1399.868) [-1392.695] (-1394.210) (-1397.444) -- 0:01:39
514500 -- (-1402.358) (-1389.997) [-1394.736] (-1401.916) * [-1389.791] (-1392.196) (-1395.117) (-1397.118) -- 0:01:39
515000 -- (-1399.107) [-1394.237] (-1387.622) (-1396.747) * (-1390.159) (-1387.994) [-1396.498] (-1398.034) -- 0:01:39
Average standard deviation of split frequencies: 0.009288
515500 -- (-1399.637) [-1402.008] (-1395.189) (-1406.659) * [-1394.153] (-1393.027) (-1389.679) (-1400.341) -- 0:01:39
516000 -- (-1392.131) (-1406.239) [-1390.535] (-1392.559) * (-1398.068) (-1392.831) (-1401.133) [-1385.991] -- 0:01:39
516500 -- (-1396.325) (-1401.724) [-1398.521] (-1403.966) * [-1393.165] (-1390.065) (-1395.003) (-1390.499) -- 0:01:39
517000 -- (-1389.489) (-1399.826) [-1396.956] (-1401.621) * (-1392.795) (-1405.543) [-1392.967] (-1394.360) -- 0:01:39
517500 -- (-1397.308) [-1397.956] (-1389.125) (-1398.879) * (-1394.379) [-1393.628] (-1389.338) (-1391.254) -- 0:01:38
518000 -- [-1395.301] (-1399.749) (-1395.570) (-1405.624) * (-1396.961) (-1398.869) [-1400.039] (-1406.295) -- 0:01:38
518500 -- (-1401.261) (-1404.613) (-1393.998) [-1390.689] * (-1391.360) (-1399.309) [-1391.529] (-1404.211) -- 0:01:38
519000 -- (-1400.901) (-1398.829) [-1395.360] (-1389.742) * [-1393.471] (-1397.699) (-1395.480) (-1395.677) -- 0:01:38
519500 -- (-1404.996) (-1393.332) [-1392.905] (-1396.594) * (-1394.067) (-1397.774) (-1400.916) [-1389.836] -- 0:01:38
520000 -- (-1397.516) [-1397.291] (-1390.306) (-1407.007) * [-1394.846] (-1396.845) (-1399.685) (-1385.648) -- 0:01:38
Average standard deviation of split frequencies: 0.009507
520500 -- (-1392.358) (-1399.722) (-1394.098) [-1391.234] * (-1395.467) (-1394.238) [-1396.525] (-1396.327) -- 0:01:38
521000 -- (-1389.659) (-1401.528) [-1393.801] (-1397.691) * (-1394.705) (-1403.034) (-1390.480) [-1392.671] -- 0:01:38
521500 -- (-1390.478) (-1396.633) (-1402.211) [-1395.819] * (-1393.161) [-1393.970] (-1396.801) (-1396.098) -- 0:01:38
522000 -- (-1395.593) (-1400.017) [-1395.442] (-1394.748) * (-1394.166) [-1394.387] (-1394.631) (-1394.909) -- 0:01:37
522500 -- (-1402.211) [-1393.429] (-1394.992) (-1396.102) * (-1397.044) (-1389.439) [-1395.949] (-1403.345) -- 0:01:37
523000 -- (-1394.499) (-1398.704) (-1401.549) [-1398.947] * [-1394.527] (-1391.021) (-1395.059) (-1388.965) -- 0:01:37
523500 -- [-1393.527] (-1399.373) (-1391.292) (-1396.932) * (-1393.072) (-1395.274) (-1391.512) [-1393.962] -- 0:01:37
524000 -- (-1402.619) (-1400.513) [-1392.161] (-1390.703) * (-1392.850) (-1395.172) [-1397.921] (-1400.739) -- 0:01:37
524500 -- [-1397.935] (-1398.179) (-1391.112) (-1392.426) * (-1392.673) (-1398.140) (-1402.003) [-1389.988] -- 0:01:37
525000 -- (-1388.456) (-1395.038) (-1389.771) [-1388.779] * (-1402.476) (-1391.712) (-1403.727) [-1395.884] -- 0:01:37
Average standard deviation of split frequencies: 0.009111
525500 -- [-1392.641] (-1399.461) (-1391.357) (-1393.072) * (-1399.541) (-1394.332) [-1393.230] (-1394.615) -- 0:01:37
526000 -- (-1390.202) [-1394.675] (-1393.012) (-1392.271) * (-1402.672) (-1394.454) [-1391.877] (-1391.597) -- 0:01:37
526500 -- [-1389.761] (-1399.328) (-1386.904) (-1402.375) * (-1403.915) (-1393.249) [-1404.564] (-1391.601) -- 0:01:37
527000 -- [-1394.913] (-1392.172) (-1402.533) (-1399.172) * (-1393.290) (-1387.560) (-1403.561) [-1387.775] -- 0:01:36
527500 -- (-1396.810) (-1390.518) (-1394.144) [-1394.878] * [-1394.743] (-1390.848) (-1396.829) (-1395.056) -- 0:01:36
528000 -- (-1394.148) (-1393.577) [-1388.698] (-1391.762) * [-1394.226] (-1393.021) (-1400.568) (-1392.727) -- 0:01:36
528500 -- [-1391.999] (-1399.167) (-1393.495) (-1396.406) * (-1401.394) [-1392.510] (-1390.537) (-1400.504) -- 0:01:36
529000 -- (-1396.134) [-1392.175] (-1402.036) (-1401.488) * (-1390.566) (-1394.461) [-1391.983] (-1397.354) -- 0:01:36
529500 -- (-1400.235) [-1391.157] (-1397.234) (-1402.315) * (-1390.482) [-1390.240] (-1395.449) (-1394.938) -- 0:01:35
530000 -- (-1391.041) (-1395.403) [-1391.431] (-1403.819) * (-1399.537) [-1390.245] (-1398.998) (-1396.666) -- 0:01:36
Average standard deviation of split frequencies: 0.008735
530500 -- (-1396.202) (-1392.140) [-1394.720] (-1392.156) * [-1398.041] (-1390.431) (-1404.670) (-1398.704) -- 0:01:36
531000 -- [-1394.009] (-1396.147) (-1392.402) (-1402.175) * [-1387.451] (-1398.034) (-1391.451) (-1392.797) -- 0:01:36
531500 -- [-1398.014] (-1397.907) (-1392.655) (-1393.835) * (-1400.776) (-1399.957) [-1390.579] (-1396.658) -- 0:01:36
532000 -- (-1392.033) (-1392.829) (-1392.926) [-1397.739] * (-1389.497) (-1392.332) [-1396.922] (-1389.151) -- 0:01:35
532500 -- (-1400.482) (-1400.401) [-1394.479] (-1393.991) * [-1394.546] (-1394.194) (-1396.791) (-1392.079) -- 0:01:35
533000 -- (-1393.122) (-1398.852) [-1394.695] (-1391.709) * (-1399.241) (-1394.700) (-1398.483) [-1394.262] -- 0:01:35
533500 -- (-1389.104) [-1387.462] (-1395.796) (-1393.857) * (-1397.383) (-1395.700) (-1400.140) [-1390.572] -- 0:01:35
534000 -- [-1394.866] (-1390.835) (-1391.238) (-1400.445) * (-1401.627) [-1396.409] (-1400.096) (-1401.352) -- 0:01:35
534500 -- (-1393.848) [-1392.324] (-1393.252) (-1403.104) * [-1395.057] (-1394.955) (-1401.816) (-1394.012) -- 0:01:34
535000 -- (-1394.281) (-1392.715) [-1399.466] (-1396.693) * (-1393.959) (-1399.311) (-1397.058) [-1392.840] -- 0:01:35
Average standard deviation of split frequencies: 0.009088
535500 -- (-1395.160) (-1393.442) [-1397.032] (-1394.216) * (-1397.628) [-1388.949] (-1395.678) (-1391.096) -- 0:01:35
536000 -- [-1388.963] (-1400.935) (-1400.873) (-1397.078) * [-1394.211] (-1396.987) (-1394.728) (-1398.586) -- 0:01:35
536500 -- (-1397.469) (-1398.981) [-1389.352] (-1395.147) * [-1400.075] (-1395.467) (-1396.179) (-1393.287) -- 0:01:35
537000 -- [-1395.452] (-1402.492) (-1401.643) (-1395.410) * (-1391.017) (-1393.056) (-1395.626) [-1393.227] -- 0:01:34
537500 -- (-1398.980) (-1393.990) [-1387.420] (-1393.649) * (-1399.800) (-1394.619) (-1393.490) [-1396.252] -- 0:01:34
538000 -- (-1393.844) (-1391.914) (-1394.351) [-1387.758] * (-1397.822) (-1390.624) (-1398.241) [-1394.162] -- 0:01:34
538500 -- (-1392.179) (-1393.714) (-1393.718) [-1395.915] * (-1404.361) [-1405.003] (-1397.813) (-1406.376) -- 0:01:34
539000 -- (-1394.063) (-1388.455) (-1391.495) [-1392.443] * [-1393.765] (-1398.785) (-1399.128) (-1402.857) -- 0:01:34
539500 -- (-1388.543) (-1393.803) (-1396.062) [-1397.521] * (-1392.525) (-1398.321) (-1395.010) [-1393.139] -- 0:01:33
540000 -- (-1401.045) (-1392.161) [-1401.159] (-1397.838) * (-1397.152) [-1396.479] (-1398.146) (-1393.375) -- 0:01:34
Average standard deviation of split frequencies: 0.009010
540500 -- (-1403.022) (-1398.159) [-1396.013] (-1398.731) * (-1396.515) [-1395.460] (-1404.302) (-1392.550) -- 0:01:34
541000 -- (-1400.417) [-1391.022] (-1393.224) (-1392.671) * (-1400.845) [-1396.872] (-1390.526) (-1400.469) -- 0:01:34
541500 -- (-1392.071) (-1389.973) (-1395.257) [-1392.676] * (-1395.327) [-1394.493] (-1393.546) (-1394.905) -- 0:01:33
542000 -- [-1391.796] (-1388.542) (-1389.933) (-1397.351) * (-1395.441) (-1398.987) [-1393.486] (-1400.673) -- 0:01:33
542500 -- (-1395.404) [-1393.174] (-1390.047) (-1395.470) * [-1395.936] (-1392.346) (-1392.175) (-1399.370) -- 0:01:33
543000 -- [-1406.614] (-1402.434) (-1394.227) (-1397.456) * [-1392.467] (-1391.051) (-1388.575) (-1395.535) -- 0:01:33
543500 -- [-1389.524] (-1393.841) (-1401.479) (-1398.101) * [-1389.399] (-1397.844) (-1396.799) (-1399.304) -- 0:01:33
544000 -- [-1395.740] (-1397.879) (-1396.068) (-1398.777) * (-1391.928) [-1389.143] (-1396.136) (-1400.662) -- 0:01:33
544500 -- (-1397.361) (-1400.471) (-1395.534) [-1399.122] * (-1391.627) [-1389.488] (-1401.732) (-1394.307) -- 0:01:32
545000 -- (-1388.253) [-1390.487] (-1403.406) (-1405.605) * (-1398.728) (-1395.151) (-1406.533) [-1392.801] -- 0:01:33
Average standard deviation of split frequencies: 0.007195
545500 -- (-1396.194) (-1400.706) [-1404.491] (-1397.968) * (-1394.202) [-1391.325] (-1398.062) (-1400.114) -- 0:01:33
546000 -- (-1392.809) (-1394.873) [-1398.155] (-1399.265) * (-1395.085) (-1393.630) (-1400.967) [-1397.496] -- 0:01:33
546500 -- [-1389.507] (-1392.483) (-1396.000) (-1393.877) * (-1391.292) [-1391.794] (-1402.878) (-1394.707) -- 0:01:32
547000 -- (-1400.052) (-1391.564) (-1392.096) [-1388.135] * [-1392.436] (-1399.990) (-1396.175) (-1397.395) -- 0:01:32
547500 -- (-1398.973) [-1396.690] (-1394.584) (-1402.049) * (-1397.793) [-1393.714] (-1398.392) (-1393.302) -- 0:01:32
548000 -- [-1389.885] (-1395.594) (-1394.072) (-1393.217) * (-1396.310) (-1406.606) (-1398.341) [-1394.489] -- 0:01:32
548500 -- (-1399.604) (-1389.394) (-1399.790) [-1390.815] * [-1385.819] (-1399.332) (-1398.035) (-1401.099) -- 0:01:32
549000 -- (-1395.409) (-1395.466) [-1393.025] (-1399.944) * (-1397.610) [-1390.645] (-1395.579) (-1393.582) -- 0:01:32
549500 -- (-1403.992) [-1386.656] (-1388.454) (-1398.403) * (-1390.982) [-1391.034] (-1398.504) (-1392.507) -- 0:01:31
550000 -- (-1394.891) (-1390.436) (-1392.659) [-1390.933] * [-1391.083] (-1392.437) (-1405.335) (-1393.505) -- 0:01:32
Average standard deviation of split frequencies: 0.006848
550500 -- (-1398.632) (-1401.777) (-1390.105) [-1390.600] * (-1397.197) [-1391.857] (-1393.087) (-1393.181) -- 0:01:32
551000 -- [-1400.526] (-1395.138) (-1393.129) (-1386.479) * (-1396.787) (-1389.319) [-1397.706] (-1393.237) -- 0:01:32
551500 -- (-1394.812) (-1394.071) [-1399.992] (-1393.185) * (-1401.220) [-1388.065] (-1393.561) (-1389.841) -- 0:01:31
552000 -- (-1393.855) (-1391.732) [-1396.597] (-1399.833) * (-1400.157) (-1395.376) (-1394.256) [-1395.319] -- 0:01:31
552500 -- (-1393.146) (-1390.815) [-1395.491] (-1399.271) * (-1397.061) (-1397.390) (-1394.263) [-1389.258] -- 0:01:31
553000 -- (-1405.849) [-1394.666] (-1394.327) (-1392.914) * [-1393.827] (-1389.902) (-1402.928) (-1402.877) -- 0:01:31
553500 -- [-1392.335] (-1399.374) (-1397.487) (-1405.215) * (-1393.193) (-1390.061) [-1390.643] (-1401.343) -- 0:01:31
554000 -- [-1395.321] (-1392.188) (-1397.459) (-1397.578) * (-1393.010) (-1391.780) (-1402.376) [-1389.947] -- 0:01:30
554500 -- (-1394.602) [-1393.045] (-1398.692) (-1394.749) * (-1389.249) [-1391.549] (-1398.028) (-1390.781) -- 0:01:30
555000 -- (-1398.863) [-1394.941] (-1392.649) (-1395.079) * (-1395.393) [-1390.858] (-1401.580) (-1396.112) -- 0:01:31
Average standard deviation of split frequencies: 0.007207
555500 -- [-1396.457] (-1392.042) (-1394.976) (-1396.606) * (-1392.163) (-1408.663) [-1395.872] (-1391.091) -- 0:01:31
556000 -- [-1392.265] (-1392.800) (-1394.915) (-1397.752) * (-1395.393) (-1392.765) (-1398.020) [-1392.307] -- 0:01:31
556500 -- (-1396.919) [-1387.411] (-1404.383) (-1387.725) * (-1402.395) [-1393.467] (-1392.382) (-1394.415) -- 0:01:30
557000 -- (-1390.381) (-1396.606) (-1403.154) [-1396.129] * [-1393.677] (-1390.057) (-1396.328) (-1402.735) -- 0:01:30
557500 -- (-1388.017) [-1386.817] (-1405.786) (-1391.501) * (-1390.611) (-1392.296) (-1393.856) [-1391.642] -- 0:01:30
558000 -- (-1399.328) (-1396.862) [-1398.715] (-1393.137) * [-1392.896] (-1398.461) (-1400.902) (-1392.814) -- 0:01:30
558500 -- [-1394.017] (-1396.579) (-1392.571) (-1398.550) * (-1388.908) (-1397.865) [-1393.934] (-1392.029) -- 0:01:30
559000 -- (-1396.585) (-1401.248) (-1395.438) [-1396.178] * (-1394.512) (-1398.808) (-1393.581) [-1391.594] -- 0:01:29
559500 -- [-1402.894] (-1402.128) (-1391.093) (-1387.592) * (-1397.649) [-1400.983] (-1401.688) (-1391.033) -- 0:01:29
560000 -- (-1405.388) (-1394.791) [-1394.048] (-1396.360) * [-1392.593] (-1397.481) (-1397.152) (-1390.805) -- 0:01:30
Average standard deviation of split frequencies: 0.006866
560500 -- (-1388.556) [-1396.993] (-1388.159) (-1398.785) * (-1392.918) (-1400.632) [-1391.504] (-1395.921) -- 0:01:30
561000 -- (-1391.892) [-1394.530] (-1396.424) (-1399.984) * (-1393.627) (-1397.510) [-1396.953] (-1402.756) -- 0:01:29
561500 -- (-1394.716) (-1400.617) [-1391.260] (-1399.140) * (-1399.401) (-1403.639) [-1390.405] (-1400.664) -- 0:01:29
562000 -- (-1400.896) (-1395.791) [-1397.782] (-1400.428) * (-1394.659) (-1393.918) (-1401.233) [-1398.122] -- 0:01:29
562500 -- (-1395.386) (-1397.557) [-1399.721] (-1393.758) * (-1391.016) (-1395.589) (-1392.079) [-1395.034] -- 0:01:29
563000 -- (-1393.368) (-1394.705) [-1389.850] (-1405.664) * (-1391.812) [-1396.119] (-1401.976) (-1396.826) -- 0:01:29
563500 -- (-1404.717) (-1396.207) (-1393.424) [-1403.217] * (-1397.163) [-1407.772] (-1397.137) (-1391.869) -- 0:01:29
564000 -- (-1397.785) (-1393.707) [-1390.229] (-1400.695) * [-1390.258] (-1402.566) (-1394.486) (-1391.729) -- 0:01:29
564500 -- (-1395.785) (-1394.673) (-1391.786) [-1397.281] * [-1396.827] (-1394.720) (-1408.715) (-1394.031) -- 0:01:29
565000 -- (-1396.567) [-1391.421] (-1407.355) (-1396.575) * [-1390.193] (-1398.748) (-1394.023) (-1394.836) -- 0:01:29
Average standard deviation of split frequencies: 0.007357
565500 -- (-1398.626) (-1392.807) (-1398.142) [-1392.763] * (-1393.909) (-1394.284) (-1396.562) [-1395.958] -- 0:01:29
566000 -- [-1394.001] (-1389.185) (-1396.000) (-1396.209) * (-1394.861) (-1394.653) [-1394.637] (-1389.738) -- 0:01:28
566500 -- (-1397.544) [-1389.401] (-1394.238) (-1394.347) * [-1393.863] (-1394.266) (-1398.179) (-1392.136) -- 0:01:28
567000 -- (-1400.592) (-1389.668) [-1396.397] (-1400.234) * [-1395.256] (-1394.034) (-1388.829) (-1389.409) -- 0:01:28
567500 -- (-1407.266) [-1391.781] (-1392.943) (-1398.493) * (-1392.404) (-1397.170) (-1396.588) [-1391.453] -- 0:01:28
568000 -- (-1391.058) (-1400.079) [-1388.901] (-1394.619) * (-1396.608) (-1393.782) [-1397.636] (-1398.994) -- 0:01:28
568500 -- (-1390.905) (-1393.910) (-1396.566) [-1389.279] * [-1390.174] (-1393.281) (-1395.194) (-1400.186) -- 0:01:28
569000 -- (-1403.995) (-1397.697) [-1391.060] (-1394.154) * (-1396.975) (-1402.617) (-1396.697) [-1396.560] -- 0:01:28
569500 -- (-1400.290) (-1399.548) [-1390.815] (-1403.059) * (-1403.279) [-1394.762] (-1393.655) (-1399.959) -- 0:01:28
570000 -- (-1404.758) (-1398.140) [-1392.897] (-1390.520) * [-1400.766] (-1394.558) (-1395.722) (-1396.346) -- 0:01:28
Average standard deviation of split frequencies: 0.007297
570500 -- (-1406.213) (-1389.830) (-1398.082) [-1388.259] * (-1399.681) (-1396.267) [-1392.403] (-1388.772) -- 0:01:28
571000 -- (-1399.778) (-1404.186) (-1390.477) [-1403.257] * (-1392.704) (-1395.203) [-1395.476] (-1392.856) -- 0:01:27
571500 -- (-1395.338) (-1395.210) (-1399.207) [-1395.992] * (-1393.618) [-1396.565] (-1388.980) (-1400.959) -- 0:01:27
572000 -- [-1389.187] (-1397.262) (-1395.747) (-1404.181) * (-1394.748) [-1394.066] (-1400.388) (-1398.205) -- 0:01:27
572500 -- [-1393.751] (-1398.282) (-1395.235) (-1392.765) * (-1391.727) (-1399.816) [-1391.819] (-1390.385) -- 0:01:27
573000 -- [-1393.200] (-1394.326) (-1395.494) (-1396.753) * (-1399.760) (-1403.890) [-1394.273] (-1398.984) -- 0:01:27
573500 -- (-1391.385) [-1394.545] (-1391.205) (-1397.257) * (-1392.456) [-1394.069] (-1392.358) (-1391.910) -- 0:01:27
574000 -- (-1395.921) [-1393.301] (-1398.839) (-1388.929) * (-1390.997) (-1387.909) [-1392.703] (-1393.908) -- 0:01:27
574500 -- (-1404.359) [-1393.645] (-1390.925) (-1393.083) * [-1394.308] (-1397.532) (-1405.479) (-1399.187) -- 0:01:27
575000 -- (-1399.563) (-1398.963) [-1391.729] (-1400.104) * (-1388.840) (-1393.421) (-1403.919) [-1389.709] -- 0:01:27
Average standard deviation of split frequencies: 0.005592
575500 -- (-1396.546) (-1392.124) (-1409.604) [-1394.479] * (-1397.798) [-1394.105] (-1399.335) (-1389.512) -- 0:01:27
576000 -- (-1390.839) [-1394.254] (-1394.249) (-1394.643) * (-1400.804) (-1401.563) [-1391.439] (-1393.477) -- 0:01:26
576500 -- (-1393.904) [-1392.589] (-1410.170) (-1390.991) * (-1392.671) (-1397.423) [-1396.185] (-1399.027) -- 0:01:26
577000 -- (-1390.847) [-1394.974] (-1392.121) (-1393.121) * (-1393.036) (-1396.591) (-1390.988) [-1390.786] -- 0:01:26
577500 -- [-1394.046] (-1396.262) (-1396.258) (-1393.250) * [-1390.532] (-1410.716) (-1399.439) (-1398.008) -- 0:01:26
578000 -- (-1394.296) (-1390.876) [-1392.426] (-1396.073) * [-1394.193] (-1405.557) (-1399.468) (-1396.978) -- 0:01:26
578500 -- (-1406.598) (-1398.830) [-1391.895] (-1395.814) * (-1397.453) [-1392.421] (-1397.921) (-1393.426) -- 0:01:26
579000 -- (-1405.615) [-1394.991] (-1395.034) (-1397.931) * (-1397.239) (-1397.933) [-1394.012] (-1389.731) -- 0:01:26
579500 -- (-1399.179) (-1397.361) [-1397.723] (-1396.332) * (-1405.748) (-1395.844) (-1394.177) [-1395.898] -- 0:01:26
580000 -- [-1394.519] (-1410.299) (-1397.928) (-1391.055) * (-1399.368) (-1393.454) [-1390.409] (-1398.320) -- 0:01:26
Average standard deviation of split frequencies: 0.006495
580500 -- (-1396.372) (-1390.963) (-1401.374) [-1391.507] * (-1398.687) (-1398.046) (-1395.311) [-1392.196] -- 0:01:25
581000 -- (-1396.924) (-1390.444) (-1402.367) [-1391.479] * (-1392.975) (-1395.192) [-1390.387] (-1397.892) -- 0:01:25
581500 -- [-1398.837] (-1393.365) (-1396.694) (-1392.037) * (-1393.562) (-1400.520) [-1397.461] (-1393.516) -- 0:01:25
582000 -- (-1391.049) (-1397.235) (-1392.867) [-1399.284] * [-1389.961] (-1404.034) (-1388.462) (-1392.674) -- 0:01:25
582500 -- (-1391.072) (-1399.947) [-1396.770] (-1399.357) * (-1389.700) (-1396.173) [-1388.441] (-1396.383) -- 0:01:25
583000 -- (-1402.642) [-1401.150] (-1391.205) (-1405.362) * (-1396.034) (-1390.816) [-1388.702] (-1390.760) -- 0:01:25
583500 -- [-1402.423] (-1398.895) (-1399.197) (-1399.965) * [-1400.660] (-1398.388) (-1386.806) (-1386.875) -- 0:01:25
584000 -- (-1391.711) (-1393.098) [-1398.465] (-1391.331) * (-1394.131) (-1406.271) (-1391.332) [-1395.424] -- 0:01:25
584500 -- [-1394.649] (-1402.802) (-1397.167) (-1401.332) * (-1398.416) (-1397.245) (-1395.057) [-1393.797] -- 0:01:25
585000 -- [-1388.589] (-1395.857) (-1397.040) (-1400.609) * (-1406.405) (-1393.878) [-1393.762] (-1405.059) -- 0:01:25
Average standard deviation of split frequencies: 0.006704
585500 -- (-1396.838) (-1392.231) [-1393.115] (-1397.771) * (-1410.983) (-1397.736) (-1391.569) [-1398.022] -- 0:01:24
586000 -- (-1401.375) (-1399.935) (-1395.834) [-1398.388] * (-1398.766) [-1390.647] (-1393.223) (-1393.067) -- 0:01:24
586500 -- (-1399.016) [-1398.646] (-1397.881) (-1403.486) * (-1402.334) (-1390.625) [-1396.179] (-1391.052) -- 0:01:24
587000 -- [-1392.388] (-1400.563) (-1391.287) (-1407.771) * (-1399.431) [-1390.991] (-1399.156) (-1394.909) -- 0:01:24
587500 -- (-1398.431) [-1391.450] (-1397.824) (-1408.126) * (-1400.357) [-1390.095] (-1390.125) (-1397.040) -- 0:01:24
588000 -- (-1397.196) (-1393.574) [-1389.214] (-1393.852) * (-1399.572) (-1392.856) [-1394.368] (-1390.923) -- 0:01:24
588500 -- (-1393.023) (-1398.826) [-1395.073] (-1392.902) * (-1399.083) (-1396.613) (-1393.402) [-1386.664] -- 0:01:24
589000 -- (-1399.380) (-1392.368) [-1395.380] (-1387.892) * [-1399.644] (-1392.505) (-1397.026) (-1392.267) -- 0:01:24
589500 -- (-1402.437) [-1394.626] (-1392.482) (-1399.326) * (-1399.363) (-1403.115) (-1403.507) [-1389.707] -- 0:01:24
590000 -- (-1393.682) (-1385.734) (-1394.608) [-1394.675] * (-1400.080) [-1391.479] (-1402.978) (-1398.817) -- 0:01:24
Average standard deviation of split frequencies: 0.006385
590500 -- [-1394.359] (-1393.038) (-1396.624) (-1394.925) * (-1394.165) [-1400.845] (-1394.042) (-1395.160) -- 0:01:23
591000 -- (-1397.018) (-1390.323) (-1391.568) [-1391.729] * [-1393.721] (-1402.894) (-1394.731) (-1396.511) -- 0:01:23
591500 -- (-1398.917) (-1395.726) (-1399.375) [-1395.114] * (-1395.256) [-1398.432] (-1392.516) (-1400.525) -- 0:01:23
592000 -- (-1397.380) (-1396.868) (-1397.716) [-1392.645] * (-1396.353) (-1398.316) [-1389.169] (-1394.361) -- 0:01:23
592500 -- [-1394.026] (-1387.728) (-1395.861) (-1394.519) * (-1393.077) (-1400.046) [-1394.593] (-1393.203) -- 0:01:23
593000 -- (-1391.654) (-1396.252) [-1401.882] (-1385.404) * [-1394.584] (-1398.074) (-1402.652) (-1401.523) -- 0:01:23
593500 -- (-1398.305) (-1396.109) [-1394.518] (-1393.558) * (-1390.996) [-1393.138] (-1390.132) (-1395.834) -- 0:01:23
594000 -- (-1396.460) (-1397.953) (-1396.998) [-1392.612] * (-1398.163) [-1391.440] (-1395.082) (-1396.470) -- 0:01:23
594500 -- [-1389.714] (-1404.464) (-1388.516) (-1389.505) * [-1390.996] (-1390.990) (-1392.549) (-1396.098) -- 0:01:23
595000 -- (-1401.322) [-1394.170] (-1394.775) (-1392.303) * (-1392.332) (-1400.523) [-1392.603] (-1393.004) -- 0:01:23
Average standard deviation of split frequencies: 0.005800
595500 -- [-1393.377] (-1394.245) (-1402.485) (-1396.810) * (-1390.500) [-1391.965] (-1389.034) (-1391.569) -- 0:01:22
596000 -- (-1390.818) (-1397.036) [-1394.553] (-1401.504) * (-1396.891) (-1388.518) (-1396.212) [-1401.754] -- 0:01:22
596500 -- (-1394.225) (-1389.448) [-1391.655] (-1386.987) * (-1392.253) (-1399.446) (-1393.981) [-1392.279] -- 0:01:22
597000 -- (-1391.377) [-1386.964] (-1401.019) (-1394.498) * (-1396.869) (-1400.381) [-1394.152] (-1397.912) -- 0:01:22
597500 -- (-1402.429) [-1391.388] (-1393.144) (-1392.616) * [-1398.112] (-1395.452) (-1393.872) (-1392.706) -- 0:01:22
598000 -- (-1389.462) (-1392.889) [-1393.460] (-1390.252) * (-1397.681) (-1397.385) (-1394.988) [-1389.623] -- 0:01:22
598500 -- (-1400.693) [-1396.413] (-1401.862) (-1392.762) * (-1396.343) [-1394.321] (-1397.163) (-1397.748) -- 0:01:22
599000 -- (-1398.066) (-1401.822) (-1389.923) [-1396.039] * [-1396.826] (-1392.640) (-1395.761) (-1400.256) -- 0:01:22
599500 -- (-1398.666) [-1391.364] (-1391.922) (-1394.151) * (-1399.992) [-1402.030] (-1397.675) (-1395.398) -- 0:01:22
600000 -- (-1396.727) (-1391.413) (-1393.139) [-1391.155] * (-1394.994) [-1394.119] (-1390.248) (-1393.606) -- 0:01:22
Average standard deviation of split frequencies: 0.006409
600500 -- (-1394.588) (-1397.312) [-1389.296] (-1395.767) * (-1399.309) (-1389.875) [-1392.444] (-1396.476) -- 0:01:21
601000 -- (-1398.683) (-1392.712) (-1394.963) [-1394.022] * (-1399.049) [-1394.593] (-1396.300) (-1400.690) -- 0:01:21
601500 -- (-1396.985) (-1392.592) (-1395.158) [-1399.680] * (-1392.569) (-1392.143) (-1396.081) [-1395.679] -- 0:01:21
602000 -- [-1393.106] (-1389.020) (-1401.783) (-1395.851) * (-1397.461) (-1399.307) (-1397.771) [-1397.292] -- 0:01:21
602500 -- (-1392.984) (-1390.319) [-1388.699] (-1394.111) * (-1395.690) (-1406.750) (-1389.301) [-1395.988] -- 0:01:21
603000 -- (-1409.715) (-1403.145) [-1392.959] (-1386.153) * (-1398.944) (-1397.799) (-1395.400) [-1388.386] -- 0:01:21
603500 -- (-1397.175) [-1394.256] (-1388.704) (-1399.201) * [-1394.071] (-1389.129) (-1397.594) (-1401.531) -- 0:01:21
604000 -- (-1393.446) (-1396.413) [-1402.961] (-1393.743) * (-1395.383) (-1390.499) [-1398.052] (-1395.946) -- 0:01:21
604500 -- (-1397.496) [-1394.365] (-1392.738) (-1388.928) * (-1391.357) (-1395.262) [-1395.045] (-1400.973) -- 0:01:21
605000 -- [-1388.369] (-1392.377) (-1398.945) (-1397.565) * (-1400.166) (-1396.976) (-1393.847) [-1388.768] -- 0:01:20
Average standard deviation of split frequencies: 0.006612
605500 -- (-1390.690) (-1391.982) [-1394.512] (-1391.371) * [-1391.212] (-1397.909) (-1394.981) (-1397.548) -- 0:01:20
606000 -- (-1401.099) (-1401.651) [-1391.175] (-1395.464) * (-1393.356) (-1399.623) (-1388.244) [-1392.230] -- 0:01:20
606500 -- (-1396.078) [-1390.207] (-1397.033) (-1395.677) * [-1390.348] (-1393.080) (-1396.612) (-1389.656) -- 0:01:20
607000 -- (-1393.011) (-1396.903) (-1396.284) [-1394.157] * [-1389.264] (-1395.811) (-1401.208) (-1395.684) -- 0:01:20
607500 -- (-1390.411) (-1397.586) [-1403.617] (-1390.214) * [-1392.366] (-1397.838) (-1395.619) (-1391.880) -- 0:01:20
608000 -- (-1397.964) (-1394.687) [-1389.722] (-1397.313) * [-1391.725] (-1397.424) (-1398.770) (-1392.626) -- 0:01:20
608500 -- (-1389.896) (-1400.296) (-1391.808) [-1401.452] * [-1392.848] (-1396.609) (-1393.092) (-1391.410) -- 0:01:20
609000 -- (-1396.140) (-1392.889) [-1396.764] (-1391.468) * [-1392.279] (-1396.901) (-1390.181) (-1389.226) -- 0:01:20
609500 -- [-1395.691] (-1391.595) (-1398.246) (-1396.584) * (-1392.295) (-1396.511) [-1388.298] (-1392.502) -- 0:01:20
610000 -- [-1394.474] (-1393.289) (-1396.578) (-1396.576) * (-1397.957) (-1393.442) (-1396.596) [-1392.637] -- 0:01:19
Average standard deviation of split frequencies: 0.006562
610500 -- (-1393.209) (-1396.039) (-1396.956) [-1391.499] * (-1391.044) (-1400.291) (-1390.275) [-1392.925] -- 0:01:19
611000 -- (-1390.552) (-1389.775) [-1397.623] (-1400.049) * (-1396.507) (-1391.836) [-1391.683] (-1399.839) -- 0:01:19
611500 -- (-1396.437) (-1393.243) (-1395.409) [-1396.105] * [-1392.447] (-1409.997) (-1399.999) (-1390.254) -- 0:01:19
612000 -- (-1398.529) (-1390.912) (-1397.455) [-1388.560] * (-1414.077) (-1395.190) (-1394.702) [-1390.279] -- 0:01:19
612500 -- (-1399.016) (-1403.026) (-1406.854) [-1396.740] * (-1393.173) [-1393.233] (-1398.260) (-1386.603) -- 0:01:19
613000 -- (-1390.884) [-1398.084] (-1397.304) (-1395.788) * [-1390.968] (-1393.124) (-1402.364) (-1399.500) -- 0:01:19
613500 -- (-1400.639) (-1392.569) [-1395.861] (-1388.613) * (-1391.932) [-1387.867] (-1397.305) (-1393.124) -- 0:01:19
614000 -- (-1397.863) (-1392.515) (-1395.988) [-1392.118] * (-1390.867) (-1398.660) (-1394.694) [-1390.810] -- 0:01:19
614500 -- [-1403.788] (-1393.488) (-1396.364) (-1394.656) * (-1408.833) (-1396.052) [-1401.350] (-1397.299) -- 0:01:19
615000 -- (-1394.204) (-1393.655) [-1387.373] (-1393.329) * (-1396.897) [-1393.115] (-1399.771) (-1389.724) -- 0:01:18
Average standard deviation of split frequencies: 0.006505
615500 -- (-1406.142) (-1397.787) (-1390.774) [-1395.410] * (-1407.434) (-1391.373) [-1391.613] (-1400.562) -- 0:01:18
616000 -- (-1399.128) (-1401.669) [-1387.956] (-1395.430) * (-1399.139) [-1386.767] (-1393.294) (-1403.658) -- 0:01:18
616500 -- (-1398.585) (-1396.388) [-1390.699] (-1394.217) * [-1394.955] (-1389.735) (-1387.988) (-1400.170) -- 0:01:18
617000 -- (-1392.374) (-1390.297) (-1400.077) [-1396.706] * (-1391.558) (-1393.950) [-1393.001] (-1392.044) -- 0:01:18
617500 -- (-1392.903) [-1394.254] (-1399.014) (-1391.904) * [-1390.417] (-1393.318) (-1392.719) (-1394.530) -- 0:01:18
618000 -- [-1394.791] (-1394.200) (-1392.571) (-1395.256) * (-1397.257) [-1394.910] (-1402.480) (-1394.291) -- 0:01:18
618500 -- [-1397.081] (-1393.326) (-1392.813) (-1397.611) * (-1398.354) [-1393.081] (-1404.396) (-1390.126) -- 0:01:18
619000 -- (-1394.133) (-1396.385) [-1391.152] (-1397.863) * (-1394.568) (-1392.428) [-1390.574] (-1390.572) -- 0:01:18
619500 -- (-1392.361) (-1391.839) (-1399.637) [-1396.433] * (-1388.357) (-1389.362) [-1395.350] (-1398.391) -- 0:01:18
620000 -- (-1397.609) (-1392.006) (-1396.663) [-1387.611] * (-1387.971) (-1393.374) (-1393.595) [-1392.013] -- 0:01:17
Average standard deviation of split frequencies: 0.006329
620500 -- (-1396.660) (-1391.418) (-1393.682) [-1391.136] * (-1392.764) [-1390.330] (-1395.707) (-1398.736) -- 0:01:17
621000 -- (-1394.317) (-1395.387) [-1392.879] (-1388.543) * [-1395.032] (-1399.101) (-1387.461) (-1389.840) -- 0:01:17
621500 -- (-1388.467) (-1393.468) (-1394.222) [-1396.740] * (-1402.418) (-1404.291) (-1389.912) [-1392.485] -- 0:01:17
622000 -- [-1391.232] (-1392.000) (-1408.553) (-1389.972) * (-1390.190) [-1393.967] (-1393.420) (-1401.147) -- 0:01:17
622500 -- [-1392.381] (-1399.290) (-1403.056) (-1393.537) * (-1392.737) [-1389.982] (-1396.527) (-1397.642) -- 0:01:17
623000 -- [-1392.950] (-1401.558) (-1400.679) (-1397.887) * (-1394.043) [-1388.841] (-1390.929) (-1395.697) -- 0:01:17
623500 -- [-1394.326] (-1400.215) (-1395.123) (-1394.046) * [-1394.140] (-1403.809) (-1389.952) (-1396.632) -- 0:01:17
624000 -- (-1397.619) (-1389.831) (-1397.079) [-1400.721] * (-1394.857) [-1390.184] (-1394.409) (-1385.918) -- 0:01:17
624500 -- (-1394.656) [-1385.990] (-1406.051) (-1398.053) * (-1393.242) (-1388.634) [-1393.050] (-1396.041) -- 0:01:16
625000 -- (-1399.433) (-1397.109) (-1394.631) [-1398.191] * (-1388.346) (-1398.833) (-1400.763) [-1386.704] -- 0:01:16
Average standard deviation of split frequencies: 0.006401
625500 -- (-1393.212) (-1393.308) (-1393.215) [-1398.280] * (-1399.054) (-1391.421) (-1389.369) [-1393.803] -- 0:01:16
626000 -- (-1394.624) (-1404.420) (-1402.797) [-1392.043] * [-1399.203] (-1402.244) (-1385.845) (-1394.997) -- 0:01:16
626500 -- (-1392.800) (-1400.741) (-1398.281) [-1395.733] * (-1391.353) (-1397.062) [-1392.077] (-1396.337) -- 0:01:16
627000 -- (-1396.357) [-1403.855] (-1389.154) (-1399.013) * (-1390.546) (-1395.317) (-1393.276) [-1398.648] -- 0:01:16
627500 -- (-1395.051) (-1387.635) (-1396.044) [-1394.949] * (-1393.774) [-1394.775] (-1391.970) (-1391.843) -- 0:01:15
628000 -- (-1395.313) [-1397.805] (-1393.737) (-1396.788) * (-1395.009) (-1405.620) [-1400.053] (-1404.319) -- 0:01:16
628500 -- (-1399.779) [-1388.391] (-1399.082) (-1399.440) * (-1403.213) (-1394.875) (-1397.481) [-1393.082] -- 0:01:16
629000 -- (-1404.257) (-1391.551) (-1402.463) [-1402.035] * [-1392.620] (-1402.830) (-1397.209) (-1391.659) -- 0:01:16
629500 -- (-1385.874) [-1391.615] (-1403.524) (-1394.066) * (-1391.183) (-1403.385) (-1401.080) [-1388.141] -- 0:01:15
630000 -- (-1395.958) (-1395.591) (-1404.699) [-1398.450] * (-1398.949) (-1390.378) (-1387.757) [-1391.328] -- 0:01:15
Average standard deviation of split frequencies: 0.006603
630500 -- (-1397.256) (-1389.802) [-1393.896] (-1410.612) * (-1397.137) (-1397.187) [-1396.561] (-1397.070) -- 0:01:15
631000 -- (-1392.400) (-1395.227) [-1396.658] (-1396.602) * (-1401.383) (-1399.422) [-1392.712] (-1396.606) -- 0:01:15
631500 -- (-1397.830) (-1397.257) [-1397.209] (-1402.197) * (-1395.724) (-1394.391) [-1386.584] (-1401.074) -- 0:01:15
632000 -- (-1390.628) (-1397.411) (-1396.313) [-1400.546] * [-1392.233] (-1389.116) (-1401.361) (-1392.955) -- 0:01:15
632500 -- [-1387.119] (-1398.632) (-1397.606) (-1400.887) * [-1397.220] (-1395.103) (-1400.960) (-1392.910) -- 0:01:14
633000 -- (-1398.835) (-1391.875) [-1390.795] (-1404.287) * (-1397.123) [-1393.795] (-1394.436) (-1402.214) -- 0:01:15
633500 -- (-1393.700) [-1389.983] (-1391.417) (-1399.507) * (-1398.705) (-1387.373) [-1388.712] (-1394.776) -- 0:01:15
634000 -- (-1399.896) [-1391.409] (-1392.775) (-1398.974) * (-1407.783) [-1388.717] (-1388.455) (-1394.986) -- 0:01:15
634500 -- (-1391.179) [-1391.305] (-1394.216) (-1399.811) * (-1399.943) (-1393.299) [-1394.389] (-1399.565) -- 0:01:14
635000 -- (-1399.213) [-1399.076] (-1394.559) (-1396.434) * (-1398.599) [-1396.802] (-1397.933) (-1396.800) -- 0:01:14
Average standard deviation of split frequencies: 0.005930
635500 -- (-1393.383) (-1401.034) (-1396.193) [-1395.029] * (-1393.574) (-1393.532) (-1397.861) [-1400.366] -- 0:01:14
636000 -- [-1389.313] (-1398.075) (-1404.968) (-1400.695) * (-1399.861) (-1395.056) [-1390.598] (-1397.333) -- 0:01:14
636500 -- (-1391.671) [-1393.726] (-1394.698) (-1392.516) * (-1393.496) (-1396.238) (-1400.028) [-1394.113] -- 0:01:14
637000 -- [-1392.066] (-1398.552) (-1391.860) (-1392.313) * [-1392.320] (-1394.320) (-1401.281) (-1395.874) -- 0:01:14
637500 -- (-1394.797) (-1396.881) (-1397.730) [-1398.113] * (-1398.207) [-1397.750] (-1397.703) (-1394.667) -- 0:01:13
638000 -- (-1391.242) [-1392.980] (-1388.617) (-1390.652) * (-1396.276) [-1396.655] (-1395.084) (-1395.625) -- 0:01:14
638500 -- (-1397.197) (-1396.493) [-1390.115] (-1392.792) * (-1394.463) [-1393.595] (-1407.028) (-1399.876) -- 0:01:14
639000 -- (-1398.433) [-1389.291] (-1392.415) (-1393.371) * (-1394.653) [-1394.511] (-1402.077) (-1400.761) -- 0:01:14
639500 -- (-1398.586) [-1394.203] (-1393.953) (-1387.496) * (-1392.318) (-1394.057) (-1398.614) [-1393.814] -- 0:01:13
640000 -- (-1393.079) [-1393.075] (-1403.573) (-1396.527) * [-1391.563] (-1391.850) (-1387.868) (-1392.993) -- 0:01:13
Average standard deviation of split frequencies: 0.006132
640500 -- (-1397.025) [-1387.052] (-1400.639) (-1393.781) * (-1388.980) [-1391.917] (-1389.624) (-1400.401) -- 0:01:13
641000 -- (-1396.904) [-1393.017] (-1386.486) (-1388.256) * (-1394.668) (-1395.368) (-1394.309) [-1392.372] -- 0:01:13
641500 -- [-1396.023] (-1394.008) (-1396.441) (-1394.135) * [-1391.127] (-1393.847) (-1393.441) (-1397.883) -- 0:01:13
642000 -- (-1399.034) (-1392.319) [-1389.335] (-1397.962) * [-1396.177] (-1407.380) (-1397.621) (-1398.388) -- 0:01:13
642500 -- (-1404.707) (-1392.494) (-1392.365) [-1396.758] * (-1392.380) (-1391.775) [-1389.639] (-1391.817) -- 0:01:12
643000 -- (-1393.134) (-1392.628) [-1390.911] (-1394.205) * (-1393.394) [-1386.789] (-1401.708) (-1392.213) -- 0:01:13
643500 -- (-1391.983) (-1394.501) (-1397.450) [-1388.452] * (-1403.176) [-1389.713] (-1397.630) (-1390.249) -- 0:01:13
644000 -- (-1401.704) (-1398.036) [-1397.472] (-1401.020) * (-1400.025) (-1396.265) (-1395.551) [-1395.139] -- 0:01:12
644500 -- (-1397.848) (-1394.509) [-1393.967] (-1400.797) * (-1399.289) [-1397.761] (-1404.257) (-1394.470) -- 0:01:12
645000 -- (-1403.022) (-1392.635) [-1393.086] (-1398.822) * (-1399.817) (-1404.348) [-1395.692] (-1388.842) -- 0:01:12
Average standard deviation of split frequencies: 0.005595
645500 -- (-1406.022) (-1394.145) [-1395.728] (-1391.387) * (-1395.054) [-1398.337] (-1404.944) (-1390.748) -- 0:01:12
646000 -- (-1408.281) (-1396.605) (-1390.681) [-1392.111] * (-1401.555) [-1389.789] (-1394.828) (-1397.997) -- 0:01:12
646500 -- (-1394.305) (-1400.700) [-1399.345] (-1395.820) * [-1393.454] (-1397.514) (-1395.892) (-1395.444) -- 0:01:12
647000 -- (-1390.384) [-1390.140] (-1398.245) (-1392.682) * [-1389.349] (-1397.658) (-1395.800) (-1403.924) -- 0:01:12
647500 -- (-1399.733) (-1401.375) [-1394.730] (-1393.743) * (-1390.037) (-1395.991) [-1392.971] (-1391.121) -- 0:01:11
648000 -- (-1390.684) (-1394.160) [-1396.591] (-1389.563) * [-1391.585] (-1397.780) (-1390.279) (-1402.283) -- 0:01:12
648500 -- (-1401.487) [-1390.451] (-1398.880) (-1397.313) * (-1390.939) (-1393.953) [-1391.057] (-1401.724) -- 0:01:12
649000 -- [-1395.058] (-1394.756) (-1396.556) (-1396.718) * (-1392.825) (-1395.054) [-1389.844] (-1392.654) -- 0:01:11
649500 -- (-1396.345) (-1391.600) [-1396.158] (-1400.360) * [-1391.078] (-1393.562) (-1398.760) (-1397.755) -- 0:01:11
650000 -- (-1394.805) [-1390.951] (-1398.984) (-1391.249) * (-1393.126) (-1388.943) [-1396.066] (-1394.538) -- 0:01:11
Average standard deviation of split frequencies: 0.006037
650500 -- (-1394.169) (-1395.392) (-1392.900) [-1393.831] * [-1397.427] (-1398.949) (-1387.376) (-1396.453) -- 0:01:11
651000 -- (-1398.369) (-1388.770) (-1403.743) [-1394.123] * [-1393.872] (-1398.090) (-1392.020) (-1395.072) -- 0:01:11
651500 -- (-1397.695) (-1401.323) (-1393.147) [-1393.166] * (-1403.195) (-1397.557) [-1398.248] (-1393.525) -- 0:01:11
652000 -- (-1398.304) (-1396.999) (-1391.939) [-1394.086] * (-1394.002) (-1394.612) [-1402.184] (-1392.488) -- 0:01:10
652500 -- (-1397.520) [-1396.265] (-1390.165) (-1393.429) * (-1390.792) [-1393.058] (-1392.180) (-1403.120) -- 0:01:11
653000 -- [-1398.572] (-1399.256) (-1386.820) (-1398.303) * [-1391.136] (-1393.868) (-1392.916) (-1396.066) -- 0:01:11
653500 -- (-1398.090) (-1400.805) [-1390.151] (-1391.951) * (-1398.667) (-1393.183) (-1399.405) [-1406.292] -- 0:01:11
654000 -- (-1393.923) [-1392.921] (-1390.237) (-1395.442) * [-1396.100] (-1399.119) (-1391.894) (-1400.012) -- 0:01:10
654500 -- (-1390.122) [-1398.186] (-1394.896) (-1392.502) * [-1395.449] (-1398.283) (-1396.916) (-1399.638) -- 0:01:10
655000 -- (-1394.159) (-1396.105) [-1394.305] (-1396.206) * (-1391.936) (-1390.323) [-1390.826] (-1400.096) -- 0:01:10
Average standard deviation of split frequencies: 0.005509
655500 -- [-1392.370] (-1398.054) (-1406.745) (-1393.424) * (-1399.592) (-1401.631) [-1396.115] (-1403.101) -- 0:01:10
656000 -- (-1396.997) (-1392.931) [-1390.740] (-1394.608) * (-1397.605) [-1394.624] (-1392.101) (-1397.444) -- 0:01:10
656500 -- (-1397.205) [-1392.480] (-1389.191) (-1394.662) * (-1405.308) [-1392.997] (-1392.916) (-1389.073) -- 0:01:10
657000 -- [-1396.387] (-1394.568) (-1394.409) (-1388.287) * (-1390.497) (-1396.960) [-1400.182] (-1392.700) -- 0:01:09
657500 -- (-1415.109) (-1396.812) (-1390.636) [-1391.208] * (-1403.792) [-1396.023] (-1398.335) (-1396.375) -- 0:01:10
658000 -- (-1405.178) (-1392.933) [-1394.443] (-1391.064) * [-1394.531] (-1394.225) (-1401.562) (-1392.735) -- 0:01:10
658500 -- (-1399.655) [-1401.114] (-1395.372) (-1394.916) * (-1394.763) [-1391.653] (-1408.521) (-1394.730) -- 0:01:10
659000 -- [-1389.561] (-1399.505) (-1392.078) (-1401.570) * (-1393.076) [-1388.947] (-1397.824) (-1398.282) -- 0:01:09
659500 -- (-1390.589) [-1394.252] (-1394.848) (-1393.397) * (-1389.292) (-1390.665) (-1397.010) [-1393.268] -- 0:01:09
660000 -- (-1393.701) (-1398.165) (-1394.104) [-1392.659] * [-1394.256] (-1394.857) (-1393.636) (-1395.796) -- 0:01:09
Average standard deviation of split frequencies: 0.006184
660500 -- (-1393.533) (-1396.151) [-1397.605] (-1395.166) * (-1396.401) [-1388.378] (-1408.851) (-1406.579) -- 0:01:09
661000 -- [-1396.772] (-1395.422) (-1397.072) (-1403.208) * (-1389.649) (-1387.556) [-1399.092] (-1393.631) -- 0:01:09
661500 -- [-1390.381] (-1394.917) (-1393.747) (-1398.062) * (-1396.918) (-1393.815) (-1394.330) [-1392.794] -- 0:01:09
662000 -- (-1399.433) (-1393.610) (-1397.015) [-1400.362] * (-1393.604) (-1401.297) (-1396.829) [-1394.620] -- 0:01:08
662500 -- (-1392.394) [-1389.962] (-1393.306) (-1399.533) * [-1397.271] (-1393.285) (-1397.700) (-1405.233) -- 0:01:09
663000 -- (-1393.997) (-1392.211) (-1389.927) [-1392.921] * [-1390.926] (-1391.624) (-1392.570) (-1400.081) -- 0:01:09
663500 -- (-1401.284) (-1397.284) [-1394.274] (-1388.468) * (-1393.480) [-1394.003] (-1400.775) (-1405.496) -- 0:01:08
664000 -- (-1395.150) (-1396.024) (-1396.899) [-1394.529] * (-1385.442) (-1394.579) [-1392.559] (-1401.047) -- 0:01:08
664500 -- (-1397.743) [-1402.303] (-1393.750) (-1396.686) * [-1392.750] (-1395.449) (-1392.192) (-1394.291) -- 0:01:08
665000 -- (-1389.445) (-1392.477) (-1393.790) [-1397.396] * (-1401.916) (-1407.093) [-1390.956] (-1392.395) -- 0:01:08
Average standard deviation of split frequencies: 0.006134
665500 -- (-1391.988) [-1399.811] (-1392.604) (-1395.534) * (-1400.397) (-1408.618) [-1396.004] (-1395.129) -- 0:01:08
666000 -- (-1389.649) (-1402.049) [-1395.905] (-1393.372) * (-1395.915) (-1401.598) [-1392.906] (-1401.878) -- 0:01:08
666500 -- (-1392.881) [-1397.707] (-1399.589) (-1409.466) * (-1400.577) (-1395.615) [-1385.605] (-1388.485) -- 0:01:08
667000 -- (-1390.811) (-1398.197) (-1394.867) [-1396.145] * (-1394.243) (-1390.222) [-1391.172] (-1396.133) -- 0:01:07
667500 -- (-1401.302) [-1392.175] (-1396.187) (-1392.706) * (-1394.484) (-1397.523) [-1393.099] (-1391.254) -- 0:01:08
668000 -- (-1392.228) (-1397.578) [-1394.241] (-1394.314) * [-1397.819] (-1393.947) (-1402.642) (-1395.238) -- 0:01:08
668500 -- (-1405.120) (-1394.760) [-1397.097] (-1388.556) * (-1404.226) [-1389.494] (-1406.208) (-1396.277) -- 0:01:07
669000 -- [-1401.121] (-1393.538) (-1403.473) (-1394.055) * (-1398.558) [-1392.373] (-1401.648) (-1396.514) -- 0:01:07
669500 -- [-1394.170] (-1386.789) (-1396.518) (-1401.717) * (-1399.988) (-1392.363) [-1395.057] (-1399.876) -- 0:01:07
670000 -- (-1391.835) [-1395.332] (-1398.858) (-1399.007) * [-1391.898] (-1395.559) (-1397.372) (-1397.509) -- 0:01:07
Average standard deviation of split frequencies: 0.006560
670500 -- (-1399.844) (-1395.203) [-1389.356] (-1395.302) * (-1395.196) [-1395.576] (-1401.307) (-1395.511) -- 0:01:07
671000 -- (-1398.605) (-1395.134) (-1399.500) [-1394.225] * (-1401.122) (-1394.116) [-1396.397] (-1391.940) -- 0:01:07
671500 -- (-1398.532) (-1391.819) [-1396.389] (-1410.136) * (-1387.061) (-1405.954) (-1395.562) [-1391.421] -- 0:01:07
672000 -- (-1391.471) (-1386.539) [-1393.670] (-1403.514) * (-1398.240) [-1391.158] (-1402.442) (-1393.503) -- 0:01:06
672500 -- (-1392.616) (-1396.513) [-1396.501] (-1397.590) * (-1397.328) [-1391.597] (-1393.804) (-1394.266) -- 0:01:07
673000 -- (-1400.435) [-1391.779] (-1400.102) (-1396.984) * (-1394.238) (-1405.336) [-1398.261] (-1387.320) -- 0:01:07
673500 -- (-1409.251) [-1396.531] (-1399.530) (-1391.713) * (-1399.659) (-1401.086) [-1391.749] (-1395.420) -- 0:01:06
674000 -- (-1394.022) (-1391.968) (-1393.909) [-1395.114] * (-1400.317) (-1388.433) [-1396.013] (-1398.753) -- 0:01:06
674500 -- (-1402.927) [-1392.295] (-1393.976) (-1396.937) * [-1396.181] (-1395.339) (-1396.101) (-1394.045) -- 0:01:06
675000 -- (-1398.662) [-1396.506] (-1397.477) (-1391.150) * (-1394.755) [-1394.696] (-1393.724) (-1409.039) -- 0:01:06
Average standard deviation of split frequencies: 0.006741
675500 -- (-1392.543) (-1394.351) (-1393.185) [-1389.533] * [-1388.056] (-1396.596) (-1396.517) (-1394.615) -- 0:01:06
676000 -- (-1392.817) (-1393.520) (-1391.200) [-1395.345] * (-1395.239) (-1394.480) (-1393.196) [-1394.026] -- 0:01:06
676500 -- (-1389.277) (-1399.868) (-1400.940) [-1388.657] * (-1400.889) [-1396.565] (-1396.643) (-1391.655) -- 0:01:05
677000 -- (-1394.560) (-1394.782) (-1394.087) [-1392.213] * (-1401.465) [-1389.938] (-1391.284) (-1392.348) -- 0:01:05
677500 -- (-1399.660) (-1394.212) [-1402.415] (-1391.724) * (-1395.988) [-1391.979] (-1394.970) (-1394.753) -- 0:01:06
678000 -- [-1391.885] (-1389.254) (-1401.084) (-1392.261) * [-1395.375] (-1390.277) (-1394.075) (-1400.616) -- 0:01:06
678500 -- (-1391.370) [-1389.930] (-1399.700) (-1393.159) * (-1393.039) [-1393.656] (-1391.011) (-1392.217) -- 0:01:05
679000 -- (-1393.267) (-1395.176) (-1396.293) [-1397.746] * (-1397.950) (-1393.521) (-1394.220) [-1389.783] -- 0:01:05
679500 -- (-1397.165) [-1392.574] (-1399.666) (-1395.412) * (-1395.184) (-1391.612) (-1395.440) [-1393.979] -- 0:01:05
680000 -- (-1393.662) (-1392.292) (-1402.919) [-1393.646] * (-1395.252) (-1396.641) [-1397.107] (-1406.863) -- 0:01:05
Average standard deviation of split frequencies: 0.005771
680500 -- (-1400.395) (-1400.510) [-1395.496] (-1397.166) * (-1394.005) (-1397.638) [-1395.721] (-1396.720) -- 0:01:05
681000 -- [-1395.343] (-1396.712) (-1390.021) (-1392.662) * (-1390.847) (-1393.985) (-1396.286) [-1395.062] -- 0:01:05
681500 -- (-1389.066) (-1391.098) (-1390.426) [-1398.747] * (-1399.802) [-1394.624] (-1399.529) (-1399.661) -- 0:01:04
682000 -- [-1392.839] (-1399.909) (-1392.090) (-1391.393) * (-1392.444) [-1390.082] (-1392.876) (-1393.851) -- 0:01:04
682500 -- (-1390.560) [-1391.898] (-1395.581) (-1400.759) * (-1398.216) [-1394.727] (-1397.514) (-1395.568) -- 0:01:05
683000 -- (-1395.187) [-1389.942] (-1389.191) (-1393.025) * (-1401.081) [-1394.134] (-1399.602) (-1393.028) -- 0:01:04
683500 -- (-1400.632) [-1398.676] (-1395.543) (-1392.686) * (-1401.535) (-1392.151) (-1388.825) [-1396.136] -- 0:01:04
684000 -- (-1403.411) (-1391.554) (-1399.540) [-1388.738] * (-1405.970) [-1402.053] (-1394.417) (-1402.086) -- 0:01:04
684500 -- [-1389.278] (-1401.195) (-1396.898) (-1388.629) * (-1392.934) (-1389.414) (-1398.846) [-1386.513] -- 0:01:04
685000 -- (-1402.732) (-1397.375) [-1390.689] (-1400.002) * (-1401.119) (-1388.858) [-1388.785] (-1392.277) -- 0:01:04
Average standard deviation of split frequencies: 0.005497
685500 -- (-1391.618) (-1397.586) [-1396.781] (-1399.045) * (-1405.610) (-1393.743) (-1391.589) [-1391.292] -- 0:01:04
686000 -- (-1400.203) (-1401.833) [-1389.446] (-1396.240) * (-1395.768) (-1390.949) (-1398.273) [-1388.300] -- 0:01:04
686500 -- [-1398.366] (-1395.951) (-1402.132) (-1393.107) * [-1393.716] (-1394.946) (-1401.987) (-1399.613) -- 0:01:03
687000 -- (-1397.136) (-1393.678) [-1392.891] (-1391.828) * [-1388.302] (-1397.815) (-1398.811) (-1394.104) -- 0:01:03
687500 -- (-1402.076) (-1401.578) (-1392.745) [-1392.500] * (-1394.376) (-1395.590) (-1399.095) [-1393.341] -- 0:01:04
688000 -- (-1392.997) (-1393.127) (-1392.452) [-1395.527] * [-1391.223] (-1396.424) (-1391.295) (-1398.610) -- 0:01:03
688500 -- (-1398.625) (-1393.898) (-1406.750) [-1394.235] * (-1396.581) [-1393.793] (-1398.365) (-1394.380) -- 0:01:03
689000 -- [-1386.944] (-1397.897) (-1394.421) (-1399.283) * (-1402.016) (-1395.957) [-1393.755] (-1394.291) -- 0:01:03
689500 -- (-1411.467) (-1391.718) (-1391.740) [-1389.061] * (-1395.593) (-1396.627) (-1395.046) [-1393.909] -- 0:01:03
690000 -- (-1397.154) (-1395.714) (-1400.460) [-1386.452] * (-1393.985) (-1393.355) [-1395.445] (-1402.484) -- 0:01:03
Average standard deviation of split frequencies: 0.004892
690500 -- [-1388.765] (-1391.586) (-1393.289) (-1388.529) * (-1393.838) (-1396.667) (-1393.620) [-1393.732] -- 0:01:03
691000 -- (-1401.147) (-1390.574) [-1393.187] (-1392.905) * [-1393.565] (-1396.605) (-1395.836) (-1397.162) -- 0:01:03
691500 -- (-1398.685) (-1398.032) [-1390.594] (-1392.815) * [-1395.787] (-1396.377) (-1389.696) (-1399.127) -- 0:01:02
692000 -- (-1402.083) (-1386.424) (-1387.624) [-1390.503] * (-1396.092) [-1397.336] (-1396.240) (-1394.411) -- 0:01:02
692500 -- (-1401.709) (-1393.409) [-1391.508] (-1391.727) * [-1397.742] (-1399.081) (-1407.665) (-1396.357) -- 0:01:03
693000 -- (-1395.340) (-1396.660) (-1397.082) [-1393.692] * (-1397.991) (-1398.434) (-1395.694) [-1395.010] -- 0:01:02
693500 -- (-1393.202) [-1395.940] (-1399.226) (-1394.741) * (-1393.935) (-1393.880) [-1401.338] (-1398.534) -- 0:01:02
694000 -- (-1396.276) (-1390.884) [-1392.862] (-1398.711) * [-1396.702] (-1392.941) (-1405.014) (-1390.179) -- 0:01:02
694500 -- [-1394.768] (-1394.296) (-1389.904) (-1393.128) * (-1394.263) [-1391.351] (-1394.347) (-1396.287) -- 0:01:02
695000 -- (-1392.813) [-1395.436] (-1391.374) (-1407.469) * (-1393.388) (-1395.508) (-1395.347) [-1392.540] -- 0:01:02
Average standard deviation of split frequencies: 0.004177
695500 -- (-1395.679) [-1388.694] (-1391.517) (-1391.700) * (-1390.046) (-1394.294) [-1400.835] (-1392.015) -- 0:01:02
696000 -- [-1386.112] (-1393.180) (-1394.002) (-1403.587) * (-1403.999) (-1395.928) (-1407.920) [-1389.278] -- 0:01:02
696500 -- (-1392.685) [-1394.824] (-1397.353) (-1393.326) * (-1402.528) (-1388.704) [-1393.081] (-1398.887) -- 0:01:01
697000 -- (-1394.243) [-1387.874] (-1388.242) (-1400.671) * (-1394.519) [-1394.247] (-1392.179) (-1397.318) -- 0:01:01
697500 -- (-1391.319) (-1397.555) (-1396.818) [-1390.675] * (-1402.065) [-1391.619] (-1396.523) (-1389.193) -- 0:01:02
698000 -- (-1392.085) [-1392.631] (-1393.327) (-1397.270) * (-1396.043) [-1394.468] (-1396.114) (-1398.598) -- 0:01:01
698500 -- (-1386.586) (-1393.571) [-1399.315] (-1401.224) * (-1398.432) (-1399.169) [-1389.104] (-1400.474) -- 0:01:01
699000 -- (-1392.567) [-1393.118] (-1391.266) (-1401.436) * (-1390.789) (-1401.993) [-1392.838] (-1401.657) -- 0:01:01
699500 -- [-1394.786] (-1392.598) (-1393.071) (-1402.136) * (-1393.976) [-1397.793] (-1393.128) (-1394.108) -- 0:01:01
700000 -- (-1389.933) (-1397.702) (-1389.458) [-1393.623] * (-1399.468) (-1404.978) [-1388.894] (-1389.905) -- 0:01:01
Average standard deviation of split frequencies: 0.005046
700500 -- [-1396.456] (-1391.500) (-1392.722) (-1394.265) * (-1399.990) (-1398.765) (-1396.269) [-1403.686] -- 0:01:01
701000 -- (-1397.536) [-1390.660] (-1393.822) (-1402.720) * [-1389.536] (-1400.494) (-1388.769) (-1395.997) -- 0:01:00
701500 -- [-1398.417] (-1390.832) (-1394.213) (-1397.728) * [-1391.269] (-1403.013) (-1392.631) (-1396.439) -- 0:01:00
702000 -- (-1392.177) [-1393.709] (-1392.676) (-1394.695) * (-1394.112) (-1400.898) (-1398.207) [-1401.737] -- 0:01:00
702500 -- [-1395.082] (-1397.090) (-1394.848) (-1397.243) * (-1391.803) (-1406.313) [-1395.961] (-1400.430) -- 0:01:00
703000 -- (-1396.871) (-1389.183) (-1402.249) [-1399.976] * (-1398.121) [-1397.462] (-1397.587) (-1399.547) -- 0:01:00
703500 -- (-1387.787) (-1393.723) [-1390.945] (-1404.641) * [-1389.574] (-1392.806) (-1403.854) (-1397.525) -- 0:01:00
704000 -- (-1397.789) (-1398.386) (-1401.220) [-1399.863] * (-1389.164) (-1396.192) [-1393.049] (-1395.102) -- 0:01:00
704500 -- (-1394.261) [-1392.903] (-1396.061) (-1398.893) * (-1395.352) [-1395.510] (-1393.887) (-1402.235) -- 0:01:00
705000 -- [-1396.010] (-1391.876) (-1397.598) (-1397.367) * [-1389.250] (-1394.352) (-1387.623) (-1397.690) -- 0:01:00
Average standard deviation of split frequencies: 0.004563
705500 -- (-1397.981) [-1393.303] (-1397.523) (-1394.933) * (-1391.622) (-1398.295) [-1390.537] (-1405.167) -- 0:01:00
706000 -- [-1392.535] (-1390.919) (-1399.391) (-1408.502) * (-1396.049) [-1390.914] (-1389.212) (-1404.393) -- 0:00:59
706500 -- (-1398.807) [-1390.023] (-1395.313) (-1397.499) * (-1397.908) [-1394.455] (-1394.639) (-1404.810) -- 0:00:59
707000 -- [-1396.158] (-1396.672) (-1394.324) (-1394.941) * [-1392.316] (-1398.013) (-1387.431) (-1397.876) -- 0:00:59
707500 -- (-1394.485) (-1398.569) (-1394.218) [-1397.476] * (-1392.799) (-1396.482) (-1389.614) [-1399.953] -- 0:00:59
708000 -- [-1398.582] (-1395.616) (-1391.544) (-1398.457) * (-1408.209) (-1397.573) (-1395.330) [-1393.698] -- 0:00:59
708500 -- (-1394.964) (-1393.944) (-1392.472) [-1395.798] * [-1398.473] (-1395.048) (-1395.462) (-1393.613) -- 0:00:59
709000 -- (-1404.592) (-1388.497) [-1396.310] (-1400.698) * (-1389.815) [-1391.326] (-1398.771) (-1391.432) -- 0:00:59
709500 -- [-1389.635] (-1397.064) (-1393.304) (-1394.634) * (-1392.766) [-1389.437] (-1398.216) (-1396.980) -- 0:00:59
710000 -- [-1387.635] (-1399.315) (-1396.141) (-1396.590) * (-1390.421) (-1394.629) [-1395.311] (-1399.143) -- 0:00:59
Average standard deviation of split frequencies: 0.004754
710500 -- [-1393.665] (-1396.146) (-1394.072) (-1388.473) * (-1392.638) (-1396.484) (-1410.508) [-1394.704] -- 0:00:59
711000 -- (-1388.923) (-1391.089) [-1397.556] (-1393.062) * (-1394.147) (-1394.132) (-1402.134) [-1397.264] -- 0:00:58
711500 -- (-1390.961) [-1394.296] (-1392.772) (-1396.013) * (-1392.922) (-1392.984) [-1392.648] (-1394.437) -- 0:00:58
712000 -- [-1389.625] (-1393.373) (-1389.049) (-1392.424) * (-1397.471) [-1393.014] (-1397.070) (-1398.167) -- 0:00:58
712500 -- (-1392.401) (-1395.307) [-1390.932] (-1398.011) * (-1392.555) [-1396.078] (-1391.759) (-1390.605) -- 0:00:58
713000 -- (-1395.090) (-1397.871) (-1390.184) [-1395.256] * (-1392.507) (-1389.215) [-1396.638] (-1394.509) -- 0:00:58
713500 -- [-1388.600] (-1396.069) (-1402.805) (-1391.783) * (-1404.018) (-1398.564) [-1394.213] (-1391.338) -- 0:00:58
714000 -- (-1391.687) [-1398.163] (-1396.633) (-1393.706) * (-1396.670) [-1396.396] (-1393.281) (-1392.746) -- 0:00:58
714500 -- [-1396.690] (-1396.841) (-1394.248) (-1394.659) * (-1392.088) (-1386.416) [-1395.620] (-1393.931) -- 0:00:58
715000 -- (-1394.156) (-1396.571) (-1398.120) [-1400.517] * [-1395.288] (-1392.389) (-1394.814) (-1397.774) -- 0:00:58
Average standard deviation of split frequencies: 0.005377
715500 -- [-1394.784] (-1390.389) (-1393.091) (-1404.621) * [-1396.164] (-1393.371) (-1389.029) (-1395.383) -- 0:00:58
716000 -- (-1400.168) (-1396.255) (-1387.995) [-1391.690] * (-1397.943) [-1390.229] (-1394.258) (-1393.325) -- 0:00:57
716500 -- (-1404.763) (-1394.025) (-1390.432) [-1392.607] * [-1395.759] (-1395.539) (-1395.641) (-1403.545) -- 0:00:57
717000 -- (-1394.621) [-1390.756] (-1397.648) (-1400.844) * (-1394.755) (-1391.103) (-1397.027) [-1392.194] -- 0:00:57
717500 -- (-1399.129) (-1390.299) (-1393.874) [-1393.155] * [-1388.788] (-1400.932) (-1396.027) (-1391.148) -- 0:00:57
718000 -- (-1397.547) [-1388.708] (-1389.879) (-1390.555) * (-1397.808) (-1393.578) (-1402.782) [-1388.875] -- 0:00:57
718500 -- (-1402.323) (-1408.600) [-1393.637] (-1390.854) * (-1395.597) (-1397.977) (-1397.295) [-1392.194] -- 0:00:57
719000 -- (-1396.849) (-1400.379) [-1396.672] (-1397.097) * [-1394.109] (-1406.506) (-1400.119) (-1391.227) -- 0:00:57
719500 -- [-1387.064] (-1390.816) (-1398.243) (-1392.512) * (-1395.480) [-1392.856] (-1401.954) (-1396.308) -- 0:00:57
720000 -- (-1391.213) [-1389.562] (-1400.514) (-1394.633) * [-1394.646] (-1392.475) (-1390.684) (-1400.161) -- 0:00:57
Average standard deviation of split frequencies: 0.004906
720500 -- [-1388.020] (-1395.648) (-1394.114) (-1394.936) * [-1392.587] (-1398.197) (-1396.853) (-1394.095) -- 0:00:57
721000 -- (-1406.602) [-1398.891] (-1404.237) (-1392.745) * [-1393.862] (-1396.168) (-1392.014) (-1393.894) -- 0:00:56
721500 -- (-1398.473) (-1391.703) [-1396.222] (-1396.051) * (-1395.053) (-1396.919) (-1403.327) [-1387.611] -- 0:00:56
722000 -- (-1392.720) (-1396.377) [-1399.303] (-1397.497) * (-1399.540) [-1389.892] (-1399.493) (-1395.703) -- 0:00:56
722500 -- (-1386.707) (-1401.945) (-1394.922) [-1391.028] * (-1397.300) (-1397.056) [-1393.760] (-1393.309) -- 0:00:56
723000 -- (-1394.793) (-1395.871) (-1398.299) [-1395.923] * (-1389.868) [-1391.933] (-1395.171) (-1393.930) -- 0:00:56
723500 -- (-1396.673) [-1396.024] (-1400.096) (-1401.186) * (-1394.329) (-1399.755) (-1390.577) [-1392.897] -- 0:00:56
724000 -- [-1395.548] (-1389.687) (-1392.417) (-1395.604) * (-1398.444) (-1387.808) [-1391.547] (-1396.800) -- 0:00:56
724500 -- [-1387.790] (-1394.784) (-1390.832) (-1393.073) * (-1398.996) (-1389.270) (-1394.690) [-1394.154] -- 0:00:56
725000 -- (-1389.256) [-1393.236] (-1393.898) (-1398.711) * (-1394.590) (-1394.104) (-1400.031) [-1398.716] -- 0:00:56
Average standard deviation of split frequencies: 0.005086
725500 -- [-1385.595] (-1394.417) (-1392.611) (-1398.044) * (-1397.966) (-1403.050) (-1402.802) [-1394.848] -- 0:00:55
726000 -- [-1389.290] (-1392.565) (-1397.177) (-1401.107) * (-1396.710) (-1399.622) (-1395.950) [-1390.955] -- 0:00:55
726500 -- (-1392.751) [-1401.517] (-1391.941) (-1394.181) * [-1392.351] (-1396.188) (-1391.439) (-1389.909) -- 0:00:55
727000 -- (-1400.638) (-1396.279) [-1394.890] (-1394.801) * [-1396.677] (-1399.362) (-1400.430) (-1399.319) -- 0:00:55
727500 -- [-1402.012] (-1406.059) (-1395.370) (-1389.921) * (-1394.497) (-1407.789) (-1391.357) [-1390.070] -- 0:00:55
728000 -- (-1404.322) [-1397.239] (-1392.116) (-1397.276) * (-1396.052) (-1406.583) [-1394.906] (-1396.775) -- 0:00:55
728500 -- [-1397.673] (-1396.877) (-1392.151) (-1396.510) * (-1393.829) (-1396.274) (-1392.483) [-1385.886] -- 0:00:55
729000 -- (-1391.998) (-1393.033) [-1402.464] (-1393.649) * [-1392.573] (-1390.727) (-1400.766) (-1390.873) -- 0:00:55
729500 -- (-1395.501) [-1386.250] (-1396.745) (-1389.879) * (-1396.267) (-1395.945) [-1388.255] (-1399.699) -- 0:00:55
730000 -- [-1387.160] (-1395.185) (-1409.054) (-1399.547) * (-1394.991) [-1394.251] (-1400.884) (-1398.856) -- 0:00:55
Average standard deviation of split frequencies: 0.004516
730500 -- [-1387.757] (-1393.525) (-1400.737) (-1392.161) * (-1394.744) (-1385.451) (-1388.534) [-1402.552] -- 0:00:54
731000 -- (-1395.937) (-1387.424) (-1390.674) [-1398.043] * (-1396.636) [-1393.522] (-1401.644) (-1400.183) -- 0:00:54
731500 -- [-1402.628] (-1389.312) (-1395.187) (-1401.116) * (-1401.249) (-1393.606) [-1401.534] (-1396.933) -- 0:00:54
732000 -- (-1401.812) [-1393.269] (-1389.924) (-1396.714) * (-1400.200) (-1389.578) (-1401.763) [-1391.572] -- 0:00:54
732500 -- (-1403.379) (-1389.116) (-1394.755) [-1391.517] * (-1391.109) (-1391.836) (-1398.006) [-1391.482] -- 0:00:54
733000 -- [-1402.471] (-1392.947) (-1392.443) (-1396.231) * (-1399.193) [-1397.001] (-1398.082) (-1387.979) -- 0:00:54
733500 -- (-1407.487) [-1399.085] (-1399.683) (-1389.867) * (-1400.307) (-1393.382) [-1394.099] (-1396.842) -- 0:00:54
734000 -- (-1395.430) (-1405.931) [-1393.011] (-1397.238) * (-1397.581) (-1406.997) [-1391.844] (-1397.238) -- 0:00:54
734500 -- (-1393.387) [-1398.134] (-1399.323) (-1411.256) * [-1388.984] (-1393.575) (-1395.471) (-1399.939) -- 0:00:54
735000 -- (-1394.904) (-1396.112) [-1392.995] (-1403.528) * (-1395.044) (-1391.164) [-1390.234] (-1389.858) -- 0:00:54
Average standard deviation of split frequencies: 0.004270
735500 -- (-1393.525) (-1391.590) (-1392.887) [-1396.447] * [-1388.781] (-1396.245) (-1390.596) (-1388.405) -- 0:00:53
736000 -- [-1392.234] (-1397.619) (-1405.774) (-1396.927) * (-1392.319) (-1397.183) [-1392.370] (-1389.945) -- 0:00:53
736500 -- (-1399.455) (-1394.489) (-1389.365) [-1391.744] * [-1397.732] (-1404.591) (-1389.768) (-1397.506) -- 0:00:53
737000 -- (-1390.944) (-1388.039) (-1395.881) [-1390.839] * (-1397.974) (-1402.804) (-1399.178) [-1390.419] -- 0:00:53
737500 -- (-1392.126) [-1394.587] (-1398.740) (-1394.955) * [-1392.542] (-1395.089) (-1393.434) (-1393.172) -- 0:00:53
738000 -- (-1400.080) [-1386.960] (-1392.908) (-1394.380) * (-1393.603) (-1399.520) (-1399.341) [-1389.371] -- 0:00:53
738500 -- (-1399.217) (-1392.104) (-1406.228) [-1393.329] * (-1397.411) (-1396.265) (-1395.918) [-1390.402] -- 0:00:53
739000 -- (-1396.666) (-1391.345) (-1398.314) [-1399.509] * (-1390.283) (-1389.754) (-1396.706) [-1392.238] -- 0:00:53
739500 -- [-1391.861] (-1397.389) (-1390.398) (-1390.878) * (-1397.586) [-1396.688] (-1395.012) (-1397.063) -- 0:00:53
740000 -- (-1393.887) (-1394.075) [-1393.335] (-1401.915) * (-1401.691) (-1398.772) (-1395.350) [-1390.403] -- 0:00:53
Average standard deviation of split frequencies: 0.004031
740500 -- (-1393.009) (-1395.793) [-1386.964] (-1397.252) * (-1390.138) [-1396.583] (-1393.366) (-1401.019) -- 0:00:52
741000 -- [-1392.168] (-1394.591) (-1389.646) (-1400.164) * (-1396.836) [-1395.900] (-1396.975) (-1394.021) -- 0:00:52
741500 -- [-1400.875] (-1401.330) (-1391.664) (-1399.193) * (-1389.144) (-1397.192) [-1393.532] (-1397.224) -- 0:00:52
742000 -- (-1396.539) (-1392.133) [-1389.668] (-1394.499) * (-1397.976) (-1393.602) (-1396.676) [-1395.003] -- 0:00:52
742500 -- [-1392.721] (-1395.742) (-1397.769) (-1391.117) * (-1394.649) (-1391.649) [-1390.782] (-1400.640) -- 0:00:52
743000 -- (-1392.041) (-1390.587) [-1394.160] (-1405.131) * (-1398.383) [-1390.880] (-1395.052) (-1392.076) -- 0:00:52
743500 -- (-1396.771) (-1397.824) [-1395.944] (-1397.531) * (-1398.546) (-1395.667) [-1385.881] (-1398.569) -- 0:00:52
744000 -- (-1394.839) (-1401.484) [-1388.955] (-1396.879) * (-1397.014) (-1393.889) (-1397.024) [-1394.321] -- 0:00:52
744500 -- (-1398.661) (-1393.066) [-1392.460] (-1392.886) * (-1388.567) [-1395.751] (-1400.326) (-1391.456) -- 0:00:52
745000 -- (-1397.899) [-1389.666] (-1392.829) (-1392.929) * (-1394.882) (-1402.641) (-1404.828) [-1387.909] -- 0:00:52
Average standard deviation of split frequencies: 0.004423
745500 -- (-1389.156) (-1399.022) (-1395.163) [-1393.464] * (-1399.535) (-1403.263) (-1396.162) [-1391.590] -- 0:00:51
746000 -- (-1399.339) (-1402.217) (-1401.973) [-1393.151] * (-1402.954) (-1404.231) [-1389.919] (-1401.369) -- 0:00:51
746500 -- (-1393.745) (-1390.640) (-1397.480) [-1398.574] * (-1399.153) (-1397.446) (-1395.387) [-1392.862] -- 0:00:51
747000 -- (-1393.285) (-1390.162) [-1387.109] (-1400.467) * (-1394.149) (-1394.487) (-1390.405) [-1388.245] -- 0:00:51
747500 -- (-1405.468) (-1395.992) (-1388.512) [-1392.668] * (-1401.606) (-1393.049) (-1389.332) [-1395.311] -- 0:00:51
748000 -- [-1399.478] (-1394.502) (-1393.574) (-1397.173) * [-1397.647] (-1397.660) (-1397.010) (-1393.080) -- 0:00:51
748500 -- (-1404.712) (-1392.367) (-1391.617) [-1392.924] * (-1394.134) (-1386.318) (-1396.510) [-1391.452] -- 0:00:51
749000 -- (-1391.919) (-1395.734) [-1390.620] (-1393.262) * (-1402.948) (-1393.384) (-1397.470) [-1399.208] -- 0:00:51
749500 -- [-1392.219] (-1401.015) (-1398.437) (-1398.850) * (-1394.935) [-1392.517] (-1393.001) (-1389.967) -- 0:00:51
750000 -- (-1390.166) [-1393.567] (-1397.508) (-1395.476) * (-1398.451) (-1394.106) (-1391.929) [-1387.690] -- 0:00:51
Average standard deviation of split frequencies: 0.004605
750500 -- (-1386.934) [-1401.018] (-1394.780) (-1400.198) * (-1398.131) [-1392.497] (-1396.199) (-1398.724) -- 0:00:50
751000 -- [-1390.341] (-1391.966) (-1404.846) (-1396.974) * (-1395.900) [-1389.380] (-1387.988) (-1395.478) -- 0:00:50
751500 -- (-1391.689) (-1387.839) (-1393.429) [-1391.923] * (-1388.866) (-1400.728) (-1391.968) [-1393.032] -- 0:00:50
752000 -- [-1394.061] (-1390.451) (-1393.279) (-1389.353) * (-1399.369) (-1396.098) (-1393.059) [-1387.883] -- 0:00:50
752500 -- (-1391.730) (-1398.867) [-1392.051] (-1394.719) * (-1397.907) (-1394.163) (-1393.103) [-1399.558] -- 0:00:50
753000 -- (-1387.187) (-1399.011) [-1395.209] (-1388.910) * (-1401.496) (-1403.166) (-1388.426) [-1398.121] -- 0:00:50
753500 -- (-1391.625) (-1398.388) (-1402.810) [-1394.507] * (-1402.619) (-1392.324) (-1396.010) [-1388.540] -- 0:00:50
754000 -- [-1392.730] (-1394.339) (-1392.895) (-1403.660) * (-1397.493) [-1391.669] (-1392.300) (-1390.191) -- 0:00:50
754500 -- (-1394.780) (-1399.738) [-1390.863] (-1400.418) * [-1390.614] (-1404.242) (-1403.633) (-1394.238) -- 0:00:50
755000 -- (-1394.774) [-1389.150] (-1393.263) (-1390.005) * (-1397.591) (-1398.873) [-1392.381] (-1398.345) -- 0:00:49
Average standard deviation of split frequencies: 0.004365
755500 -- (-1390.184) (-1387.168) (-1394.600) [-1398.146] * [-1392.769] (-1395.914) (-1390.692) (-1398.538) -- 0:00:49
756000 -- (-1395.616) (-1398.074) [-1395.343] (-1401.967) * (-1394.852) [-1401.778] (-1386.639) (-1393.987) -- 0:00:49
756500 -- (-1393.357) (-1402.549) [-1393.266] (-1396.243) * [-1388.353] (-1407.189) (-1392.627) (-1395.866) -- 0:00:49
757000 -- [-1405.370] (-1398.458) (-1392.560) (-1403.752) * (-1391.069) (-1399.511) (-1387.131) [-1392.913] -- 0:00:49
757500 -- (-1399.348) [-1395.329] (-1388.724) (-1399.239) * (-1391.588) (-1394.080) [-1393.718] (-1395.014) -- 0:00:49
758000 -- (-1388.571) (-1394.369) [-1393.601] (-1391.842) * (-1396.299) [-1396.466] (-1391.849) (-1398.738) -- 0:00:49
758500 -- (-1389.910) (-1399.356) [-1394.361] (-1391.948) * [-1396.576] (-1394.520) (-1394.767) (-1395.952) -- 0:00:49
759000 -- (-1391.376) (-1408.771) (-1396.964) [-1396.716] * (-1407.725) (-1401.374) [-1397.375] (-1395.134) -- 0:00:49
759500 -- (-1395.013) [-1396.406] (-1398.660) (-1397.933) * [-1393.050] (-1392.362) (-1398.828) (-1397.830) -- 0:00:49
760000 -- [-1394.780] (-1406.708) (-1393.352) (-1405.611) * (-1389.476) (-1391.754) [-1397.876] (-1400.547) -- 0:00:48
Average standard deviation of split frequencies: 0.004545
760500 -- (-1398.090) [-1397.168] (-1396.902) (-1397.226) * (-1392.120) (-1400.091) [-1396.717] (-1398.626) -- 0:00:48
761000 -- (-1396.666) (-1396.023) (-1399.120) [-1392.144] * [-1392.906] (-1406.245) (-1393.616) (-1398.490) -- 0:00:48
761500 -- (-1394.314) [-1392.205] (-1400.615) (-1392.692) * [-1400.039] (-1396.069) (-1397.711) (-1394.115) -- 0:00:48
762000 -- (-1393.952) (-1401.588) (-1403.249) [-1391.677] * (-1395.635) [-1387.344] (-1395.554) (-1392.590) -- 0:00:48
762500 -- (-1402.373) [-1393.706] (-1396.432) (-1390.876) * (-1400.054) (-1392.633) (-1396.071) [-1389.053] -- 0:00:48
763000 -- [-1393.084] (-1399.438) (-1393.513) (-1387.292) * (-1404.234) (-1391.420) (-1406.040) [-1400.252] -- 0:00:48
763500 -- (-1393.799) [-1394.671] (-1405.142) (-1387.373) * (-1397.883) [-1392.336] (-1404.612) (-1401.131) -- 0:00:48
764000 -- (-1389.252) [-1395.235] (-1394.860) (-1393.743) * (-1396.277) (-1408.115) (-1408.841) [-1391.515] -- 0:00:48
764500 -- (-1393.390) [-1392.421] (-1394.642) (-1393.642) * (-1389.944) [-1388.903] (-1395.535) (-1393.560) -- 0:00:48
765000 -- (-1401.519) (-1390.146) [-1389.152] (-1397.764) * (-1400.425) (-1392.683) (-1398.357) [-1395.897] -- 0:00:47
Average standard deviation of split frequencies: 0.004718
765500 -- (-1408.139) [-1400.534] (-1388.350) (-1391.413) * (-1401.891) (-1395.151) (-1394.925) [-1389.399] -- 0:00:47
766000 -- (-1391.099) (-1391.167) [-1389.223] (-1397.540) * (-1401.287) [-1394.319] (-1401.379) (-1392.475) -- 0:00:47
766500 -- (-1404.773) (-1390.456) [-1390.574] (-1400.180) * (-1400.677) (-1390.196) (-1396.197) [-1398.003] -- 0:00:47
767000 -- [-1391.201] (-1393.252) (-1410.400) (-1394.572) * (-1408.639) (-1392.131) [-1396.287] (-1400.241) -- 0:00:47
767500 -- [-1395.626] (-1390.654) (-1402.057) (-1402.198) * (-1391.683) [-1387.675] (-1392.864) (-1395.664) -- 0:00:47
768000 -- [-1389.297] (-1396.845) (-1393.089) (-1397.064) * (-1391.685) (-1395.319) (-1393.714) [-1400.399] -- 0:00:47
768500 -- [-1404.202] (-1390.661) (-1400.372) (-1398.785) * (-1390.144) (-1396.100) [-1390.392] (-1401.326) -- 0:00:47
769000 -- [-1392.321] (-1399.027) (-1398.282) (-1406.898) * [-1391.196] (-1405.565) (-1398.957) (-1395.260) -- 0:00:47
769500 -- [-1391.755] (-1393.568) (-1394.280) (-1395.328) * [-1391.907] (-1391.604) (-1393.543) (-1400.365) -- 0:00:47
770000 -- (-1391.408) [-1392.886] (-1396.363) (-1394.542) * [-1395.658] (-1394.326) (-1395.533) (-1396.235) -- 0:00:46
Average standard deviation of split frequencies: 0.004486
770500 -- (-1391.052) (-1393.610) [-1390.362] (-1399.285) * (-1397.925) (-1396.046) [-1394.492] (-1400.179) -- 0:00:46
771000 -- (-1395.563) (-1404.611) [-1398.591] (-1397.659) * (-1393.694) [-1394.672] (-1408.278) (-1397.101) -- 0:00:46
771500 -- (-1392.052) (-1396.504) [-1392.313] (-1393.967) * (-1395.141) (-1389.987) (-1394.546) [-1386.900] -- 0:00:46
772000 -- (-1393.004) (-1395.258) (-1400.818) [-1387.439] * (-1394.925) [-1393.391] (-1407.979) (-1394.652) -- 0:00:46
772500 -- (-1386.752) (-1415.912) (-1406.025) [-1389.813] * (-1398.381) (-1395.826) (-1406.859) [-1400.517] -- 0:00:46
773000 -- [-1393.370] (-1395.308) (-1395.901) (-1395.877) * (-1400.617) (-1400.520) (-1398.154) [-1403.539] -- 0:00:46
773500 -- (-1399.107) (-1400.224) [-1392.545] (-1389.966) * (-1389.835) (-1398.754) (-1394.721) [-1390.480] -- 0:00:46
774000 -- (-1404.914) (-1393.781) (-1395.634) [-1395.268] * (-1395.772) (-1387.653) [-1391.101] (-1400.133) -- 0:00:46
774500 -- (-1397.762) (-1401.846) (-1395.256) [-1394.674] * [-1397.432] (-1397.288) (-1395.938) (-1400.059) -- 0:00:46
775000 -- (-1406.301) (-1398.775) (-1408.734) [-1392.036] * (-1399.235) (-1400.083) (-1395.444) [-1400.435] -- 0:00:45
Average standard deviation of split frequencies: 0.004252
775500 -- [-1388.641] (-1401.173) (-1393.658) (-1399.380) * (-1391.711) (-1389.154) [-1393.723] (-1390.959) -- 0:00:45
776000 -- (-1392.680) (-1406.095) (-1396.305) [-1389.314] * (-1392.288) (-1397.313) (-1394.807) [-1396.084] -- 0:00:45
776500 -- (-1393.755) (-1404.110) (-1393.918) [-1400.210] * (-1397.161) (-1399.618) [-1390.985] (-1393.737) -- 0:00:45
777000 -- [-1397.202] (-1408.994) (-1398.006) (-1398.175) * [-1394.929] (-1394.137) (-1392.580) (-1395.487) -- 0:00:45
777500 -- (-1397.448) [-1394.964] (-1399.413) (-1396.529) * (-1404.585) (-1394.757) [-1394.732] (-1403.584) -- 0:00:45
778000 -- (-1391.156) (-1396.845) [-1405.403] (-1394.698) * (-1392.648) (-1391.490) [-1395.458] (-1403.470) -- 0:00:45
778500 -- (-1389.007) (-1398.156) (-1396.157) [-1395.992] * (-1392.753) [-1384.894] (-1408.655) (-1396.795) -- 0:00:45
779000 -- (-1391.229) [-1404.519] (-1393.620) (-1405.748) * (-1392.243) [-1389.111] (-1395.668) (-1398.070) -- 0:00:45
779500 -- (-1390.090) (-1398.595) [-1386.937] (-1402.400) * (-1396.027) [-1394.098] (-1397.256) (-1397.673) -- 0:00:44
780000 -- [-1389.141] (-1390.586) (-1392.059) (-1396.520) * [-1393.695] (-1392.401) (-1398.183) (-1400.424) -- 0:00:44
Average standard deviation of split frequencies: 0.004227
780500 -- (-1394.208) (-1395.008) [-1392.433] (-1401.733) * (-1392.289) (-1393.990) [-1393.976] (-1394.633) -- 0:00:44
781000 -- (-1391.172) (-1393.660) (-1403.629) [-1393.124] * (-1400.785) (-1394.437) [-1392.915] (-1394.501) -- 0:00:44
781500 -- (-1401.989) (-1394.722) [-1389.192] (-1393.388) * [-1391.563] (-1400.216) (-1397.354) (-1397.095) -- 0:00:44
782000 -- (-1395.140) (-1392.825) [-1393.212] (-1398.037) * (-1396.231) (-1392.241) (-1393.809) [-1392.237] -- 0:00:44
782500 -- [-1399.093] (-1402.886) (-1398.100) (-1393.171) * (-1400.560) (-1393.327) [-1393.018] (-1392.121) -- 0:00:44
783000 -- [-1397.574] (-1401.408) (-1398.023) (-1391.651) * [-1391.788] (-1390.313) (-1395.378) (-1390.654) -- 0:00:44
783500 -- (-1396.968) (-1396.618) [-1398.127] (-1399.100) * [-1393.860] (-1393.487) (-1400.089) (-1392.817) -- 0:00:44
784000 -- (-1402.821) (-1403.100) (-1397.010) [-1410.481] * (-1392.527) (-1388.712) [-1396.944] (-1390.037) -- 0:00:44
784500 -- (-1400.100) (-1398.235) (-1399.594) [-1398.490] * [-1387.990] (-1399.791) (-1400.516) (-1393.191) -- 0:00:43
785000 -- (-1406.075) (-1393.404) [-1395.690] (-1401.035) * [-1392.273] (-1399.200) (-1402.279) (-1393.960) -- 0:00:43
Average standard deviation of split frequencies: 0.004498
785500 -- (-1403.829) [-1400.404] (-1395.195) (-1407.202) * (-1395.890) (-1395.800) (-1392.224) [-1396.084] -- 0:00:43
786000 -- [-1398.256] (-1399.149) (-1396.049) (-1400.739) * (-1397.084) (-1396.126) (-1398.826) [-1390.193] -- 0:00:43
786500 -- [-1391.867] (-1398.645) (-1392.934) (-1404.875) * (-1399.742) (-1389.826) (-1391.811) [-1393.838] -- 0:00:43
787000 -- (-1397.587) (-1392.159) [-1395.747] (-1403.271) * (-1401.961) (-1392.892) [-1394.821] (-1398.645) -- 0:00:43
787500 -- (-1397.700) (-1397.149) [-1397.098] (-1399.442) * (-1407.317) [-1387.279] (-1397.243) (-1394.029) -- 0:00:43
788000 -- [-1398.126] (-1392.858) (-1397.894) (-1402.078) * (-1404.471) (-1398.825) (-1396.646) [-1396.506] -- 0:00:43
788500 -- (-1399.549) [-1386.121] (-1396.679) (-1397.811) * (-1398.149) (-1390.401) (-1391.555) [-1399.873] -- 0:00:43
789000 -- (-1399.019) (-1397.560) (-1403.310) [-1390.298] * (-1398.517) (-1399.679) [-1392.898] (-1391.776) -- 0:00:43
789500 -- (-1396.765) (-1403.236) (-1398.585) [-1391.705] * (-1394.989) (-1390.606) (-1394.801) [-1392.401] -- 0:00:42
790000 -- (-1388.739) [-1397.870] (-1398.211) (-1387.769) * (-1402.681) (-1392.193) [-1394.920] (-1387.738) -- 0:00:42
Average standard deviation of split frequencies: 0.004472
790500 -- [-1391.750] (-1400.876) (-1390.661) (-1393.150) * [-1387.405] (-1393.920) (-1397.638) (-1392.087) -- 0:00:42
791000 -- [-1386.878] (-1394.746) (-1390.240) (-1395.838) * (-1394.767) (-1394.417) [-1391.315] (-1404.443) -- 0:00:42
791500 -- (-1395.383) (-1399.005) (-1404.746) [-1394.274] * (-1400.867) [-1392.936] (-1388.248) (-1394.143) -- 0:00:42
792000 -- (-1399.101) (-1397.168) (-1413.301) [-1389.806] * (-1395.972) (-1387.558) [-1395.495] (-1397.031) -- 0:00:42
792500 -- (-1392.495) (-1398.278) [-1398.872] (-1392.936) * (-1395.216) (-1388.012) [-1389.424] (-1397.382) -- 0:00:42
793000 -- (-1400.402) (-1401.623) [-1397.365] (-1398.477) * [-1386.076] (-1396.506) (-1394.094) (-1403.951) -- 0:00:42
793500 -- (-1399.606) (-1397.369) (-1391.625) [-1392.037] * (-1396.200) (-1400.009) [-1393.400] (-1397.742) -- 0:00:42
794000 -- (-1395.612) (-1396.279) (-1392.012) [-1387.212] * [-1397.130] (-1408.159) (-1389.095) (-1395.316) -- 0:00:42
794500 -- (-1387.654) [-1396.326] (-1392.269) (-1395.231) * (-1394.356) (-1399.097) (-1406.511) [-1396.394] -- 0:00:41
795000 -- [-1394.285] (-1393.034) (-1394.290) (-1406.106) * (-1394.277) [-1390.966] (-1393.387) (-1403.917) -- 0:00:41
Average standard deviation of split frequencies: 0.004442
795500 -- (-1388.360) (-1394.208) (-1403.750) [-1389.200] * (-1390.676) [-1397.536] (-1393.694) (-1392.422) -- 0:00:41
796000 -- (-1394.928) [-1392.600] (-1399.164) (-1402.564) * (-1400.971) [-1390.208] (-1390.050) (-1389.040) -- 0:00:41
796500 -- (-1399.318) (-1392.026) (-1409.646) [-1395.147] * [-1391.117] (-1399.250) (-1398.890) (-1393.784) -- 0:00:41
797000 -- (-1396.394) (-1391.646) (-1397.919) [-1391.618] * (-1398.229) (-1392.822) (-1396.413) [-1393.917] -- 0:00:41
797500 -- (-1393.916) (-1401.540) [-1398.597] (-1398.721) * [-1394.049] (-1399.342) (-1395.603) (-1394.737) -- 0:00:41
798000 -- (-1397.143) [-1396.506] (-1393.061) (-1398.165) * (-1395.645) [-1398.804] (-1403.255) (-1398.927) -- 0:00:41
798500 -- (-1394.144) (-1400.010) (-1397.559) [-1392.775] * (-1394.689) (-1393.242) (-1394.305) [-1388.614] -- 0:00:41
799000 -- (-1399.113) [-1394.206] (-1406.805) (-1393.764) * [-1394.108] (-1395.878) (-1392.465) (-1393.656) -- 0:00:41
799500 -- (-1392.839) (-1393.482) [-1402.950] (-1394.952) * (-1394.050) (-1392.366) (-1394.939) [-1393.182] -- 0:00:40
800000 -- [-1395.680] (-1392.853) (-1396.413) (-1392.633) * (-1400.733) (-1387.759) (-1400.224) [-1395.310] -- 0:00:40
Average standard deviation of split frequencies: 0.004416
800500 -- (-1397.835) [-1392.337] (-1390.852) (-1395.028) * (-1394.380) (-1397.220) (-1399.822) [-1396.245] -- 0:00:40
801000 -- [-1393.555] (-1403.128) (-1398.269) (-1400.933) * [-1392.820] (-1389.643) (-1394.232) (-1391.533) -- 0:00:40
801500 -- [-1391.487] (-1400.065) (-1392.109) (-1388.241) * (-1402.109) (-1399.401) (-1398.703) [-1394.655] -- 0:00:40
802000 -- (-1392.979) (-1399.364) (-1390.351) [-1390.351] * (-1392.173) [-1393.179] (-1392.679) (-1391.409) -- 0:00:40
802500 -- (-1398.575) [-1390.696] (-1396.926) (-1399.207) * (-1396.684) [-1394.500] (-1392.428) (-1402.297) -- 0:00:40
803000 -- [-1400.779] (-1389.014) (-1391.407) (-1392.869) * [-1391.789] (-1391.789) (-1397.305) (-1397.333) -- 0:00:40
803500 -- (-1418.773) (-1395.449) (-1399.940) [-1392.900] * (-1400.975) [-1394.821] (-1393.191) (-1402.700) -- 0:00:40
804000 -- (-1404.552) [-1391.117] (-1395.314) (-1398.048) * (-1396.612) [-1393.233] (-1394.507) (-1393.275) -- 0:00:39
804500 -- (-1397.813) [-1387.395] (-1392.794) (-1396.147) * (-1392.214) (-1394.733) [-1388.794] (-1395.447) -- 0:00:39
805000 -- (-1400.732) (-1388.449) [-1393.305] (-1396.520) * [-1390.774] (-1395.079) (-1394.090) (-1397.876) -- 0:00:39
Average standard deviation of split frequencies: 0.004581
805500 -- (-1394.662) [-1392.208] (-1388.337) (-1394.721) * (-1390.671) (-1403.773) [-1399.871] (-1392.227) -- 0:00:39
806000 -- (-1391.875) (-1394.526) (-1396.348) [-1396.775] * [-1399.272] (-1400.554) (-1398.030) (-1398.828) -- 0:00:39
806500 -- (-1394.825) (-1391.835) [-1391.305] (-1389.098) * (-1401.586) (-1398.787) [-1391.972] (-1399.053) -- 0:00:39
807000 -- (-1396.881) [-1394.255] (-1399.759) (-1393.092) * (-1403.836) [-1391.612] (-1390.549) (-1393.908) -- 0:00:39
807500 -- [-1397.636] (-1397.004) (-1396.565) (-1393.897) * [-1396.503] (-1387.021) (-1388.821) (-1392.728) -- 0:00:39
808000 -- (-1396.369) (-1396.928) [-1396.632] (-1394.886) * [-1393.242] (-1391.694) (-1405.852) (-1391.493) -- 0:00:39
808500 -- (-1393.767) (-1396.317) (-1393.462) [-1390.553] * (-1400.115) (-1397.717) (-1396.216) [-1392.926] -- 0:00:39
809000 -- [-1392.882] (-1394.597) (-1393.376) (-1389.938) * (-1390.837) [-1397.383] (-1405.765) (-1390.360) -- 0:00:38
809500 -- [-1394.002] (-1401.777) (-1391.088) (-1399.806) * (-1398.849) (-1397.722) (-1420.042) [-1396.335] -- 0:00:38
810000 -- (-1392.598) (-1402.964) [-1388.747] (-1406.377) * (-1394.730) [-1399.390] (-1409.208) (-1392.534) -- 0:00:38
Average standard deviation of split frequencies: 0.003974
810500 -- [-1393.051] (-1387.401) (-1404.389) (-1397.904) * (-1394.372) (-1398.864) [-1387.544] (-1394.871) -- 0:00:38
811000 -- (-1397.223) [-1395.967] (-1389.851) (-1399.726) * [-1393.666] (-1402.266) (-1394.881) (-1403.017) -- 0:00:38
811500 -- (-1397.561) [-1393.550] (-1394.634) (-1399.060) * (-1404.894) [-1392.370] (-1395.712) (-1392.962) -- 0:00:38
812000 -- [-1390.553] (-1390.430) (-1393.268) (-1397.252) * (-1392.049) (-1391.959) (-1400.845) [-1396.916] -- 0:00:38
812500 -- (-1396.845) [-1401.434] (-1399.344) (-1396.660) * (-1388.931) [-1393.127] (-1391.050) (-1393.508) -- 0:00:38
813000 -- [-1391.996] (-1399.752) (-1393.178) (-1398.889) * (-1397.863) [-1393.026] (-1396.429) (-1395.522) -- 0:00:38
813500 -- (-1398.839) [-1392.677] (-1391.457) (-1394.075) * (-1393.066) (-1390.968) [-1397.174] (-1400.595) -- 0:00:38
814000 -- (-1396.026) [-1392.335] (-1403.586) (-1390.389) * (-1391.621) (-1406.311) (-1392.881) [-1393.680] -- 0:00:37
814500 -- [-1389.682] (-1400.191) (-1400.954) (-1395.959) * [-1390.434] (-1394.154) (-1395.046) (-1394.317) -- 0:00:37
815000 -- [-1392.158] (-1397.629) (-1392.540) (-1401.104) * (-1394.525) (-1394.279) (-1393.796) [-1391.819] -- 0:00:37
Average standard deviation of split frequencies: 0.003948
815500 -- (-1394.388) [-1396.587] (-1396.831) (-1413.810) * (-1399.510) (-1394.178) [-1389.537] (-1397.901) -- 0:00:37
816000 -- [-1392.196] (-1394.325) (-1395.674) (-1393.610) * [-1395.697] (-1400.803) (-1391.653) (-1392.079) -- 0:00:37
816500 -- (-1392.716) [-1393.620] (-1399.326) (-1396.144) * (-1396.098) (-1400.425) (-1396.958) [-1391.988] -- 0:00:37
817000 -- (-1392.264) (-1395.568) [-1394.580] (-1395.834) * [-1389.385] (-1394.619) (-1397.447) (-1393.742) -- 0:00:37
817500 -- (-1390.049) (-1388.303) (-1391.234) [-1390.279] * [-1397.595] (-1398.021) (-1392.441) (-1394.406) -- 0:00:37
818000 -- [-1397.886] (-1392.715) (-1397.661) (-1397.913) * (-1398.424) (-1395.129) (-1393.449) [-1387.612] -- 0:00:37
818500 -- [-1391.821] (-1393.112) (-1397.120) (-1392.425) * (-1390.728) (-1396.930) [-1390.413] (-1390.018) -- 0:00:37
819000 -- (-1400.556) [-1402.532] (-1389.536) (-1392.749) * (-1394.323) (-1394.528) (-1394.557) [-1392.263] -- 0:00:36
819500 -- (-1400.894) [-1389.822] (-1391.921) (-1387.710) * (-1411.454) (-1388.558) (-1396.774) [-1395.053] -- 0:00:36
820000 -- (-1395.464) (-1394.385) [-1390.468] (-1387.664) * [-1388.072] (-1401.277) (-1391.434) (-1388.471) -- 0:00:36
Average standard deviation of split frequencies: 0.003925
820500 -- [-1393.660] (-1393.252) (-1394.831) (-1400.147) * [-1399.839] (-1408.769) (-1388.633) (-1405.684) -- 0:00:36
821000 -- (-1391.162) [-1392.160] (-1390.906) (-1396.234) * (-1402.167) [-1391.681] (-1394.589) (-1399.478) -- 0:00:36
821500 -- (-1398.563) (-1400.261) [-1389.574] (-1393.746) * (-1406.250) (-1397.398) [-1389.041] (-1392.262) -- 0:00:36
822000 -- (-1390.701) [-1390.737] (-1393.205) (-1394.833) * (-1401.189) (-1395.961) [-1395.598] (-1388.822) -- 0:00:36
822500 -- (-1396.362) (-1396.992) (-1397.880) [-1395.649] * [-1389.371] (-1395.283) (-1393.422) (-1400.194) -- 0:00:36
823000 -- [-1386.794] (-1388.967) (-1390.959) (-1394.269) * (-1393.050) (-1395.940) (-1391.639) [-1393.830] -- 0:00:36
823500 -- [-1396.257] (-1397.938) (-1397.076) (-1392.766) * (-1395.259) (-1394.319) (-1398.712) [-1396.065] -- 0:00:36
824000 -- (-1396.167) (-1392.592) [-1394.501] (-1407.561) * (-1400.122) (-1392.074) (-1399.503) [-1399.915] -- 0:00:35
824500 -- (-1394.974) (-1397.648) (-1397.254) [-1391.149] * (-1398.421) [-1391.850] (-1392.981) (-1393.101) -- 0:00:35
825000 -- (-1396.749) (-1398.368) (-1388.246) [-1395.659] * (-1391.291) (-1394.653) (-1393.878) [-1395.973] -- 0:00:35
Average standard deviation of split frequencies: 0.003900
825500 -- (-1396.280) [-1393.727] (-1401.270) (-1393.645) * (-1395.322) (-1391.958) [-1395.928] (-1393.628) -- 0:00:35
826000 -- (-1403.532) (-1398.762) [-1391.892] (-1392.957) * (-1395.534) (-1399.881) (-1389.103) [-1389.286] -- 0:00:35
826500 -- (-1397.618) (-1400.160) (-1390.967) [-1401.933] * (-1396.655) (-1398.890) [-1395.863] (-1398.520) -- 0:00:35
827000 -- [-1392.227] (-1401.463) (-1386.851) (-1396.502) * (-1394.398) (-1400.137) (-1392.662) [-1390.973] -- 0:00:35
827500 -- [-1398.683] (-1401.979) (-1399.412) (-1393.583) * (-1398.074) [-1391.509] (-1392.942) (-1392.969) -- 0:00:35
828000 -- [-1395.097] (-1400.936) (-1398.675) (-1394.316) * (-1399.438) (-1391.944) [-1397.858] (-1398.603) -- 0:00:35
828500 -- [-1387.260] (-1401.565) (-1400.479) (-1395.100) * (-1396.793) [-1389.190] (-1399.400) (-1393.263) -- 0:00:34
829000 -- (-1395.708) (-1392.487) (-1396.262) [-1389.694] * (-1395.148) [-1395.269] (-1398.423) (-1391.606) -- 0:00:34
829500 -- (-1396.893) (-1394.450) (-1390.923) [-1395.589] * (-1400.982) [-1394.268] (-1389.383) (-1393.960) -- 0:00:34
830000 -- (-1399.128) (-1399.827) [-1390.794] (-1398.330) * [-1396.785] (-1399.265) (-1391.286) (-1391.733) -- 0:00:34
Average standard deviation of split frequencies: 0.004067
830500 -- (-1395.602) (-1397.289) [-1389.227] (-1391.638) * (-1395.372) [-1391.217] (-1397.816) (-1391.828) -- 0:00:34
831000 -- [-1392.759] (-1398.987) (-1400.317) (-1394.127) * (-1392.628) [-1388.544] (-1400.122) (-1392.092) -- 0:00:34
831500 -- (-1387.757) (-1402.195) [-1393.414] (-1392.459) * [-1393.419] (-1411.732) (-1393.092) (-1395.058) -- 0:00:34
832000 -- (-1397.352) [-1393.905] (-1391.173) (-1388.951) * (-1394.575) (-1392.729) (-1398.661) [-1394.062] -- 0:00:34
832500 -- (-1403.220) (-1401.262) [-1389.308] (-1394.597) * (-1391.329) [-1394.104] (-1392.094) (-1395.670) -- 0:00:34
833000 -- [-1388.354] (-1401.323) (-1396.269) (-1390.558) * (-1389.295) [-1388.567] (-1393.158) (-1395.420) -- 0:00:34
833500 -- [-1393.216] (-1396.571) (-1393.257) (-1390.639) * (-1399.094) [-1389.847] (-1396.068) (-1390.780) -- 0:00:33
834000 -- (-1399.815) (-1402.196) (-1392.845) [-1391.332] * (-1393.913) [-1394.111] (-1407.363) (-1396.907) -- 0:00:33
834500 -- (-1404.144) (-1398.052) [-1393.585] (-1393.563) * (-1398.878) [-1390.866] (-1396.150) (-1400.824) -- 0:00:33
835000 -- [-1394.599] (-1390.694) (-1404.658) (-1395.664) * (-1403.142) (-1399.579) (-1396.823) [-1388.505] -- 0:00:33
Average standard deviation of split frequencies: 0.003477
835500 -- (-1398.074) (-1391.569) [-1400.230] (-1394.324) * (-1391.556) [-1390.849] (-1386.814) (-1395.058) -- 0:00:33
836000 -- (-1396.342) (-1394.214) [-1403.776] (-1401.099) * [-1396.095] (-1387.767) (-1393.004) (-1397.338) -- 0:00:33
836500 -- [-1398.288] (-1401.273) (-1396.457) (-1394.487) * (-1391.433) (-1396.088) [-1390.382] (-1404.855) -- 0:00:33
837000 -- [-1388.826] (-1401.508) (-1396.192) (-1397.754) * (-1394.575) [-1391.431] (-1393.206) (-1398.093) -- 0:00:33
837500 -- (-1388.589) (-1404.214) [-1396.370] (-1388.697) * (-1393.336) [-1398.680] (-1393.413) (-1398.306) -- 0:00:33
838000 -- (-1393.266) (-1395.144) (-1405.915) [-1393.071] * (-1391.966) (-1395.535) [-1394.337] (-1397.577) -- 0:00:33
838500 -- (-1392.254) (-1391.730) (-1402.113) [-1390.299] * [-1394.016] (-1388.662) (-1391.062) (-1400.842) -- 0:00:32
839000 -- (-1394.945) (-1399.604) (-1392.327) [-1398.055] * (-1386.994) (-1385.830) [-1391.795] (-1397.481) -- 0:00:32
839500 -- (-1393.030) (-1392.422) [-1400.983] (-1398.442) * (-1396.757) [-1394.837] (-1396.832) (-1392.789) -- 0:00:32
840000 -- (-1399.680) [-1390.501] (-1390.940) (-1403.305) * (-1402.652) [-1391.139] (-1393.264) (-1391.116) -- 0:00:32
Average standard deviation of split frequencies: 0.003458
840500 -- [-1394.653] (-1401.604) (-1396.953) (-1402.207) * (-1393.355) [-1388.024] (-1397.516) (-1395.015) -- 0:00:32
841000 -- (-1392.934) (-1390.834) [-1395.351] (-1396.441) * (-1390.578) (-1388.064) [-1387.339] (-1399.285) -- 0:00:32
841500 -- (-1390.689) (-1402.839) [-1388.697] (-1400.770) * (-1393.187) [-1394.990] (-1394.722) (-1388.795) -- 0:00:32
842000 -- (-1386.696) (-1395.813) [-1395.675] (-1399.456) * (-1395.478) (-1392.168) [-1402.564] (-1396.384) -- 0:00:32
842500 -- [-1391.275] (-1400.114) (-1398.935) (-1405.067) * (-1400.490) (-1405.357) (-1394.870) [-1401.411] -- 0:00:32
843000 -- (-1387.233) (-1392.789) [-1389.457] (-1402.873) * (-1398.385) (-1396.114) (-1396.948) [-1401.951] -- 0:00:32
843500 -- (-1391.280) [-1387.833] (-1394.029) (-1401.572) * (-1395.205) [-1391.334] (-1395.445) (-1392.249) -- 0:00:31
844000 -- (-1397.325) [-1398.025] (-1388.844) (-1401.802) * (-1391.905) [-1388.282] (-1392.492) (-1392.001) -- 0:00:31
844500 -- (-1396.711) [-1392.404] (-1389.888) (-1407.791) * [-1394.399] (-1392.225) (-1400.039) (-1392.394) -- 0:00:31
845000 -- (-1402.859) (-1390.216) (-1394.479) [-1399.052] * (-1403.137) (-1395.178) [-1391.399] (-1400.079) -- 0:00:31
Average standard deviation of split frequencies: 0.003436
845500 -- (-1397.284) [-1391.320] (-1394.348) (-1398.983) * (-1398.472) [-1392.684] (-1393.734) (-1394.673) -- 0:00:31
846000 -- (-1388.050) (-1399.835) (-1395.985) [-1389.059] * (-1397.945) [-1396.306] (-1405.581) (-1395.937) -- 0:00:31
846500 -- (-1390.649) (-1387.422) [-1396.833] (-1390.915) * (-1395.975) (-1397.106) (-1396.499) [-1392.616] -- 0:00:31
847000 -- [-1393.348] (-1389.483) (-1391.116) (-1386.555) * (-1390.447) (-1395.387) (-1404.402) [-1395.827] -- 0:00:31
847500 -- (-1399.112) (-1397.083) (-1390.896) [-1388.099] * (-1390.917) (-1391.176) (-1390.207) [-1393.727] -- 0:00:31
848000 -- (-1403.894) (-1398.342) [-1394.441] (-1394.289) * [-1394.147] (-1398.619) (-1397.468) (-1393.394) -- 0:00:31
848500 -- (-1392.763) [-1390.638] (-1391.854) (-1395.094) * (-1398.110) (-1398.847) (-1396.273) [-1396.281] -- 0:00:30
849000 -- [-1397.034] (-1389.927) (-1395.498) (-1394.143) * (-1388.734) (-1394.376) (-1393.522) [-1401.020] -- 0:00:30
849500 -- (-1387.438) [-1387.927] (-1402.975) (-1391.189) * [-1395.182] (-1394.650) (-1390.806) (-1392.296) -- 0:00:30
850000 -- [-1391.386] (-1393.833) (-1403.290) (-1396.682) * (-1407.394) (-1392.291) [-1393.460] (-1402.226) -- 0:00:30
Average standard deviation of split frequencies: 0.003417
850500 -- (-1402.891) (-1389.052) (-1394.283) [-1387.213] * (-1407.665) (-1408.811) (-1397.788) [-1401.181] -- 0:00:30
851000 -- [-1396.830] (-1399.682) (-1391.955) (-1394.341) * (-1388.306) (-1392.043) (-1392.112) [-1400.153] -- 0:00:30
851500 -- (-1392.532) (-1398.261) (-1392.181) [-1397.660] * (-1394.453) (-1398.279) (-1393.321) [-1392.766] -- 0:00:30
852000 -- [-1393.030] (-1393.141) (-1399.175) (-1390.701) * [-1403.321] (-1393.920) (-1401.259) (-1398.536) -- 0:00:30
852500 -- (-1398.206) (-1399.639) [-1392.802] (-1395.125) * (-1397.497) (-1396.559) (-1404.796) [-1391.970] -- 0:00:30
853000 -- (-1398.556) (-1393.164) (-1399.688) [-1397.874] * [-1391.152] (-1395.827) (-1394.001) (-1395.109) -- 0:00:29
853500 -- (-1398.588) [-1392.133] (-1397.715) (-1394.153) * (-1393.407) [-1394.389] (-1400.248) (-1393.092) -- 0:00:29
854000 -- (-1393.729) (-1400.679) (-1391.641) [-1393.189] * (-1400.614) [-1392.601] (-1398.001) (-1390.672) -- 0:00:29
854500 -- (-1394.074) [-1394.042] (-1392.007) (-1395.548) * (-1397.735) [-1394.308] (-1398.299) (-1398.614) -- 0:00:29
855000 -- (-1395.097) [-1391.013] (-1394.587) (-1389.863) * (-1393.327) [-1394.363] (-1391.010) (-1400.295) -- 0:00:29
Average standard deviation of split frequencies: 0.003304
855500 -- (-1396.204) (-1389.670) (-1389.068) [-1399.483] * (-1392.492) (-1388.770) [-1392.573] (-1397.000) -- 0:00:29
856000 -- (-1396.769) (-1395.256) [-1397.588] (-1398.055) * (-1396.164) [-1387.758] (-1392.565) (-1403.829) -- 0:00:29
856500 -- (-1404.342) (-1403.916) (-1395.600) [-1399.047] * (-1397.696) [-1395.532] (-1391.110) (-1397.128) -- 0:00:29
857000 -- [-1394.807] (-1387.875) (-1398.911) (-1401.898) * (-1395.492) (-1391.518) [-1391.547] (-1392.767) -- 0:00:29
857500 -- (-1390.076) [-1406.397] (-1397.445) (-1393.373) * (-1394.762) (-1396.659) [-1399.820] (-1397.203) -- 0:00:29
858000 -- [-1399.583] (-1398.856) (-1396.713) (-1391.491) * (-1399.650) (-1394.372) [-1390.196] (-1397.081) -- 0:00:28
858500 -- [-1393.796] (-1394.879) (-1400.289) (-1394.164) * (-1395.796) (-1398.044) (-1404.359) [-1391.853] -- 0:00:28
859000 -- (-1391.286) (-1391.085) [-1394.601] (-1396.161) * (-1403.862) (-1394.959) [-1399.433] (-1395.778) -- 0:00:28
859500 -- (-1394.888) (-1396.967) (-1395.014) [-1389.343] * (-1394.614) [-1393.463] (-1394.341) (-1389.673) -- 0:00:28
860000 -- [-1392.252] (-1401.575) (-1400.006) (-1401.013) * (-1390.296) (-1392.679) (-1411.291) [-1390.673] -- 0:00:28
Average standard deviation of split frequencies: 0.003104
860500 -- [-1395.394] (-1408.237) (-1388.756) (-1393.312) * (-1389.080) (-1393.724) [-1395.396] (-1395.134) -- 0:00:28
861000 -- [-1396.074] (-1397.145) (-1401.072) (-1401.858) * (-1402.831) [-1388.196] (-1397.355) (-1397.387) -- 0:00:28
861500 -- (-1391.345) (-1392.738) [-1393.697] (-1388.888) * (-1391.543) (-1399.656) (-1405.493) [-1398.136] -- 0:00:28
862000 -- (-1394.531) [-1399.384] (-1399.015) (-1388.392) * [-1394.805] (-1398.150) (-1399.112) (-1395.625) -- 0:00:28
862500 -- (-1395.710) (-1412.682) (-1401.357) [-1391.862] * [-1393.072] (-1392.502) (-1401.667) (-1397.583) -- 0:00:28
863000 -- (-1398.799) (-1412.549) [-1395.008] (-1396.704) * (-1396.972) [-1402.042] (-1392.182) (-1394.744) -- 0:00:27
863500 -- [-1389.298] (-1398.909) (-1400.425) (-1394.428) * (-1388.153) (-1390.836) (-1395.338) [-1388.896] -- 0:00:27
864000 -- (-1392.981) (-1390.751) [-1400.141] (-1392.830) * (-1395.201) (-1394.398) [-1390.421] (-1390.333) -- 0:00:27
864500 -- (-1399.163) [-1392.238] (-1399.940) (-1395.905) * (-1391.769) (-1401.495) (-1393.303) [-1388.115] -- 0:00:27
865000 -- [-1395.753] (-1394.233) (-1394.691) (-1399.351) * [-1393.679] (-1394.835) (-1392.615) (-1395.244) -- 0:00:27
Average standard deviation of split frequencies: 0.003266
865500 -- [-1394.437] (-1402.435) (-1394.348) (-1396.813) * (-1389.849) (-1395.603) [-1393.093] (-1395.241) -- 0:00:27
866000 -- (-1390.833) (-1396.827) [-1391.332] (-1393.634) * (-1394.012) (-1387.645) (-1395.747) [-1389.665] -- 0:00:27
866500 -- [-1389.242] (-1389.943) (-1393.654) (-1390.769) * (-1395.893) [-1390.229] (-1394.760) (-1389.780) -- 0:00:27
867000 -- (-1394.533) [-1397.412] (-1392.701) (-1389.713) * [-1385.677] (-1392.929) (-1394.586) (-1403.653) -- 0:00:27
867500 -- (-1398.330) [-1398.980] (-1389.752) (-1399.404) * [-1398.991] (-1396.173) (-1391.227) (-1390.826) -- 0:00:27
868000 -- (-1392.778) [-1390.610] (-1395.368) (-1401.676) * (-1396.840) (-1399.139) [-1391.130] (-1396.107) -- 0:00:26
868500 -- [-1395.641] (-1405.369) (-1400.838) (-1395.812) * [-1398.996] (-1400.769) (-1397.140) (-1389.292) -- 0:00:26
869000 -- (-1393.286) [-1396.539] (-1396.366) (-1391.410) * [-1392.594] (-1393.300) (-1397.731) (-1400.991) -- 0:00:26
869500 -- (-1396.401) [-1395.635] (-1400.290) (-1398.517) * [-1393.228] (-1396.434) (-1396.080) (-1398.127) -- 0:00:26
870000 -- [-1393.285] (-1398.707) (-1394.936) (-1392.605) * (-1391.463) [-1391.686] (-1413.201) (-1401.635) -- 0:00:26
Average standard deviation of split frequencies: 0.003429
870500 -- (-1401.219) [-1386.817] (-1402.095) (-1398.649) * [-1401.132] (-1395.811) (-1396.856) (-1390.406) -- 0:00:26
871000 -- (-1389.058) [-1390.268] (-1394.877) (-1405.449) * [-1393.447] (-1391.243) (-1400.296) (-1387.342) -- 0:00:26
871500 -- (-1393.117) (-1387.087) [-1394.123] (-1394.426) * [-1395.408] (-1404.918) (-1404.393) (-1394.290) -- 0:00:26
872000 -- (-1389.346) (-1387.549) (-1405.967) [-1390.780] * (-1393.159) (-1415.185) (-1399.022) [-1387.565] -- 0:00:26
872500 -- (-1393.261) (-1394.173) [-1396.734] (-1394.962) * (-1397.253) (-1395.755) (-1391.067) [-1395.350] -- 0:00:26
873000 -- [-1391.347] (-1393.654) (-1395.005) (-1400.963) * (-1395.716) (-1399.654) [-1387.062] (-1399.376) -- 0:00:25
873500 -- (-1390.384) (-1396.538) [-1395.813] (-1390.734) * (-1393.107) (-1397.041) (-1397.291) [-1401.969] -- 0:00:25
874000 -- (-1392.051) (-1392.022) [-1392.432] (-1394.097) * (-1403.549) (-1396.735) [-1390.656] (-1399.019) -- 0:00:25
874500 -- [-1392.238] (-1395.606) (-1400.582) (-1393.128) * (-1396.326) (-1394.797) [-1395.541] (-1396.534) -- 0:00:25
875000 -- (-1390.583) [-1402.966] (-1400.445) (-1395.032) * (-1395.347) (-1403.689) (-1400.542) [-1406.151] -- 0:00:25
Average standard deviation of split frequencies: 0.003588
875500 -- (-1394.366) (-1400.102) [-1398.965] (-1398.397) * (-1397.806) (-1399.906) [-1396.692] (-1390.723) -- 0:00:25
876000 -- (-1392.989) [-1395.320] (-1394.686) (-1395.226) * (-1389.986) (-1390.581) (-1395.731) [-1389.267] -- 0:00:25
876500 -- (-1397.008) (-1400.270) [-1388.933] (-1389.569) * (-1396.893) (-1391.445) (-1393.905) [-1391.002] -- 0:00:25
877000 -- (-1390.902) (-1403.613) (-1395.142) [-1387.934] * [-1397.083] (-1394.665) (-1400.993) (-1391.079) -- 0:00:25
877500 -- [-1391.485] (-1394.022) (-1391.871) (-1393.961) * (-1399.228) (-1399.062) (-1393.674) [-1397.998] -- 0:00:24
878000 -- (-1400.562) [-1397.205] (-1394.511) (-1388.572) * (-1397.956) (-1398.339) [-1392.834] (-1399.666) -- 0:00:24
878500 -- (-1399.737) (-1404.500) [-1395.070] (-1392.794) * (-1396.175) (-1398.829) [-1396.201] (-1394.476) -- 0:00:24
879000 -- (-1391.694) (-1400.080) (-1392.088) [-1391.499] * (-1393.715) [-1395.789] (-1392.336) (-1390.484) -- 0:00:24
879500 -- (-1397.966) [-1386.984] (-1400.423) (-1395.641) * (-1402.018) (-1392.223) [-1397.158] (-1388.786) -- 0:00:24
880000 -- (-1399.526) [-1394.971] (-1393.936) (-1395.455) * [-1400.196] (-1389.405) (-1396.423) (-1390.521) -- 0:00:24
Average standard deviation of split frequencies: 0.004104
880500 -- (-1398.169) (-1388.215) (-1397.933) [-1395.864] * [-1397.086] (-1394.268) (-1394.800) (-1394.026) -- 0:00:24
881000 -- (-1400.371) [-1395.904] (-1396.567) (-1398.546) * (-1390.945) (-1397.378) (-1391.412) [-1394.473] -- 0:00:24
881500 -- (-1390.690) (-1388.543) (-1395.572) [-1393.524] * (-1397.281) [-1389.856] (-1391.373) (-1398.114) -- 0:00:24
882000 -- [-1392.414] (-1390.342) (-1398.335) (-1394.754) * (-1393.291) (-1390.744) (-1391.168) [-1392.820] -- 0:00:24
882500 -- (-1401.785) [-1388.936] (-1394.372) (-1397.822) * (-1397.463) (-1398.692) [-1390.886] (-1397.413) -- 0:00:23
883000 -- (-1405.022) [-1388.606] (-1394.370) (-1398.666) * (-1399.026) [-1394.740] (-1392.759) (-1389.759) -- 0:00:23
883500 -- [-1393.360] (-1393.049) (-1397.481) (-1401.454) * (-1391.603) [-1402.756] (-1394.319) (-1393.368) -- 0:00:23
884000 -- (-1392.547) (-1393.847) [-1390.081] (-1393.727) * (-1395.983) [-1393.294] (-1408.485) (-1400.580) -- 0:00:23
884500 -- (-1397.305) (-1392.801) (-1394.796) [-1394.050] * (-1400.772) (-1398.322) (-1394.849) [-1395.606] -- 0:00:23
885000 -- (-1400.342) (-1395.333) [-1399.532] (-1399.427) * [-1391.982] (-1403.100) (-1392.852) (-1391.743) -- 0:00:23
Average standard deviation of split frequencies: 0.004434
885500 -- (-1402.047) (-1398.934) [-1397.285] (-1398.807) * (-1396.468) (-1396.801) [-1392.993] (-1402.917) -- 0:00:23
886000 -- [-1394.043] (-1393.928) (-1400.780) (-1401.080) * (-1398.183) (-1395.605) [-1387.644] (-1394.391) -- 0:00:23
886500 -- (-1399.725) (-1401.296) [-1396.307] (-1395.402) * [-1396.487] (-1402.370) (-1396.478) (-1400.461) -- 0:00:23
887000 -- (-1397.424) [-1391.700] (-1392.722) (-1394.653) * (-1390.440) [-1394.290] (-1393.431) (-1396.500) -- 0:00:23
887500 -- (-1392.367) (-1395.211) (-1391.596) [-1397.995] * (-1391.768) (-1396.299) [-1392.298] (-1394.332) -- 0:00:22
888000 -- [-1388.779] (-1394.606) (-1394.266) (-1402.358) * [-1393.595] (-1394.641) (-1396.354) (-1397.490) -- 0:00:22
888500 -- [-1388.681] (-1394.289) (-1396.121) (-1393.076) * [-1393.888] (-1396.156) (-1392.616) (-1391.720) -- 0:00:22
889000 -- (-1406.156) [-1387.781] (-1395.142) (-1403.431) * (-1395.537) (-1388.554) [-1394.582] (-1395.957) -- 0:00:22
889500 -- [-1394.196] (-1389.041) (-1391.044) (-1392.600) * (-1390.488) [-1393.265] (-1401.039) (-1388.447) -- 0:00:22
890000 -- [-1386.799] (-1391.934) (-1396.348) (-1390.731) * (-1399.717) [-1389.832] (-1393.972) (-1390.022) -- 0:00:22
Average standard deviation of split frequencies: 0.004234
890500 -- (-1396.856) [-1388.890] (-1393.841) (-1392.254) * (-1386.478) (-1396.361) [-1394.912] (-1397.621) -- 0:00:22
891000 -- (-1395.527) (-1399.535) (-1398.767) [-1393.630] * (-1391.842) (-1395.502) (-1391.317) [-1395.358] -- 0:00:22
891500 -- (-1401.910) (-1400.944) [-1394.278] (-1401.865) * (-1397.866) [-1395.129] (-1394.328) (-1397.778) -- 0:00:22
892000 -- (-1398.314) (-1393.750) (-1391.240) [-1396.476] * (-1395.439) [-1390.650] (-1399.606) (-1404.055) -- 0:00:22
892500 -- (-1410.565) [-1400.603] (-1392.567) (-1397.456) * (-1399.399) (-1394.766) (-1397.968) [-1391.534] -- 0:00:21
893000 -- (-1403.849) (-1401.142) [-1393.078] (-1401.942) * (-1400.740) (-1398.235) [-1387.829] (-1393.485) -- 0:00:21
893500 -- (-1403.377) (-1401.902) [-1392.309] (-1401.220) * (-1394.844) (-1388.112) [-1393.793] (-1400.601) -- 0:00:21
894000 -- (-1395.003) (-1394.969) (-1392.455) [-1395.058] * (-1390.663) (-1397.026) [-1397.815] (-1397.919) -- 0:00:21
894500 -- (-1406.355) [-1390.968] (-1399.223) (-1394.730) * (-1401.998) (-1399.394) (-1391.753) [-1398.366] -- 0:00:21
895000 -- (-1399.845) [-1392.648] (-1406.190) (-1406.692) * [-1396.353] (-1393.055) (-1406.869) (-1395.421) -- 0:00:21
Average standard deviation of split frequencies: 0.004034
895500 -- [-1389.721] (-1403.609) (-1390.356) (-1400.266) * [-1391.908] (-1392.469) (-1388.839) (-1398.754) -- 0:00:21
896000 -- (-1402.281) [-1392.933] (-1388.828) (-1397.175) * (-1400.131) [-1393.767] (-1389.017) (-1398.691) -- 0:00:21
896500 -- [-1394.209] (-1395.233) (-1393.255) (-1395.484) * (-1391.311) (-1394.286) (-1396.084) [-1395.241] -- 0:00:21
897000 -- (-1393.939) (-1391.549) [-1398.398] (-1397.159) * [-1388.218] (-1394.242) (-1388.599) (-1391.311) -- 0:00:21
897500 -- (-1397.929) [-1393.974] (-1390.365) (-1399.034) * (-1402.548) (-1394.784) [-1390.544] (-1388.029) -- 0:00:20
898000 -- [-1393.183] (-1392.576) (-1403.913) (-1394.836) * [-1400.560] (-1395.261) (-1393.357) (-1394.573) -- 0:00:20
898500 -- (-1394.746) [-1393.030] (-1405.426) (-1396.188) * (-1392.065) (-1397.312) [-1391.551] (-1393.874) -- 0:00:20
899000 -- (-1393.935) (-1392.712) (-1397.096) [-1386.327] * (-1396.287) (-1397.439) [-1390.962] (-1396.393) -- 0:00:20
899500 -- (-1401.572) [-1395.454] (-1392.887) (-1391.751) * (-1396.624) [-1391.920] (-1392.983) (-1393.485) -- 0:00:20
900000 -- (-1405.608) (-1392.743) [-1387.680] (-1393.398) * (-1391.965) [-1390.622] (-1391.058) (-1391.457) -- 0:00:20
Average standard deviation of split frequencies: 0.004362
900500 -- (-1398.546) (-1391.378) (-1393.894) [-1395.935] * (-1392.236) [-1389.517] (-1400.011) (-1395.376) -- 0:00:20
901000 -- (-1393.090) (-1395.616) [-1393.325] (-1395.482) * (-1395.355) (-1398.488) [-1388.974] (-1400.437) -- 0:00:20
901500 -- [-1388.552] (-1388.875) (-1391.888) (-1393.903) * [-1393.118] (-1393.138) (-1390.552) (-1389.904) -- 0:00:20
902000 -- (-1390.321) [-1393.818] (-1392.175) (-1395.790) * (-1414.062) (-1395.538) [-1392.880] (-1402.170) -- 0:00:19
902500 -- (-1392.150) (-1391.531) [-1394.897] (-1395.992) * (-1398.028) (-1388.266) (-1390.483) [-1389.247] -- 0:00:19
903000 -- (-1391.758) (-1390.118) [-1392.043] (-1390.396) * [-1394.292] (-1395.328) (-1396.961) (-1409.600) -- 0:00:19
903500 -- (-1405.979) [-1393.965] (-1399.289) (-1395.446) * [-1395.244] (-1395.020) (-1401.256) (-1391.891) -- 0:00:19
904000 -- (-1392.597) [-1390.558] (-1394.132) (-1396.221) * (-1402.928) (-1397.620) (-1399.165) [-1389.487] -- 0:00:19
904500 -- (-1395.452) [-1391.828] (-1394.395) (-1390.581) * [-1388.791] (-1400.365) (-1398.127) (-1403.107) -- 0:00:19
905000 -- (-1395.142) (-1392.227) [-1400.585] (-1395.416) * (-1391.161) (-1394.475) [-1392.669] (-1392.235) -- 0:00:19
Average standard deviation of split frequencies: 0.004856
905500 -- (-1408.619) (-1392.710) [-1389.884] (-1401.351) * (-1401.389) (-1399.637) (-1397.723) [-1392.029] -- 0:00:19
906000 -- [-1393.472] (-1396.845) (-1403.204) (-1401.580) * (-1389.469) (-1397.134) [-1400.164] (-1392.942) -- 0:00:19
906500 -- [-1399.650] (-1395.380) (-1395.253) (-1403.027) * (-1392.670) (-1397.203) [-1390.124] (-1398.503) -- 0:00:19
907000 -- (-1395.409) (-1393.705) [-1390.186] (-1401.613) * (-1396.932) (-1403.288) [-1400.240] (-1398.754) -- 0:00:18
907500 -- (-1389.996) (-1396.080) [-1389.093] (-1401.198) * [-1385.904] (-1399.220) (-1396.770) (-1394.456) -- 0:00:18
908000 -- (-1389.939) [-1395.585] (-1394.228) (-1392.578) * (-1399.770) [-1391.403] (-1391.501) (-1397.082) -- 0:00:18
908500 -- (-1391.978) [-1388.895] (-1397.452) (-1404.043) * (-1397.180) (-1392.797) (-1397.839) [-1392.184] -- 0:00:18
909000 -- (-1394.798) (-1391.459) (-1399.993) [-1392.312] * (-1393.147) (-1392.126) (-1410.874) [-1399.502] -- 0:00:18
909500 -- (-1391.185) [-1397.522] (-1403.838) (-1390.571) * (-1396.295) (-1397.254) [-1404.222] (-1397.987) -- 0:00:18
910000 -- [-1389.455] (-1403.222) (-1401.118) (-1397.895) * (-1398.106) (-1404.130) (-1404.733) [-1392.443] -- 0:00:18
Average standard deviation of split frequencies: 0.004573
910500 -- [-1391.061] (-1400.672) (-1395.165) (-1394.598) * (-1398.865) (-1397.903) (-1402.373) [-1392.724] -- 0:00:18
911000 -- (-1391.774) (-1392.886) [-1391.599] (-1398.718) * (-1391.051) [-1394.872] (-1388.768) (-1400.230) -- 0:00:18
911500 -- (-1394.494) [-1393.670] (-1397.071) (-1393.216) * (-1399.577) (-1400.917) (-1393.441) [-1388.212] -- 0:00:18
912000 -- (-1398.077) (-1393.025) (-1390.715) [-1398.136] * (-1391.111) (-1400.383) [-1398.710] (-1392.652) -- 0:00:17
912500 -- (-1395.009) (-1389.896) (-1395.234) [-1391.459] * (-1399.552) (-1389.687) (-1396.172) [-1403.159] -- 0:00:17
913000 -- [-1392.193] (-1392.386) (-1400.043) (-1398.467) * (-1393.229) [-1394.475] (-1403.990) (-1395.869) -- 0:00:17
913500 -- (-1391.758) [-1391.490] (-1401.627) (-1400.026) * [-1387.194] (-1395.578) (-1399.938) (-1392.801) -- 0:00:17
914000 -- (-1396.323) [-1396.169] (-1396.962) (-1404.208) * (-1390.358) (-1392.770) [-1391.339] (-1402.417) -- 0:00:17
914500 -- (-1400.469) [-1389.699] (-1391.134) (-1397.530) * (-1391.283) (-1395.047) [-1389.443] (-1405.100) -- 0:00:17
915000 -- (-1394.020) [-1394.459] (-1394.134) (-1394.896) * (-1394.140) (-1399.736) [-1390.932] (-1393.541) -- 0:00:17
Average standard deviation of split frequencies: 0.004374
915500 -- (-1400.037) (-1395.473) (-1409.308) [-1393.692] * (-1406.365) [-1393.213] (-1388.182) (-1388.891) -- 0:00:17
916000 -- [-1391.873] (-1393.468) (-1399.203) (-1399.220) * (-1390.079) [-1387.333] (-1396.657) (-1398.223) -- 0:00:17
916500 -- (-1396.175) (-1395.650) (-1395.680) [-1394.767] * (-1410.808) [-1400.153] (-1406.664) (-1405.428) -- 0:00:17
917000 -- (-1397.575) (-1392.835) [-1396.706] (-1393.932) * (-1391.392) (-1396.827) (-1392.948) [-1402.708] -- 0:00:16
917500 -- [-1395.984] (-1402.632) (-1396.446) (-1393.734) * [-1393.127] (-1398.420) (-1394.074) (-1402.772) -- 0:00:16
918000 -- (-1400.922) [-1393.894] (-1396.532) (-1395.541) * [-1392.144] (-1397.739) (-1389.846) (-1400.749) -- 0:00:16
918500 -- [-1394.375] (-1397.057) (-1394.107) (-1394.321) * (-1394.804) (-1399.800) [-1397.010] (-1407.594) -- 0:00:16
919000 -- (-1403.700) (-1392.429) (-1398.714) [-1400.033] * [-1392.136] (-1391.649) (-1393.488) (-1394.675) -- 0:00:16
919500 -- (-1398.394) (-1397.229) [-1391.383] (-1400.449) * (-1395.745) [-1390.973] (-1392.743) (-1400.674) -- 0:00:16
920000 -- (-1394.142) (-1394.026) (-1385.270) [-1394.653] * [-1393.652] (-1392.256) (-1398.292) (-1395.724) -- 0:00:16
Average standard deviation of split frequencies: 0.004182
920500 -- (-1398.459) (-1393.090) (-1388.447) [-1390.068] * (-1400.626) (-1392.950) [-1402.893] (-1399.501) -- 0:00:16
921000 -- [-1394.618] (-1391.974) (-1392.958) (-1387.661) * (-1402.572) (-1395.455) [-1392.808] (-1390.129) -- 0:00:16
921500 -- (-1394.886) [-1398.524] (-1398.861) (-1390.136) * (-1403.715) (-1394.688) (-1396.519) [-1389.172] -- 0:00:16
922000 -- (-1395.272) (-1395.803) [-1390.696] (-1390.188) * (-1401.085) (-1403.098) [-1397.087] (-1404.034) -- 0:00:15
922500 -- (-1391.821) (-1396.342) [-1391.598] (-1393.294) * (-1389.987) (-1394.808) [-1400.806] (-1400.686) -- 0:00:15
923000 -- (-1403.943) (-1396.706) [-1396.017] (-1397.279) * (-1394.757) (-1392.293) (-1399.639) [-1394.707] -- 0:00:15
923500 -- (-1394.738) (-1404.575) (-1415.856) [-1402.989] * (-1392.186) [-1395.307] (-1392.688) (-1393.921) -- 0:00:15
924000 -- [-1403.510] (-1403.669) (-1398.434) (-1396.825) * (-1398.711) (-1401.676) [-1394.642] (-1404.008) -- 0:00:15
924500 -- (-1391.789) [-1384.905] (-1401.367) (-1405.892) * (-1401.267) [-1392.544] (-1400.080) (-1394.449) -- 0:00:15
925000 -- (-1404.803) [-1390.104] (-1400.420) (-1406.874) * (-1398.668) (-1399.542) [-1394.364] (-1392.941) -- 0:00:15
Average standard deviation of split frequencies: 0.004327
925500 -- (-1392.679) (-1391.669) (-1392.110) [-1396.672] * (-1401.766) (-1388.942) (-1389.646) [-1386.463] -- 0:00:15
926000 -- (-1395.759) [-1389.958] (-1395.327) (-1399.663) * [-1404.315] (-1391.061) (-1394.293) (-1394.814) -- 0:00:15
926500 -- (-1392.043) [-1393.193] (-1399.631) (-1391.124) * (-1395.592) (-1396.315) (-1395.198) [-1390.565] -- 0:00:14
927000 -- [-1390.259] (-1396.216) (-1397.074) (-1395.413) * (-1399.460) (-1405.198) [-1392.540] (-1402.714) -- 0:00:14
927500 -- (-1392.470) (-1403.403) [-1394.742] (-1392.789) * (-1398.101) (-1395.167) [-1387.913] (-1395.206) -- 0:00:14
928000 -- [-1394.712] (-1402.405) (-1390.551) (-1393.836) * (-1393.490) [-1402.456] (-1393.506) (-1390.020) -- 0:00:14
928500 -- (-1399.114) (-1398.747) [-1388.435] (-1394.411) * [-1403.936] (-1399.018) (-1396.483) (-1399.265) -- 0:00:14
929000 -- [-1393.618] (-1400.933) (-1392.629) (-1395.559) * (-1396.067) [-1393.400] (-1399.956) (-1400.474) -- 0:00:14
929500 -- (-1397.675) (-1394.137) (-1395.077) [-1397.652] * (-1406.003) (-1399.673) [-1390.223] (-1396.118) -- 0:00:14
930000 -- (-1392.900) (-1393.519) (-1394.463) [-1395.088] * [-1402.686] (-1392.369) (-1401.183) (-1400.692) -- 0:00:14
Average standard deviation of split frequencies: 0.004981
930500 -- [-1395.762] (-1399.636) (-1390.626) (-1400.362) * [-1393.094] (-1395.817) (-1395.404) (-1395.878) -- 0:00:14
931000 -- [-1396.961] (-1397.238) (-1397.566) (-1398.913) * [-1396.325] (-1391.572) (-1397.555) (-1393.859) -- 0:00:14
931500 -- (-1404.335) [-1393.134] (-1390.503) (-1390.702) * [-1393.651] (-1399.356) (-1400.967) (-1406.283) -- 0:00:13
932000 -- (-1396.707) (-1389.524) (-1398.749) [-1398.748] * [-1389.141] (-1396.049) (-1401.812) (-1393.844) -- 0:00:13
932500 -- (-1405.787) (-1388.138) (-1394.020) [-1397.059] * [-1400.929] (-1393.763) (-1397.293) (-1390.035) -- 0:00:13
933000 -- [-1394.624] (-1402.584) (-1399.149) (-1400.325) * (-1392.048) (-1396.325) (-1403.181) [-1399.434] -- 0:00:13
933500 -- (-1396.227) [-1394.283] (-1393.769) (-1399.680) * (-1392.791) [-1401.906] (-1402.872) (-1405.528) -- 0:00:13
934000 -- [-1391.332] (-1390.603) (-1392.468) (-1400.812) * (-1398.447) (-1400.795) [-1388.563] (-1390.765) -- 0:00:13
934500 -- [-1393.134] (-1399.103) (-1402.164) (-1397.464) * [-1392.714] (-1394.465) (-1389.973) (-1397.639) -- 0:00:13
935000 -- (-1395.672) (-1404.590) (-1395.907) [-1394.454] * [-1394.336] (-1389.416) (-1397.804) (-1397.912) -- 0:00:13
Average standard deviation of split frequencies: 0.004449
935500 -- (-1400.648) (-1405.598) (-1401.661) [-1388.992] * [-1397.729] (-1390.560) (-1387.907) (-1393.633) -- 0:00:13
936000 -- (-1400.062) (-1396.377) (-1392.696) [-1390.170] * (-1404.879) (-1388.787) (-1396.555) [-1391.263] -- 0:00:13
936500 -- [-1394.007] (-1400.596) (-1402.793) (-1396.975) * (-1401.392) (-1400.038) (-1394.545) [-1398.916] -- 0:00:12
937000 -- (-1400.046) (-1399.640) [-1388.350] (-1402.114) * (-1402.450) (-1397.347) (-1391.310) [-1393.987] -- 0:00:12
937500 -- (-1405.708) (-1406.917) [-1394.630] (-1394.942) * [-1393.400] (-1393.780) (-1400.457) (-1399.547) -- 0:00:12
938000 -- (-1396.086) [-1396.304] (-1397.432) (-1409.937) * [-1395.277] (-1398.569) (-1400.550) (-1389.502) -- 0:00:12
938500 -- [-1389.989] (-1392.590) (-1397.945) (-1395.109) * (-1392.850) (-1392.585) [-1396.003] (-1398.366) -- 0:00:12
939000 -- (-1390.883) (-1394.929) [-1391.785] (-1387.603) * (-1401.011) (-1400.217) (-1392.840) [-1393.128] -- 0:00:12
939500 -- (-1398.974) [-1396.386] (-1395.867) (-1392.319) * (-1400.950) (-1401.058) (-1392.115) [-1393.863] -- 0:00:12
940000 -- (-1394.072) (-1392.301) [-1397.232] (-1396.401) * (-1397.625) (-1391.918) [-1388.526] (-1391.635) -- 0:00:12
Average standard deviation of split frequencies: 0.004260
940500 -- (-1390.363) [-1392.603] (-1395.053) (-1397.655) * [-1399.693] (-1392.885) (-1403.344) (-1397.351) -- 0:00:12
941000 -- (-1391.035) [-1395.458] (-1389.197) (-1397.497) * (-1397.695) (-1390.753) [-1390.610] (-1402.380) -- 0:00:12
941500 -- (-1395.000) (-1401.089) (-1400.035) [-1393.543] * (-1395.660) [-1391.456] (-1388.832) (-1396.168) -- 0:00:11
942000 -- (-1394.783) [-1387.262] (-1395.652) (-1392.539) * (-1396.759) (-1399.125) [-1392.067] (-1397.151) -- 0:00:11
942500 -- (-1398.476) [-1389.490] (-1390.242) (-1394.096) * (-1395.516) (-1391.813) [-1392.973] (-1396.493) -- 0:00:11
943000 -- (-1390.745) (-1389.355) (-1392.498) [-1392.971] * (-1399.688) (-1396.932) [-1396.379] (-1401.575) -- 0:00:11
943500 -- (-1395.677) (-1397.874) (-1391.585) [-1391.130] * (-1397.270) (-1394.999) [-1390.843] (-1388.950) -- 0:00:11
944000 -- (-1393.885) (-1393.784) (-1394.119) [-1392.031] * (-1395.835) (-1391.888) [-1396.951] (-1395.235) -- 0:00:11
944500 -- (-1392.083) (-1394.812) (-1402.769) [-1397.725] * (-1393.650) [-1395.715] (-1407.249) (-1394.171) -- 0:00:11
945000 -- (-1396.436) [-1393.543] (-1402.635) (-1392.802) * (-1395.078) (-1394.099) [-1395.824] (-1395.026) -- 0:00:11
Average standard deviation of split frequencies: 0.004402
945500 -- (-1397.873) (-1401.920) [-1393.799] (-1389.850) * (-1396.862) (-1395.450) [-1395.931] (-1390.958) -- 0:00:11
946000 -- (-1398.671) [-1398.612] (-1397.947) (-1395.218) * (-1404.535) [-1399.173] (-1397.809) (-1390.218) -- 0:00:11
946500 -- [-1391.933] (-1390.341) (-1397.410) (-1403.059) * (-1392.401) (-1403.356) [-1394.652] (-1394.910) -- 0:00:10
947000 -- (-1388.511) (-1392.860) [-1392.700] (-1396.527) * (-1393.831) [-1388.111] (-1394.850) (-1391.392) -- 0:00:10
947500 -- [-1397.730] (-1391.651) (-1397.133) (-1391.508) * (-1403.252) [-1394.018] (-1395.670) (-1397.694) -- 0:00:10
948000 -- (-1394.709) (-1393.022) (-1393.980) [-1391.132] * (-1398.642) [-1401.864] (-1394.713) (-1402.863) -- 0:00:10
948500 -- (-1399.661) (-1403.616) (-1389.787) [-1393.085] * (-1393.803) [-1394.446] (-1397.744) (-1396.784) -- 0:00:10
949000 -- (-1405.403) (-1390.384) (-1400.040) [-1389.421] * (-1397.663) (-1393.856) (-1397.265) [-1390.386] -- 0:00:10
949500 -- [-1396.939] (-1396.383) (-1399.029) (-1397.851) * (-1395.466) (-1395.661) (-1395.326) [-1399.982] -- 0:00:10
950000 -- (-1387.411) [-1392.317] (-1397.149) (-1393.429) * (-1401.271) (-1405.705) (-1397.061) [-1399.759] -- 0:00:10
Average standard deviation of split frequencies: 0.004380
950500 -- (-1403.944) [-1392.084] (-1398.201) (-1399.960) * (-1391.002) (-1397.841) (-1395.378) [-1399.428] -- 0:00:10
951000 -- (-1398.309) (-1400.905) [-1397.787] (-1394.687) * (-1392.027) (-1395.144) (-1398.509) [-1390.625] -- 0:00:09
951500 -- (-1390.660) (-1391.926) (-1389.776) [-1394.554] * (-1396.395) (-1389.455) (-1405.937) [-1390.605] -- 0:00:09
952000 -- (-1398.614) (-1402.441) [-1389.216] (-1396.398) * (-1388.515) [-1390.893] (-1394.015) (-1399.445) -- 0:00:09
952500 -- (-1402.520) (-1399.743) (-1399.305) [-1394.099] * [-1389.820] (-1388.079) (-1403.760) (-1394.452) -- 0:00:09
953000 -- (-1392.851) (-1396.157) (-1395.093) [-1394.227] * (-1397.596) (-1395.572) [-1397.658] (-1392.214) -- 0:00:09
953500 -- [-1391.548] (-1398.002) (-1390.530) (-1390.506) * (-1398.760) [-1397.748] (-1400.479) (-1390.075) -- 0:00:09
954000 -- [-1390.211] (-1395.075) (-1394.052) (-1397.907) * (-1396.316) (-1399.122) (-1396.138) [-1387.832] -- 0:00:09
954500 -- (-1397.524) [-1394.039] (-1392.789) (-1392.041) * [-1401.382] (-1392.854) (-1399.327) (-1391.128) -- 0:00:09
955000 -- (-1393.938) [-1390.767] (-1387.211) (-1391.110) * (-1393.310) (-1391.260) [-1395.399] (-1399.730) -- 0:00:09
Average standard deviation of split frequencies: 0.004684
955500 -- (-1399.801) [-1396.722] (-1392.922) (-1397.284) * (-1400.737) (-1389.563) [-1397.337] (-1391.669) -- 0:00:09
956000 -- (-1392.394) (-1396.048) [-1387.807] (-1395.636) * (-1405.271) (-1391.736) (-1392.803) [-1394.077] -- 0:00:08
956500 -- (-1386.385) [-1392.243] (-1395.041) (-1394.758) * (-1394.502) [-1389.363] (-1398.385) (-1397.217) -- 0:00:08
957000 -- (-1398.844) (-1396.542) [-1390.354] (-1394.796) * (-1396.419) [-1388.432] (-1396.395) (-1393.253) -- 0:00:08
957500 -- (-1397.085) (-1398.212) (-1401.694) [-1391.361] * (-1400.538) (-1396.792) (-1401.212) [-1392.398] -- 0:00:08
958000 -- [-1396.322] (-1393.035) (-1394.980) (-1408.168) * (-1392.840) (-1397.409) [-1396.909] (-1395.941) -- 0:00:08
958500 -- (-1394.350) (-1391.881) (-1396.973) [-1399.031] * [-1396.685] (-1391.850) (-1396.470) (-1394.151) -- 0:00:08
959000 -- (-1397.861) [-1396.454] (-1400.676) (-1394.360) * (-1393.238) (-1389.632) (-1395.900) [-1388.645] -- 0:00:08
959500 -- [-1392.605] (-1398.084) (-1393.420) (-1410.438) * (-1392.472) (-1396.583) (-1393.747) [-1394.136] -- 0:00:08
960000 -- (-1393.524) (-1398.401) [-1394.735] (-1400.161) * (-1397.672) (-1397.673) (-1399.621) [-1397.876] -- 0:00:08
Average standard deviation of split frequencies: 0.003680
960500 -- (-1391.246) [-1393.117] (-1400.812) (-1393.246) * (-1398.297) (-1399.285) [-1394.692] (-1402.281) -- 0:00:08
961000 -- [-1391.025] (-1407.697) (-1392.964) (-1393.948) * (-1397.536) (-1395.491) [-1396.502] (-1397.540) -- 0:00:07
961500 -- [-1392.827] (-1396.124) (-1390.285) (-1395.297) * [-1397.068] (-1400.403) (-1394.613) (-1395.876) -- 0:00:07
962000 -- [-1397.930] (-1390.871) (-1396.747) (-1395.562) * (-1389.513) (-1397.052) (-1399.714) [-1391.899] -- 0:00:07
962500 -- (-1399.150) (-1393.182) [-1389.536] (-1397.027) * (-1404.038) [-1401.646] (-1393.449) (-1390.245) -- 0:00:07
963000 -- (-1398.853) [-1395.040] (-1397.227) (-1389.601) * (-1403.199) [-1395.926] (-1394.689) (-1392.479) -- 0:00:07
963500 -- (-1396.723) (-1406.481) [-1397.437] (-1393.418) * (-1403.012) (-1394.999) [-1393.304] (-1398.930) -- 0:00:07
964000 -- (-1404.503) (-1391.264) [-1389.862] (-1398.016) * (-1395.426) [-1392.565] (-1389.922) (-1397.092) -- 0:00:07
964500 -- [-1398.259] (-1389.035) (-1392.183) (-1396.022) * (-1401.932) (-1399.123) [-1404.301] (-1393.491) -- 0:00:07
965000 -- (-1403.725) (-1393.025) (-1394.590) [-1392.675] * (-1401.019) (-1395.122) [-1393.329] (-1397.660) -- 0:00:07
Average standard deviation of split frequencies: 0.003335
965500 -- (-1392.137) (-1394.682) (-1406.102) [-1394.732] * (-1394.373) (-1392.913) (-1393.143) [-1391.293] -- 0:00:07
966000 -- (-1403.344) (-1403.112) (-1399.565) [-1392.632] * (-1403.727) (-1396.696) (-1394.493) [-1399.878] -- 0:00:06
966500 -- (-1389.490) [-1392.443] (-1400.557) (-1406.751) * [-1391.872] (-1399.498) (-1388.676) (-1394.162) -- 0:00:06
967000 -- [-1398.542] (-1392.113) (-1393.241) (-1396.254) * (-1390.629) (-1395.789) [-1386.465] (-1400.312) -- 0:00:06
967500 -- (-1396.409) (-1398.243) [-1396.047] (-1390.328) * (-1392.823) (-1391.545) [-1398.377] (-1390.952) -- 0:00:06
968000 -- (-1397.638) (-1393.407) (-1395.959) [-1388.221] * (-1383.526) (-1404.670) (-1395.394) [-1396.633] -- 0:00:06
968500 -- (-1393.055) (-1387.276) (-1392.996) [-1391.533] * (-1393.633) (-1393.245) [-1390.839] (-1398.652) -- 0:00:06
969000 -- (-1391.340) [-1389.854] (-1396.852) (-1399.183) * (-1394.916) (-1397.912) [-1391.643] (-1389.267) -- 0:00:06
969500 -- [-1388.782] (-1397.835) (-1401.756) (-1395.240) * [-1394.173] (-1395.641) (-1394.406) (-1388.431) -- 0:00:06
970000 -- [-1389.396] (-1397.808) (-1400.942) (-1406.305) * [-1393.948] (-1389.365) (-1392.257) (-1394.321) -- 0:00:06
Average standard deviation of split frequencies: 0.003804
970500 -- (-1392.736) [-1395.764] (-1393.308) (-1394.859) * (-1405.624) (-1399.150) [-1390.191] (-1396.415) -- 0:00:06
971000 -- [-1396.499] (-1398.484) (-1393.889) (-1400.416) * (-1396.402) (-1394.380) (-1393.135) [-1389.685] -- 0:00:05
971500 -- (-1396.469) (-1392.918) [-1396.586] (-1397.260) * [-1390.698] (-1402.043) (-1398.032) (-1396.727) -- 0:00:05
972000 -- (-1393.043) [-1399.867] (-1393.027) (-1397.784) * (-1392.251) (-1391.564) [-1395.110] (-1393.569) -- 0:00:05
972500 -- (-1392.876) (-1399.957) [-1388.443] (-1389.332) * [-1394.404] (-1392.730) (-1401.516) (-1392.130) -- 0:00:05
973000 -- (-1395.194) (-1392.577) (-1398.050) [-1393.017] * [-1391.699] (-1386.943) (-1395.648) (-1398.525) -- 0:00:05
973500 -- (-1398.510) (-1390.876) [-1392.713] (-1394.624) * (-1393.186) (-1405.396) (-1397.101) [-1392.758] -- 0:00:05
974000 -- (-1387.677) [-1391.959] (-1404.346) (-1388.375) * (-1394.078) (-1394.330) [-1394.386] (-1394.282) -- 0:00:05
974500 -- (-1396.357) (-1404.702) [-1394.573] (-1398.353) * [-1397.985] (-1391.875) (-1393.214) (-1396.012) -- 0:00:05
975000 -- (-1399.232) (-1394.129) [-1398.150] (-1394.100) * [-1408.087] (-1396.169) (-1412.443) (-1398.893) -- 0:00:05
Average standard deviation of split frequencies: 0.003944
975500 -- (-1398.693) [-1392.969] (-1403.792) (-1391.147) * (-1393.914) (-1398.226) [-1392.450] (-1399.766) -- 0:00:04
976000 -- [-1399.998] (-1390.176) (-1391.085) (-1392.803) * (-1401.903) (-1389.555) [-1390.466] (-1401.045) -- 0:00:04
976500 -- (-1389.524) (-1396.854) (-1389.427) [-1388.671] * (-1408.151) (-1395.858) (-1390.074) [-1392.880] -- 0:00:04
977000 -- [-1390.365] (-1405.768) (-1395.458) (-1391.859) * (-1397.863) (-1397.502) (-1394.591) [-1386.886] -- 0:00:04
977500 -- (-1402.319) (-1394.783) (-1400.435) [-1389.430] * [-1389.033] (-1402.057) (-1391.417) (-1393.944) -- 0:00:04
978000 -- (-1392.865) (-1398.375) (-1393.577) [-1388.717] * (-1385.936) [-1392.542] (-1396.718) (-1395.225) -- 0:00:04
978500 -- [-1395.297] (-1398.378) (-1394.230) (-1394.083) * (-1391.464) [-1395.376] (-1390.449) (-1391.439) -- 0:00:04
979000 -- [-1391.842] (-1404.961) (-1399.869) (-1394.673) * (-1390.053) [-1385.471] (-1392.128) (-1395.398) -- 0:00:04
979500 -- (-1403.974) [-1401.585] (-1398.002) (-1395.377) * [-1390.862] (-1397.283) (-1402.914) (-1394.043) -- 0:00:04
980000 -- (-1389.907) (-1398.371) (-1399.891) [-1391.702] * (-1395.487) [-1391.937] (-1395.794) (-1398.941) -- 0:00:04
Average standard deviation of split frequencies: 0.004246
980500 -- (-1386.797) (-1391.112) [-1392.930] (-1408.065) * (-1395.856) [-1391.380] (-1402.162) (-1401.735) -- 0:00:03
981000 -- (-1397.369) [-1390.594] (-1397.263) (-1388.959) * [-1386.234] (-1397.425) (-1410.372) (-1391.603) -- 0:00:03
981500 -- (-1393.328) (-1394.494) (-1394.529) [-1394.900] * [-1394.894] (-1396.463) (-1391.363) (-1402.727) -- 0:00:03
982000 -- (-1398.236) [-1397.002] (-1396.087) (-1394.822) * (-1390.984) [-1402.536] (-1398.847) (-1395.708) -- 0:00:03
982500 -- (-1400.422) [-1392.270] (-1393.751) (-1391.318) * (-1394.104) (-1393.846) [-1388.374] (-1397.017) -- 0:00:03
983000 -- (-1395.634) [-1391.879] (-1392.325) (-1397.715) * [-1393.167] (-1396.415) (-1395.472) (-1398.881) -- 0:00:03
983500 -- (-1394.718) (-1406.306) [-1400.062] (-1403.884) * (-1392.572) (-1393.857) [-1398.892] (-1401.819) -- 0:00:03
984000 -- (-1395.073) (-1402.776) [-1401.553] (-1404.019) * (-1401.092) (-1399.041) (-1392.114) [-1395.763] -- 0:00:03
984500 -- (-1396.307) (-1406.190) (-1401.407) [-1389.746] * (-1396.409) (-1391.723) [-1393.750] (-1400.093) -- 0:00:03
985000 -- (-1400.845) (-1396.997) (-1392.471) [-1403.338] * (-1403.931) [-1392.483] (-1396.134) (-1393.926) -- 0:00:03
Average standard deviation of split frequencies: 0.003904
985500 -- [-1389.246] (-1395.187) (-1397.865) (-1400.843) * [-1398.407] (-1392.643) (-1389.643) (-1388.903) -- 0:00:02
986000 -- (-1395.405) (-1395.727) (-1396.044) [-1392.351] * (-1394.937) [-1392.254] (-1393.696) (-1392.939) -- 0:00:02
986500 -- (-1390.066) (-1396.563) (-1390.255) [-1390.147] * (-1395.787) (-1391.606) [-1392.834] (-1394.699) -- 0:00:02
987000 -- (-1401.980) [-1393.802] (-1392.708) (-1400.582) * [-1388.878] (-1398.985) (-1405.536) (-1394.651) -- 0:00:02
987500 -- (-1396.103) [-1389.975] (-1404.757) (-1397.837) * (-1391.648) (-1388.598) [-1396.389] (-1395.782) -- 0:00:02
988000 -- (-1390.056) (-1395.996) (-1394.160) [-1392.284] * (-1394.581) (-1396.408) (-1396.363) [-1393.042] -- 0:00:02
988500 -- [-1392.428] (-1395.068) (-1393.645) (-1400.043) * (-1393.145) [-1386.704] (-1397.656) (-1393.647) -- 0:00:02
989000 -- (-1399.665) (-1391.530) [-1389.162] (-1398.423) * [-1390.823] (-1398.026) (-1396.768) (-1407.243) -- 0:00:02
989500 -- (-1389.718) [-1390.651] (-1388.242) (-1395.283) * (-1392.710) (-1391.223) [-1393.457] (-1398.405) -- 0:00:02
990000 -- [-1399.602] (-1392.149) (-1399.645) (-1398.708) * [-1394.063] (-1394.624) (-1393.870) (-1402.638) -- 0:00:02
Average standard deviation of split frequencies: 0.004203
990500 -- (-1392.256) [-1394.996] (-1400.486) (-1399.395) * [-1398.634] (-1389.614) (-1394.557) (-1392.629) -- 0:00:01
991000 -- (-1393.763) (-1396.352) [-1393.951] (-1397.449) * (-1401.475) (-1394.477) [-1393.985] (-1402.461) -- 0:00:01
991500 -- [-1398.460] (-1391.338) (-1397.356) (-1395.429) * (-1401.065) [-1390.138] (-1387.829) (-1395.070) -- 0:00:01
992000 -- [-1403.065] (-1398.253) (-1401.220) (-1397.962) * [-1391.805] (-1397.689) (-1406.061) (-1391.948) -- 0:00:01
992500 -- (-1396.419) (-1392.323) (-1398.487) [-1386.730] * (-1395.195) [-1393.162] (-1408.120) (-1397.319) -- 0:00:01
993000 -- (-1394.642) (-1394.800) (-1392.598) [-1387.809] * (-1401.239) (-1394.177) [-1392.286] (-1400.011) -- 0:00:01
993500 -- (-1401.189) (-1402.931) (-1395.088) [-1392.294] * (-1386.339) (-1393.077) (-1397.808) [-1395.499] -- 0:00:01
994000 -- (-1397.240) (-1402.552) [-1392.907] (-1393.913) * [-1390.252] (-1398.841) (-1394.704) (-1398.797) -- 0:00:01
994500 -- (-1398.318) [-1396.986] (-1392.599) (-1394.868) * (-1391.327) [-1394.207] (-1397.284) (-1399.305) -- 0:00:01
995000 -- (-1387.933) (-1402.875) (-1391.987) [-1391.746] * (-1392.432) (-1404.343) [-1397.852] (-1394.713) -- 0:00:01
Average standard deviation of split frequencies: 0.003944
995500 -- (-1402.529) (-1402.882) [-1393.600] (-1396.506) * (-1396.032) (-1389.191) [-1395.297] (-1392.883) -- 0:00:00
996000 -- (-1400.471) (-1392.226) [-1398.114] (-1397.098) * (-1404.802) (-1393.599) [-1392.827] (-1388.125) -- 0:00:00
996500 -- (-1400.664) [-1394.474] (-1398.640) (-1399.916) * (-1405.906) [-1391.720] (-1391.545) (-1396.918) -- 0:00:00
997000 -- (-1402.923) [-1400.700] (-1401.578) (-1397.412) * (-1403.990) (-1399.599) (-1392.592) [-1398.773] -- 0:00:00
997500 -- (-1401.655) (-1392.767) [-1392.298] (-1396.978) * (-1398.926) (-1393.839) (-1396.268) [-1389.501] -- 0:00:00
998000 -- (-1394.246) [-1388.417] (-1396.098) (-1394.437) * (-1397.372) [-1387.894] (-1386.906) (-1408.901) -- 0:00:00
998500 -- (-1391.764) [-1388.017] (-1398.876) (-1395.453) * (-1398.047) (-1390.677) (-1389.606) [-1392.672] -- 0:00:00
999000 -- (-1400.606) [-1389.546] (-1390.630) (-1397.837) * (-1390.551) (-1397.851) [-1391.672] (-1395.969) -- 0:00:00
999500 -- (-1398.906) [-1389.471] (-1396.771) (-1394.027) * (-1399.765) (-1398.507) [-1390.355] (-1391.930) -- 0:00:00
1000000 -- [-1398.866] (-1401.251) (-1398.502) (-1392.966) * (-1390.673) (-1397.882) [-1388.762] (-1394.839) -- 0:00:00
Average standard deviation of split frequencies: 0.004397
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1398.866157 -- 16.206126
Chain 1 -- -1398.866162 -- 16.206126
Chain 2 -- -1401.251471 -- 19.045109
Chain 2 -- -1401.251469 -- 19.045109
Chain 3 -- -1398.502417 -- 14.951153
Chain 3 -- -1398.502417 -- 14.951153
Chain 4 -- -1392.966247 -- 15.199081
Chain 4 -- -1392.966247 -- 15.199081
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1390.672619 -- 14.948048
Chain 1 -- -1390.672617 -- 14.948048
Chain 2 -- -1397.882300 -- 16.455297
Chain 2 -- -1397.882300 -- 16.455297
Chain 3 -- -1388.762291 -- 13.927025
Chain 3 -- -1388.762289 -- 13.927025
Chain 4 -- -1394.838707 -- 14.661889
Chain 4 -- -1394.838704 -- 14.661889
Analysis completed in 3 mins 24 seconds
Analysis used 204.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1383.11
Likelihood of best state for "cold" chain of run 2 was -1383.38
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
62.5 % ( 47 %) Dirichlet(Revmat{all})
75.4 % ( 69 %) Slider(Revmat{all})
27.6 % ( 27 %) Dirichlet(Pi{all})
29.4 % ( 27 %) Slider(Pi{all})
64.0 % ( 42 %) Multiplier(Alpha{1,2})
44.7 % ( 25 %) Multiplier(Alpha{3})
48.0 % ( 30 %) Slider(Pinvar{all})
7.5 % ( 7 %) ExtSPR(Tau{all},V{all})
3.7 % ( 3 %) ExtTBR(Tau{all},V{all})
15.3 % ( 15 %) NNI(Tau{all},V{all})
17.6 % ( 17 %) ParsSPR(Tau{all},V{all})
26.6 % ( 26 %) Multiplier(V{all})
42.4 % ( 40 %) Nodeslider(V{all})
26.0 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.8 % ( 48 %) Dirichlet(Revmat{all})
74.5 % ( 60 %) Slider(Revmat{all})
27.8 % ( 26 %) Dirichlet(Pi{all})
30.1 % ( 23 %) Slider(Pi{all})
63.5 % ( 39 %) Multiplier(Alpha{1,2})
44.6 % ( 29 %) Multiplier(Alpha{3})
47.6 % ( 26 %) Slider(Pinvar{all})
7.6 % ( 5 %) ExtSPR(Tau{all},V{all})
3.7 % ( 3 %) ExtTBR(Tau{all},V{all})
14.8 % ( 17 %) NNI(Tau{all},V{all})
17.4 % ( 17 %) ParsSPR(Tau{all},V{all})
26.7 % ( 24 %) Multiplier(V{all})
42.5 % ( 41 %) Nodeslider(V{all})
26.3 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166713 0.82 0.65
3 | 166724 167439 0.83
4 | 166128 166145 166851
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.49
2 | 167255 0.82 0.66
3 | 166489 166921 0.83
4 | 166922 166236 166177
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1392.00
| 1 |
| 2 2 |
| 2 1 1 2 2 2 1 2|
|1 1 22 1 2 2 2 1 2 2 1 2 |
| 11 12 2 1 2 21 2 2 22 12 11 1 2 2 |
| 1 *211 1 2 1 1 21 1 1 2 1111 1|
| 2*2 1 2 1 1 21 1 1 22 1 1 1 |
| 1 2 2 1 |
| 2 2 21 1 2 1 22 |
|2 2 2 21 1 22 2 2 |
| 2 1 1 1 1 |
| 2 2 2 2 |
| 1 1 1 1 2 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1395.92
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1389.51 -1403.31
2 -1389.39 -1401.84
--------------------------------------
TOTAL -1389.45 -1402.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.418859 0.005755 0.282118 0.569366 0.410320 1151.71 1229.84 1.000
r(A<->C){all} 0.074556 0.001489 0.008541 0.151292 0.069042 787.88 813.01 1.000
r(A<->G){all} 0.205707 0.003355 0.104436 0.326428 0.200830 684.47 843.42 1.000
r(A<->T){all} 0.178883 0.003405 0.072312 0.295420 0.174954 599.84 697.86 1.000
r(C<->G){all} 0.068277 0.000793 0.018922 0.124104 0.064628 814.96 904.25 1.000
r(C<->T){all} 0.377833 0.004807 0.250552 0.517958 0.375776 871.96 943.03 1.000
r(G<->T){all} 0.094743 0.001229 0.034242 0.167762 0.090959 891.68 900.16 1.000
pi(A){all} 0.230734 0.000260 0.200419 0.264386 0.230640 1239.65 1248.09 1.000
pi(C){all} 0.279343 0.000288 0.247889 0.313647 0.279134 1106.40 1280.74 1.000
pi(G){all} 0.237679 0.000264 0.204947 0.267415 0.237720 1268.21 1270.28 1.000
pi(T){all} 0.252244 0.000269 0.221648 0.283985 0.251696 1105.04 1255.36 1.000
alpha{1,2} 0.040665 0.000676 0.000119 0.086539 0.037870 1176.48 1248.95 1.000
alpha{3} 2.725638 0.770167 1.218363 4.384799 2.616761 1501.00 1501.00 1.001
pinvar{all} 0.619385 0.002331 0.523372 0.708294 0.622645 1432.65 1466.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Key to taxon bipartitions (saved to file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------
1 -- .******
2 -- .*.....
3 -- ..*....
4 -- ...*...
5 -- ....*..
6 -- .....*.
7 -- ......*
8 -- ....***
9 -- ...****
10 -- .....**
11 -- .**....
12 -- ..*****
13 -- .*.****
-------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
8 3002 1.000000 0.000000 1.000000 1.000000 2
9 2995 0.997668 0.002355 0.996003 0.999334 2
10 2990 0.996003 0.000942 0.995336 0.996669 2
11 1752 0.583611 0.002827 0.581612 0.585610 2
12 664 0.221186 0.010364 0.213857 0.228514 2
13 579 0.192871 0.009893 0.185876 0.199867 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.025492 0.000107 0.007851 0.045439 0.024065 1.000 2
length{all}[2] 0.016710 0.000066 0.002888 0.032114 0.015417 1.000 2
length{all}[3] 0.009114 0.000032 0.000195 0.019878 0.008069 1.000 2
length{all}[4] 0.015462 0.000091 0.001465 0.035133 0.013746 1.000 2
length{all}[5] 0.052856 0.000423 0.016427 0.090923 0.050327 1.000 2
length{all}[6] 0.113393 0.001229 0.056175 0.185506 0.108111 1.000 2
length{all}[7] 0.041977 0.000355 0.010331 0.081462 0.039131 1.000 2
length{all}[8] 0.069907 0.000605 0.024897 0.115309 0.066771 1.000 2
length{all}[9] 0.024829 0.000130 0.004892 0.046730 0.023400 1.000 2
length{all}[10] 0.044172 0.000467 0.010339 0.088921 0.040473 1.000 2
length{all}[11] 0.005907 0.000025 0.000000 0.015498 0.004495 1.000 2
length{all}[12] 0.004295 0.000020 0.000017 0.012686 0.002868 0.999 2
length{all}[13] 0.003670 0.000014 0.000013 0.011034 0.002525 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004397
Maximum standard deviation of split frequencies = 0.010364
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------------------------ C4 (4)
| |
|-------100-------+ /------------------------------------ C5 (5)
| | |
+ \-------100-------+ /------------------ C6 (6)
| \-------100-------+
| \------------------ C7 (7)
|
| /------------------ C2 (2)
\--------------------------58-------------------------+
\------------------ C3 (3)
Phylogram (based on average branch lengths):
/------- C1 (1)
|
| /---- C4 (4)
| |
|------+ /--------------- C5 (5)
| | |
+ \-------------------+ /--------------------------------- C6 (6)
| \-----------+
| \------------ C7 (7)
|
|/----- C2 (2)
\+
\--- C3 (3)
|--------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (12 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 642
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sequences read..
Counting site patterns.. 0:00
114 patterns at 214 / 214 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
111264 bytes for conP
15504 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, (5, (6, 7))), (2, 3)); MP score: 87
278160 bytes for conP, adjusted
0.031214 0.028431 0.017582 0.075810 0.059654 0.034821 0.119661 0.053399 0.002952 0.026301 0.002527 0.300000 1.300000
ntime & nrate & np: 11 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 13
lnL0 = -1473.901310
Iterating by ming2
Initial: fx= 1473.901310
x= 0.03121 0.02843 0.01758 0.07581 0.05965 0.03482 0.11966 0.05340 0.00295 0.02630 0.00253 0.30000 1.30000
1 h-m-p 0.0000 0.0004 607.2430 YYCCC 1472.335651 4 0.0000 24 | 0/13
2 h-m-p 0.0001 0.0004 160.1892 +YYCYCCCC 1467.777330 7 0.0003 52 | 0/13
3 h-m-p 0.0001 0.0004 650.5225 +YYCCCC 1457.526144 5 0.0002 77 | 0/13
4 h-m-p 0.0001 0.0005 1356.5051 +YCCCC 1439.884213 4 0.0003 101 | 0/13
5 h-m-p 0.0001 0.0004 1829.3868 +CCYC 1420.184547 3 0.0003 123 | 0/13
6 h-m-p 0.0000 0.0002 910.1153 ++ 1406.093231 m 0.0002 139 | 0/13
7 h-m-p 0.0002 0.0011 379.9112 YCCCC 1398.606773 4 0.0005 162 | 0/13
8 h-m-p 0.0004 0.0022 319.8227 +CCYCYYYYYC 1342.948840 9 0.0021 191 | 0/13
9 h-m-p 0.0000 0.0000 482.6102 YCCCC 1342.802109 4 0.0000 214 | 0/13
10 h-m-p 0.0002 0.0035 16.0060 +YYYC 1342.676178 3 0.0008 234 | 0/13
11 h-m-p 0.0028 0.0203 4.4100 CY 1342.564459 1 0.0028 252 | 0/13
12 h-m-p 0.0020 0.0377 6.0631 +CCC 1341.134847 2 0.0108 273 | 0/13
13 h-m-p 0.0025 0.0140 25.6817 +YYCCC 1327.637720 4 0.0095 296 | 0/13
14 h-m-p 0.0005 0.0024 117.7071 +YYCCCC 1314.422264 5 0.0016 321 | 0/13
15 h-m-p 0.1033 0.5165 0.3171 +YCYCCC 1308.981911 5 0.3012 346 | 0/13
16 h-m-p 0.2127 1.0633 0.1543 YCC 1307.138567 2 0.3727 378 | 0/13
17 h-m-p 0.3125 1.5627 0.1823 YCCCC 1304.543103 4 0.5447 414 | 0/13
18 h-m-p 0.2839 1.4196 0.2174 CYCCC 1303.019969 4 0.4619 450 | 0/13
19 h-m-p 0.4627 2.3136 0.0787 CCCCC 1302.399838 4 0.5835 487 | 0/13
20 h-m-p 0.6132 3.0659 0.0338 CCCC 1302.041795 3 0.9535 522 | 0/13
21 h-m-p 1.2007 6.0033 0.0083 YCC 1301.972593 2 0.8053 554 | 0/13
22 h-m-p 0.6818 3.4088 0.0091 CCC 1301.918706 2 0.6993 587 | 0/13
23 h-m-p 1.1154 8.0000 0.0057 CC 1301.906282 1 1.1973 618 | 0/13
24 h-m-p 1.6000 8.0000 0.0031 CC 1301.901556 1 1.4066 649 | 0/13
25 h-m-p 0.8148 8.0000 0.0053 +CC 1301.896961 1 2.7789 681 | 0/13
26 h-m-p 1.6000 8.0000 0.0066 YC 1301.895413 1 1.0917 711 | 0/13
27 h-m-p 1.2630 8.0000 0.0057 CC 1301.893368 1 1.5776 742 | 0/13
28 h-m-p 1.6000 8.0000 0.0015 Y 1301.893212 0 1.2765 771 | 0/13
29 h-m-p 1.6000 8.0000 0.0001 C 1301.893198 0 1.6168 800 | 0/13
30 h-m-p 1.6000 8.0000 0.0001 C 1301.893193 0 1.3499 829 | 0/13
31 h-m-p 1.6000 8.0000 0.0000 C 1301.893192 0 1.4301 858 | 0/13
32 h-m-p 1.6000 8.0000 0.0000 C 1301.893192 0 1.9001 887 | 0/13
33 h-m-p 1.6000 8.0000 0.0000 Y 1301.893192 0 1.1515 916 | 0/13
34 h-m-p 1.6000 8.0000 0.0000 C 1301.893192 0 1.6000 945 | 0/13
35 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/13
36 h-m-p 0.0160 8.0000 0.0003 -C 1301.893192 0 0.0010 1018 | 0/13
37 h-m-p 0.0160 8.0000 0.0003 -------------.. | 0/13
38 h-m-p 0.0160 8.0000 0.0062 -------C 1301.893192 0 0.0000 1094 | 0/13
39 h-m-p 0.0160 8.0000 0.0011 ---Y 1301.893192 0 0.0001 1126 | 0/13
40 h-m-p 0.0160 8.0000 0.0004 --Y 1301.893192 0 0.0002 1157 | 0/13
41 h-m-p 0.0160 8.0000 0.0002 -------------.. | 0/13
42 h-m-p 0.0160 8.0000 0.0063 ------------- | 0/13
43 h-m-p 0.0160 8.0000 0.0063 -------------
Out..
lnL = -1301.893192
1278 lfun, 1278 eigenQcodon, 14058 P(t)
Time used: 0:05
Model 1: NearlyNeutral
TREE # 1
(1, (4, (5, (6, 7))), (2, 3)); MP score: 87
0.031214 0.028431 0.017582 0.075810 0.059654 0.034821 0.119661 0.053399 0.002952 0.026301 0.002527 1.254461 0.534390 0.193110
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.006900
np = 14
lnL0 = -1376.890944
Iterating by ming2
Initial: fx= 1376.890944
x= 0.03121 0.02843 0.01758 0.07581 0.05965 0.03482 0.11966 0.05340 0.00295 0.02630 0.00253 1.25446 0.53439 0.19311
1 h-m-p 0.0000 0.0007 606.9513 YYCCCC 1375.253731 5 0.0000 41 | 0/14
2 h-m-p 0.0001 0.0007 131.4784 +CYYYYCCCCC 1369.218201 9 0.0005 87 | 0/14
3 h-m-p 0.0000 0.0002 1534.8184 ++ 1330.349689 m 0.0002 118 | 1/14
4 h-m-p 0.0000 0.0001 1223.0269 +YCYCC 1326.301860 4 0.0001 156 | 1/14
5 h-m-p 0.0001 0.0004 185.4397 +YCCC 1324.822245 3 0.0002 192 | 1/14
6 h-m-p 0.0002 0.0008 173.0885 CCYC 1324.658222 3 0.0000 227 | 1/14
7 h-m-p 0.0002 0.0034 30.4716 YC 1324.463256 1 0.0004 258 | 1/14
8 h-m-p 0.0002 0.0021 68.9609 YCCC 1324.020468 3 0.0004 293 | 1/14
9 h-m-p 0.0003 0.0014 100.9400 CYCCC 1323.397682 4 0.0004 330 | 1/14
10 h-m-p 0.0008 0.0038 47.1374 CCCC 1322.673320 3 0.0012 366 | 1/14
11 h-m-p 0.0008 0.0073 68.0815 YCCC 1320.933259 3 0.0021 401 | 1/14
12 h-m-p 0.0007 0.0033 160.5206 YCYCCC 1317.836847 5 0.0015 439 | 1/14
13 h-m-p 0.0005 0.0024 215.5106 +YCYCCC 1313.888095 5 0.0014 478 | 1/14
14 h-m-p 0.0409 0.3196 7.2268 +YYCCC 1312.053294 4 0.1262 515 | 1/14
15 h-m-p 1.2707 6.8505 0.7177 ----------------.. | 1/14
16 h-m-p 0.0000 0.0006 257.9777 ++YCCC 1304.818415 3 0.0003 596 | 1/14
17 h-m-p 0.0000 0.0001 181.0742 +CYC 1303.535963 2 0.0001 630 | 1/14
18 h-m-p 0.0000 0.0002 256.8086 YCYCCC 1301.979690 5 0.0001 668 | 1/14
19 h-m-p 0.0000 0.0002 120.8512 CYCCC 1301.689996 4 0.0001 705 | 0/14
20 h-m-p 0.0000 0.0002 156.2096 YCCC 1301.589679 3 0.0000 740 | 0/14
21 h-m-p 0.0001 0.0047 21.5404 YC 1301.544207 1 0.0002 772 | 0/14
22 h-m-p 0.0003 0.0022 18.1884 YCC 1301.523206 2 0.0002 806 | 0/14
23 h-m-p 0.0004 0.0271 8.2396 YC 1301.500554 1 0.0009 838 | 0/14
24 h-m-p 0.0003 0.0044 28.4017 CC 1301.468257 1 0.0004 871 | 0/14
25 h-m-p 0.0002 0.0036 70.7928 ++CCC 1300.999611 2 0.0025 908 | 0/14
26 h-m-p 0.0001 0.0004 592.4778 ++ 1300.265255 m 0.0004 939 | 1/14
27 h-m-p 0.0003 0.0030 832.6143 +YYYCYCYCCC 1295.825930 9 0.0015 984 | 1/14
28 h-m-p 0.0016 0.0079 166.8885 YCCC 1295.471983 3 0.0008 1019 | 0/14
29 h-m-p 0.0001 0.0007 1796.3630 YCCC 1295.371888 3 0.0000 1054 | 0/14
30 h-m-p 0.0008 0.0039 11.5477 YC 1295.366170 1 0.0004 1086 | 0/14
31 h-m-p 0.0139 1.3445 0.3095 ++YCCC 1294.404133 3 0.5600 1124 | 0/14
32 h-m-p 0.6443 3.2215 0.1464 YYCC 1294.118742 3 0.5468 1159 | 0/14
33 h-m-p 0.8047 4.0235 0.0281 YCCC 1294.083825 3 0.5426 1195 | 0/14
34 h-m-p 1.6000 8.0000 0.0082 YC 1294.076332 1 0.7354 1227 | 0/14
35 h-m-p 1.6000 8.0000 0.0017 YC 1294.075921 1 0.8600 1259 | 0/14
36 h-m-p 1.6000 8.0000 0.0003 Y 1294.075887 0 1.0604 1290 | 0/14
37 h-m-p 1.6000 8.0000 0.0001 Y 1294.075885 0 1.0914 1321 | 0/14
38 h-m-p 1.6000 8.0000 0.0000 Y 1294.075885 0 0.9259 1352 | 0/14
39 h-m-p 1.6000 8.0000 0.0000 Y 1294.075885 0 0.9755 1383 | 0/14
40 h-m-p 1.6000 8.0000 0.0000 Y 1294.075885 0 0.9468 1414 | 0/14
41 h-m-p 1.6000 8.0000 0.0000 ------C 1294.075885 0 0.0001 1451
Out..
lnL = -1294.075885
1452 lfun, 4356 eigenQcodon, 31944 P(t)
Time used: 0:16
Model 2: PositiveSelection
TREE # 1
(1, (4, (5, (6, 7))), (2, 3)); MP score: 87
initial w for M2:NSpselection reset.
0.031214 0.028431 0.017582 0.075810 0.059654 0.034821 0.119661 0.053399 0.002952 0.026301 0.002527 1.255713 1.131355 0.291249 0.418683 2.981222
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.825327
np = 16
lnL0 = -1407.042362
Iterating by ming2
Initial: fx= 1407.042362
x= 0.03121 0.02843 0.01758 0.07581 0.05965 0.03482 0.11966 0.05340 0.00295 0.02630 0.00253 1.25571 1.13136 0.29125 0.41868 2.98122
1 h-m-p 0.0000 0.0013 630.3384 YYCCCC 1405.282484 5 0.0000 45 | 0/16
2 h-m-p 0.0001 0.0014 99.2948 +YYYYY 1403.450574 4 0.0004 85 | 0/16
3 h-m-p 0.0000 0.0002 185.7180 +YYYCCC 1402.027783 5 0.0002 128 | 0/16
4 h-m-p 0.0000 0.0006 764.6241 ++ 1380.969376 m 0.0006 163 | 0/16
5 h-m-p -0.0000 -0.0000 17980.8162
h-m-p: -1.15226298e-21 -5.76131488e-21 1.79808162e+04 1380.969376
.. | 0/16
6 h-m-p 0.0000 0.0002 2186.4551 +CYYYC 1369.305835 4 0.0000 236 | 0/16
7 h-m-p 0.0000 0.0001 217.5722 ++ 1363.385565 m 0.0001 271 | 1/16
8 h-m-p 0.0001 0.0004 193.4696 +CYCCC 1359.744841 4 0.0003 314 | 1/16
9 h-m-p 0.0000 0.0002 681.9310 YCYCCC 1357.442047 5 0.0001 356 | 1/16
10 h-m-p 0.0004 0.0046 148.9622 +YCCCCC 1343.387603 5 0.0031 400 | 1/16
11 h-m-p 0.0013 0.0065 255.1948 CYCC 1334.639815 3 0.0015 439 | 1/16
12 h-m-p 0.0004 0.0018 184.4385 +YYCCCC 1328.626962 5 0.0012 482 | 1/16
13 h-m-p 0.0003 0.0014 270.0373 +YYCCC 1321.395766 4 0.0010 523 | 1/16
14 h-m-p 0.0003 0.0014 279.9585 YCYCCC 1317.471751 5 0.0006 565 | 1/16
15 h-m-p 0.0007 0.0033 87.2016 CYCCC 1315.968513 4 0.0010 606 | 1/16
16 h-m-p 0.0012 0.0058 40.1752 YYCC 1315.587813 3 0.0008 644 | 1/16
17 h-m-p 0.0048 0.3290 6.8938 ++YCCCC 1310.344753 4 0.1451 687 | 1/16
18 h-m-p 0.0004 0.0020 866.7384 YCCCC 1305.815742 4 0.0010 728 | 1/16
19 h-m-p 0.1804 0.9018 3.8526 CYCCCC 1303.038285 5 0.2853 771 | 0/16
20 h-m-p 0.0004 0.0018 1295.3123 -YCCC 1302.999334 3 0.0000 811 | 0/16
21 h-m-p 0.0030 0.3882 5.4697 +++YYCC 1301.404496 3 0.1561 853 | 0/16
22 h-m-p 0.3809 1.9047 1.3023 CYCC 1300.053679 3 0.4783 893 | 0/16
23 h-m-p 0.1901 0.9507 1.0442 +YYCCCC 1298.020034 5 0.6030 937 | 0/16
24 h-m-p 0.7978 3.9888 0.6110 CCCCC 1296.057902 4 1.1996 980 | 0/16
25 h-m-p 0.5895 2.9475 0.5842 CCCCC 1295.231333 4 0.8804 1023 | 0/16
26 h-m-p 0.6681 3.3404 0.5848 CCC 1294.920374 2 0.6914 1062 | 0/16
27 h-m-p 1.6000 8.0000 0.1774 YCC 1294.821375 2 0.9601 1100 | 0/16
28 h-m-p 0.5584 8.0000 0.3050 YC 1294.736558 1 1.3823 1136 | 0/16
29 h-m-p 0.4442 7.2877 0.9491 CCCC 1294.619136 3 0.6815 1177 | 0/16
30 h-m-p 0.8729 5.4016 0.7411 YCCC 1294.453927 3 1.4550 1217 | 0/16
31 h-m-p 1.2238 8.0000 0.8811 CCC 1294.357736 2 1.1383 1256 | 0/16
32 h-m-p 1.0514 8.0000 0.9539 CCC 1294.262164 2 1.4512 1295 | 0/16
33 h-m-p 1.4355 8.0000 0.9643 YCC 1294.200433 2 1.0001 1333 | 0/16
34 h-m-p 0.5540 8.0000 1.7407 YCCC 1294.117320 3 1.0475 1373 | 0/16
35 h-m-p 1.6000 8.0000 0.8202 YC 1294.097541 1 0.7013 1409 | 0/16
36 h-m-p 1.2956 8.0000 0.4440 YC 1294.093729 1 0.9987 1445 | 0/16
37 h-m-p 0.9794 8.0000 0.4527 YC 1294.089917 1 1.5615 1481 | 0/16
38 h-m-p 1.3898 8.0000 0.5087 YC 1294.083461 1 3.1082 1517 | 0/16
39 h-m-p 1.6000 8.0000 0.8474 CC 1294.079311 1 1.4391 1554 | 0/16
40 h-m-p 1.5214 8.0000 0.8016 CY 1294.077463 1 1.8796 1591 | 0/16
41 h-m-p 1.6000 8.0000 0.6956 YC 1294.076605 1 2.5385 1627 | 0/16
42 h-m-p 1.6000 8.0000 0.8877 C 1294.076225 0 1.5939 1662 | 0/16
43 h-m-p 1.6000 8.0000 0.7608 C 1294.076053 0 1.8651 1697 | 0/16
44 h-m-p 1.6000 8.0000 0.7531 C 1294.075956 0 2.3327 1732 | 0/16
45 h-m-p 1.6000 8.0000 0.7309 C 1294.075916 0 2.1958 1767 | 0/16
46 h-m-p 1.6000 8.0000 0.7267 C 1294.075898 0 2.4110 1802 | 0/16
47 h-m-p 1.6000 8.0000 0.7320 C 1294.075890 0 2.2679 1837 | 0/16
48 h-m-p 1.6000 8.0000 0.7202 C 1294.075887 0 2.2850 1872 | 0/16
49 h-m-p 1.6000 8.0000 0.7563 C 1294.075886 0 2.2856 1907 | 0/16
50 h-m-p 1.6000 8.0000 0.7344 C 1294.075885 0 2.1758 1942 | 0/16
51 h-m-p 1.6000 8.0000 0.7563 C 1294.075885 0 2.4141 1977 | 0/16
52 h-m-p 1.6000 8.0000 0.8391 Y 1294.075885 0 2.5710 2012 | 0/16
53 h-m-p 1.6000 8.0000 0.8596 C 1294.075885 0 1.9979 2047 | 0/16
54 h-m-p 1.2995 8.0000 1.3215 Y 1294.075885 0 3.2160 2082 | 0/16
55 h-m-p 1.0018 8.0000 4.2422 Y 1294.075885 0 1.9806 2117 | 0/16
56 h-m-p 0.2173 3.6254 38.6738 ------Y 1294.075885 0 0.0000 2158 | 0/16
57 h-m-p 0.0796 8.0000 0.0064 +C 1294.075885 0 0.3184 2194 | 0/16
58 h-m-p 0.1659 8.0000 0.0124 -C 1294.075885 0 0.0104 2230 | 0/16
59 h-m-p 0.0160 8.0000 0.0313 ----C 1294.075885 0 0.0000 2269 | 0/16
60 h-m-p 0.2072 8.0000 0.0000 -----Y 1294.075885 0 0.0001 2309 | 0/16
61 h-m-p 0.0160 8.0000 0.0031 ------------C 1294.075885 0 0.0000 2356 | 0/16
62 h-m-p 0.0160 8.0000 0.0088 -------------.. | 0/16
63 h-m-p 0.0160 8.0000 0.0052 -------------
Out..
lnL = -1294.075885
2449 lfun, 9796 eigenQcodon, 80817 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1320.349530 S = -1294.221420 -18.226564
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 114 patterns 0:44
did 20 / 114 patterns 0:44
did 30 / 114 patterns 0:44
did 40 / 114 patterns 0:44
did 50 / 114 patterns 0:44
did 60 / 114 patterns 0:44
did 70 / 114 patterns 0:44
did 80 / 114 patterns 0:44
did 90 / 114 patterns 0:44
did 100 / 114 patterns 0:44
did 110 / 114 patterns 0:44
did 114 / 114 patterns 0:44
Time used: 0:44
Model 3: discrete
TREE # 1
(1, (4, (5, (6, 7))), (2, 3)); MP score: 87
0.031214 0.028431 0.017582 0.075810 0.059654 0.034821 0.119661 0.053399 0.002952 0.026301 0.002527 1.255714 0.960589 0.897086 0.007598 0.019545 0.026617
ntime & nrate & np: 11 4 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 25.741065
np = 17
lnL0 = -1302.843673
Iterating by ming2
Initial: fx= 1302.843673
x= 0.03121 0.02843 0.01758 0.07581 0.05965 0.03482 0.11966 0.05340 0.00295 0.02630 0.00253 1.25571 0.96059 0.89709 0.00760 0.01954 0.02662
1 h-m-p 0.0000 0.0001 542.7110 YYCCC 1301.570327 4 0.0000 45 | 0/17
2 h-m-p 0.0000 0.0001 100.9232 ++ 1300.814825 m 0.0001 82 | 1/17
3 h-m-p 0.0001 0.0005 81.1283 +CCCC 1300.225513 3 0.0003 126 | 1/17
4 h-m-p 0.0000 0.0001 840.0533 CCC 1299.827876 2 0.0000 166 | 1/17
5 h-m-p 0.0000 0.0002 150.1516 ++ 1299.294543 m 0.0002 202 | 2/17
6 h-m-p 0.0009 0.0138 22.5910 CCC 1299.250173 2 0.0002 242 | 2/17
7 h-m-p 0.0006 0.0090 6.4816 CC 1299.246064 1 0.0002 279 | 2/17
8 h-m-p 0.0007 0.0324 1.8800 YC 1299.244998 1 0.0004 315 | 2/17
9 h-m-p 0.0003 0.0764 2.7821 +YC 1299.242430 1 0.0008 352 | 2/17
10 h-m-p 0.0003 0.0582 7.3436 +YC 1299.222374 1 0.0022 389 | 2/17
11 h-m-p 0.0002 0.0089 68.7502 +YC 1299.154468 1 0.0008 426 | 2/17
12 h-m-p 0.0003 0.0094 202.5048 +CCC 1298.850134 2 0.0012 466 | 2/17
13 h-m-p 0.0033 0.0166 33.4410 C 1298.812921 0 0.0008 501 | 2/17
14 h-m-p 0.0093 0.0521 3.0062 -CC 1298.809933 1 0.0009 539 | 2/17
15 h-m-p 0.0018 0.8967 2.1462 +++CCCCC 1298.457371 4 0.1359 585 | 2/17
16 h-m-p 0.2773 3.4555 1.0522 +CCCCC 1297.072323 4 1.1651 629 | 2/17
17 h-m-p 0.8027 8.0000 1.5272 CYC 1296.411100 2 0.6404 667 | 1/17
18 h-m-p 0.0010 0.0604 1010.1441 -CC 1296.402896 1 0.0001 705 | 1/17
19 h-m-p 0.2053 1.0267 0.1414 ++ 1296.143160 m 1.0267 741 | 1/17
20 h-m-p 0.0035 0.0599 41.8696 -CYC 1296.133984 2 0.0002 781 | 1/17
21 h-m-p 0.0171 0.1992 0.6069 ++ 1295.997777 m 0.1992 817 | 2/17
22 h-m-p 0.1409 8.0000 0.8575 +CC 1295.701108 1 0.6215 856 | 2/17
23 h-m-p 0.3592 8.0000 1.4837 YCC 1295.138119 2 0.6609 894 | 1/17
24 h-m-p 0.0001 0.0036 6800.0466 CCC 1295.076250 2 0.0000 933 | 1/17
25 h-m-p 0.8056 8.0000 0.4138 +CCC 1294.669256 2 3.0417 974 | 0/17
26 h-m-p 1.6000 8.0000 0.7587 CYC 1294.458694 2 1.5423 1013 | 0/17
27 h-m-p 0.9523 4.7613 0.3619 CCCC 1294.240239 3 1.5733 1056 | 0/17
28 h-m-p 0.9413 8.0000 0.6048 YCCC 1293.954562 3 2.3055 1098 | 0/17
29 h-m-p 1.3016 8.0000 1.0713 YCCC 1293.689389 3 2.2871 1140 | 0/17
30 h-m-p 1.0127 8.0000 2.4195 YC 1293.605391 1 0.4631 1178 | 0/17
31 h-m-p 1.2239 8.0000 0.9154 CCC 1293.552223 2 1.3745 1219 | 0/17
32 h-m-p 1.6000 8.0000 0.5092 CYC 1293.536270 2 1.6780 1259 | 0/17
33 h-m-p 1.6000 8.0000 0.2262 YC 1293.535096 1 1.1474 1297 | 0/17
34 h-m-p 1.6000 8.0000 0.0423 C 1293.534972 0 1.3267 1334 | 0/17
35 h-m-p 1.6000 8.0000 0.0051 Y 1293.534964 0 1.2083 1371 | 0/17
36 h-m-p 1.6000 8.0000 0.0018 Y 1293.534963 0 1.1821 1408 | 0/17
37 h-m-p 1.6000 8.0000 0.0005 Y 1293.534963 0 1.1262 1445 | 0/17
38 h-m-p 1.6000 8.0000 0.0002 C 1293.534963 0 1.4813 1482 | 0/17
39 h-m-p 1.6000 8.0000 0.0000 Y 1293.534963 0 3.3859 1519 | 0/17
40 h-m-p 0.9948 8.0000 0.0001 ++ 1293.534963 m 8.0000 1556 | 0/17
41 h-m-p 0.5250 8.0000 0.0018 +Y 1293.534963 0 4.7745 1594 | 0/17
42 h-m-p 1.6000 8.0000 0.0051 ++ 1293.534961 m 8.0000 1631 | 0/17
43 h-m-p 0.2061 8.0000 0.1984 +Y 1293.534956 0 1.3989 1669 | 0/17
44 h-m-p 1.6000 8.0000 0.0184 C 1293.534955 0 2.2856 1706 | 0/17
45 h-m-p 1.6000 8.0000 0.0131 Y 1293.534955 0 1.1481 1743 | 0/17
46 h-m-p 1.6000 8.0000 0.0007 C 1293.534955 0 0.4254 1780 | 0/17
47 h-m-p 0.6173 8.0000 0.0005 Y 1293.534955 0 0.3358 1817 | 0/17
48 h-m-p 0.3682 8.0000 0.0004 Y 1293.534955 0 0.3682 1854 | 0/17
49 h-m-p 1.6000 8.0000 0.0001 -C 1293.534955 0 0.0984 1892 | 0/17
50 h-m-p 0.0334 8.0000 0.0002 -Y 1293.534955 0 0.0021 1930 | 0/17
51 h-m-p 0.0190 8.0000 0.0000 ------------Y 1293.534955 0 0.0000 1979
Out..
lnL = -1293.534955
1980 lfun, 7920 eigenQcodon, 65340 P(t)
Time used: 1:06
Model 7: beta
TREE # 1
(1, (4, (5, (6, 7))), (2, 3)); MP score: 87
0.031214 0.028431 0.017582 0.075810 0.059654 0.034821 0.119661 0.053399 0.002952 0.026301 0.002527 1.278941 0.496071 1.323761
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.739744
np = 14
lnL0 = -1341.214553
Iterating by ming2
Initial: fx= 1341.214553
x= 0.03121 0.02843 0.01758 0.07581 0.05965 0.03482 0.11966 0.05340 0.00295 0.02630 0.00253 1.27894 0.49607 1.32376
1 h-m-p 0.0000 0.0007 586.4656 YYCCC 1339.751985 4 0.0000 39 | 0/14
2 h-m-p 0.0001 0.0007 88.8800 +YYCCC 1338.314600 4 0.0003 77 | 0/14
3 h-m-p 0.0000 0.0002 266.3844 +CYCCC 1336.002935 4 0.0002 116 | 0/14
4 h-m-p 0.0000 0.0002 2238.1627 +CYYCCCYC 1318.215445 7 0.0002 160 | 0/14
5 h-m-p 0.0000 0.0001 878.2054 CYCYC 1316.770017 4 0.0000 198 | 0/14
6 h-m-p 0.0002 0.0012 33.6754 CCCC 1316.638874 3 0.0003 235 | 0/14
7 h-m-p 0.0002 0.0048 40.6778 +YCCCC 1315.926018 4 0.0016 274 | 0/14
8 h-m-p 0.0002 0.0012 193.9086 CCCCC 1315.201617 4 0.0003 313 | 0/14
9 h-m-p 0.0002 0.0026 312.2992 +CYCCCC 1310.899733 5 0.0012 354 | 0/14
10 h-m-p 0.0001 0.0005 1397.5490 +CYCCC 1303.178513 4 0.0005 393 | 0/14
11 h-m-p 0.0004 0.0019 150.0935 YCCCC 1302.122784 4 0.0007 431 | 0/14
12 h-m-p 0.0001 0.0004 168.7791 +YC 1301.732634 1 0.0003 464 | 0/14
13 h-m-p 0.0011 0.0058 41.3454 CCC 1301.612089 2 0.0004 499 | 0/14
14 h-m-p 0.0078 0.8491 2.1404 ++YCCCCC 1299.484444 5 0.2663 541 | 0/14
15 h-m-p 0.4091 2.0457 0.9893 YCCCC 1298.638808 4 0.2821 579 | 0/14
16 h-m-p 0.2874 1.4370 0.2263 CCCC 1297.777141 3 0.4892 616 | 0/14
17 h-m-p 1.1084 6.2494 0.0999 YC 1297.649778 1 0.4931 648 | 0/14
18 h-m-p 1.6000 8.0000 0.0297 YC 1297.604212 1 1.0361 680 | 0/14
19 h-m-p 1.3061 8.0000 0.0235 CC 1297.590264 1 1.1301 713 | 0/14
20 h-m-p 0.6437 8.0000 0.0413 YC 1297.578691 1 1.4308 745 | 0/14
21 h-m-p 1.6000 8.0000 0.0335 YC 1297.563694 1 2.7515 777 | 0/14
22 h-m-p 1.2135 8.0000 0.0760 +C 1297.526082 0 4.7797 809 | 0/14
23 h-m-p 1.3721 8.0000 0.2649 +YCYCCC 1297.386557 5 4.2023 850 | 0/14
24 h-m-p 0.3168 1.5840 0.7395 YCYYYY 1297.298386 5 0.7987 888 | 0/14
25 h-m-p 0.1617 0.8083 0.1805 CCC 1297.287438 2 0.0421 923 | 0/14
26 h-m-p 0.0643 4.8608 0.1182 ++YYYY 1297.182387 3 1.0290 959 | 0/14
27 h-m-p 1.1327 6.9721 0.1074 CCCC 1297.145766 3 1.5713 996 | 0/14
28 h-m-p 1.3181 6.5905 0.0942 YYYYCCCCC 1297.115885 8 1.6415 1039 | 0/14
29 h-m-p 0.7525 3.7623 0.1210 YCYC 1297.112585 3 0.4702 1074 | 0/14
30 h-m-p 1.6000 8.0000 0.0187 CC 1297.108202 1 0.6222 1107 | 0/14
31 h-m-p 0.3046 8.0000 0.0383 +YYY 1297.106968 2 1.1309 1141 | 0/14
32 h-m-p 1.6000 8.0000 0.0122 YC 1297.106535 1 1.1376 1173 | 0/14
33 h-m-p 0.5101 8.0000 0.0273 CYC 1297.106310 2 0.8177 1207 | 0/14
34 h-m-p 1.6000 8.0000 0.0074 YC 1297.106106 1 2.7027 1239 | 0/14
35 h-m-p 1.6000 8.0000 0.0125 YC 1297.106015 1 0.9632 1271 | 0/14
36 h-m-p 1.6000 8.0000 0.0034 C 1297.105993 0 0.5075 1302 | 0/14
37 h-m-p 0.4452 8.0000 0.0039 +++ 1297.105888 m 8.0000 1334 | 0/14
38 h-m-p 1.6000 8.0000 0.0185 ----------------.. | 0/14
39 h-m-p 0.0000 0.0080 0.8948 C 1297.105887 0 0.0000 1410 | 0/14
40 h-m-p 0.0000 0.0036 1.6407 Y 1297.105877 0 0.0000 1441 | 0/14
41 h-m-p 0.0002 0.0791 0.5158 Y 1297.105869 0 0.0001 1472 | 0/14
42 h-m-p 0.0001 0.0684 0.3006 Y 1297.105866 0 0.0001 1503 | 0/14
43 h-m-p 0.0008 0.4208 0.2169 Y 1297.105864 0 0.0001 1534 | 0/14
44 h-m-p 0.0017 0.8668 0.0685 -Y 1297.105864 0 0.0002 1566 | 0/14
45 h-m-p 0.0160 8.0000 0.0230 --C 1297.105864 0 0.0002 1599 | 0/14
46 h-m-p 0.0046 2.3124 0.0172 -Y 1297.105864 0 0.0002 1631 | 0/14
47 h-m-p 0.0160 8.0000 0.0113 -C 1297.105864 0 0.0012 1663 | 0/14
48 h-m-p 0.0160 8.0000 0.0674 Y 1297.105863 0 0.0020 1694 | 0/14
49 h-m-p 0.0046 2.3099 0.6360 -C 1297.105863 0 0.0002 1726 | 0/14
50 h-m-p 0.0036 1.7788 0.3434 -C 1297.105863 0 0.0002 1758 | 0/14
51 h-m-p 0.0160 8.0000 0.0548 --C 1297.105863 0 0.0003 1791 | 0/14
52 h-m-p 0.0160 8.0000 0.0050 -------------.. | 0/14
53 h-m-p 0.0160 8.0000 0.1774 -------------
Out..
lnL = -1297.105863
1876 lfun, 20636 eigenQcodon, 206360 P(t)
Time used: 2:15
Model 8: beta&w>1
TREE # 1
(1, (4, (5, (6, 7))), (2, 3)); MP score: 87
initial w for M8:NSbetaw>1 reset.
0.031214 0.028431 0.017582 0.075810 0.059654 0.034821 0.119661 0.053399 0.002952 0.026301 0.002527 1.259361 0.900000 0.225525 1.016293 2.374037
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.232012
np = 16
lnL0 = -1345.431291
Iterating by ming2
Initial: fx= 1345.431291
x= 0.03121 0.02843 0.01758 0.07581 0.05965 0.03482 0.11966 0.05340 0.00295 0.02630 0.00253 1.25936 0.90000 0.22553 1.01629 2.37404
1 h-m-p 0.0000 0.0004 694.0041 +YYCCC 1341.008648 4 0.0001 44 | 0/16
2 h-m-p 0.0001 0.0003 309.3185 ++ 1324.186764 m 0.0003 79 | 0/16
3 h-m-p 0.0000 0.0000 936.5972 ++ 1321.078409 m 0.0000 114 | 1/16
4 h-m-p 0.0000 0.0005 298.3625 +YCYYCCC 1307.741859 6 0.0004 160 | 1/16
5 h-m-p 0.0000 0.0001 1153.8599 YCYCCC 1304.272661 5 0.0000 203 | 0/16
6 h-m-p 0.0000 0.0000 57586.4482 YCYCCC 1302.479622 5 0.0000 245 | 0/16
7 h-m-p 0.0001 0.0004 75.6932 YCCC 1302.374311 3 0.0000 285 | 0/16
8 h-m-p 0.0001 0.0009 49.8984 +YCC 1302.128374 2 0.0002 324 | 0/16
9 h-m-p 0.0001 0.0007 150.0686 CCC 1301.820315 2 0.0001 363 | 0/16
10 h-m-p 0.0004 0.0039 35.8748 CCC 1301.634338 2 0.0004 402 | 0/16
11 h-m-p 0.0003 0.0017 42.3608 CC 1301.582858 1 0.0001 439 | 0/16
12 h-m-p 0.0002 0.0079 36.3036 +YCCC 1301.256939 3 0.0012 480 | 0/16
13 h-m-p 0.0009 0.0190 45.4784 +YCCC 1299.661305 3 0.0060 521 | 0/16
14 h-m-p 0.0004 0.0018 333.2168 CYC 1298.852117 2 0.0004 559 | 0/16
15 h-m-p 0.0056 0.0279 3.5888 -CC 1298.848028 1 0.0006 597 | 0/16
16 h-m-p 0.0031 1.5718 0.9603 +++CCCCC 1298.040648 4 0.3377 643 | 0/16
17 h-m-p 0.1179 0.5897 1.0660 +YCCC 1295.694810 3 0.3603 684 | 0/16
18 h-m-p 0.2001 1.0005 0.3093 +YCYCCC 1294.555534 5 0.5820 728 | 0/16
19 h-m-p 0.4550 5.2760 0.3956 +YCCC 1293.944687 3 1.1564 769 | 0/16
20 h-m-p 1.6000 8.0000 0.1830 CYC 1293.814283 2 1.4625 807 | 0/16
21 h-m-p 1.6000 8.0000 0.1416 YCCC 1293.787093 3 0.7902 847 | 0/16
22 h-m-p 1.0198 8.0000 0.1097 CC 1293.751853 1 1.6285 884 | 0/16
23 h-m-p 1.6000 8.0000 0.0513 YCCC 1293.702836 3 2.8727 924 | 0/16
24 h-m-p 1.6000 8.0000 0.0857 CCC 1293.643248 2 2.4455 963 | 0/16
25 h-m-p 1.6000 8.0000 0.0902 YCC 1293.602741 2 3.0828 1001 | 0/16
26 h-m-p 1.6000 8.0000 0.0996 CC 1293.586823 1 2.0429 1038 | 0/16
27 h-m-p 1.6000 8.0000 0.0227 C 1293.584735 0 1.7047 1073 | 0/16
28 h-m-p 1.6000 8.0000 0.0044 CC 1293.584508 1 2.2458 1110 | 0/16
29 h-m-p 1.6000 8.0000 0.0043 C 1293.584409 0 2.3048 1145 | 0/16
30 h-m-p 1.6000 8.0000 0.0028 C 1293.584394 0 1.5556 1180 | 0/16
31 h-m-p 1.6000 8.0000 0.0011 C 1293.584388 0 2.4486 1215 | 0/16
32 h-m-p 1.6000 8.0000 0.0002 C 1293.584386 0 2.2130 1250 | 0/16
33 h-m-p 1.4648 8.0000 0.0004 Y 1293.584384 0 3.6508 1285 | 0/16
34 h-m-p 1.6000 8.0000 0.0002 ++ 1293.584381 m 8.0000 1320 | 0/16
35 h-m-p 0.7419 8.0000 0.0026 ++ 1293.584348 m 8.0000 1355 | 0/16
36 h-m-p 0.1941 8.0000 0.1061 ++C 1293.584057 0 3.0272 1392 | 0/16
37 h-m-p 1.6000 8.0000 0.1955 ++ 1293.580849 m 8.0000 1427 | 0/16
38 h-m-p 0.0722 4.3699 21.6480 +YCYC 1293.572329 3 0.5952 1467 | 0/16
39 h-m-p 1.6000 8.0000 0.6170 C 1293.569939 0 1.6000 1502 | 0/16
40 h-m-p 0.8538 8.0000 1.1563 +CC 1293.568709 1 4.1951 1540 | 0/16
41 h-m-p 1.6000 8.0000 2.3546 +YC 1293.566442 1 4.3719 1577 | 0/16
42 h-m-p 1.6000 8.0000 4.7982 YC 1293.564054 1 3.2255 1613 | 0/16
43 h-m-p 1.5831 7.9153 6.3303 +YC 1293.562305 1 4.0743 1650 | 0/16
44 h-m-p 0.4534 2.2668 10.7268 ++ 1293.561148 m 2.2668 1685 | 1/16
45 h-m-p 0.3548 8.0000 0.4809 ---------------.. | 1/16
46 h-m-p 0.0000 0.0125 0.8512 C 1293.561134 0 0.0000 1767 | 1/16
47 h-m-p 0.0001 0.0649 0.6311 Y 1293.561101 0 0.0002 1801 | 1/16
48 h-m-p 0.0001 0.0181 1.5907 Y 1293.561047 0 0.0002 1835 | 1/16
49 h-m-p 0.0001 0.0374 7.5184 +YC 1293.560011 1 0.0007 1871 | 1/16
50 h-m-p 0.0001 0.0109 61.3748 YC 1293.558019 1 0.0002 1906 | 1/16
51 h-m-p 0.0001 0.0079 83.6090 +CC 1293.551019 1 0.0004 1943 | 1/16
52 h-m-p 0.0006 0.0095 65.5623 YC 1293.546838 1 0.0003 1978 | 1/16
53 h-m-p 0.0004 0.0112 53.7236 YC 1293.544586 1 0.0002 2013 | 1/16
54 h-m-p 0.0012 0.0464 10.0133 CC 1293.543755 1 0.0004 2049 | 1/16
55 h-m-p 0.0021 0.2164 2.1301 YC 1293.543655 1 0.0003 2084 | 1/16
56 h-m-p 0.0008 0.1854 0.7270 C 1293.543627 0 0.0003 2118 | 1/16
57 h-m-p 0.0019 0.7486 0.1093 C 1293.543625 0 0.0004 2152 | 1/16
58 h-m-p 0.0077 3.8524 0.0381 C 1293.543624 0 0.0016 2186 | 1/16
59 h-m-p 0.0160 8.0000 0.1191 +CC 1293.543421 1 0.1018 2223 | 1/16
60 h-m-p 0.1100 8.0000 0.1102 +C 1293.542628 0 0.4830 2258 | 1/16
61 h-m-p 1.6000 8.0000 0.0220 C 1293.542374 0 1.2997 2292 | 1/16
62 h-m-p 1.6000 8.0000 0.0004 Y 1293.542373 0 0.9903 2326 | 1/16
63 h-m-p 1.6000 8.0000 0.0000 ------C 1293.542373 0 0.0001 2366
Out..
lnL = -1293.542373
2367 lfun, 28404 eigenQcodon, 286407 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1325.983330 S = -1293.892551 -24.223665
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 114 patterns 3:51
did 20 / 114 patterns 3:51
did 30 / 114 patterns 3:51
did 40 / 114 patterns 3:52
did 50 / 114 patterns 3:52
did 60 / 114 patterns 3:52
did 70 / 114 patterns 3:52
did 80 / 114 patterns 3:52
did 90 / 114 patterns 3:53
did 100 / 114 patterns 3:53
did 110 / 114 patterns 3:53
did 114 / 114 patterns 3:53
Time used: 3:53
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=214
D_melanogaster_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
D_sechellia_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
D_simulans_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
D_erecta_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
D_takahashii_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
D_ficusphila_Gfrl-PK MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
D_elegans_Gfrl-PK MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
****:*********************************************
D_melanogaster_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
D_sechellia_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
D_simulans_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
D_erecta_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
D_takahashii_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
D_ficusphila_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
D_elegans_Gfrl-PK CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
**************************************************
D_melanogaster_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
D_sechellia_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
D_simulans_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
D_erecta_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
D_takahashii_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
D_ficusphila_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
D_elegans_Gfrl-PK LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
**************************************************
D_melanogaster_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
D_sechellia_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
D_simulans_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
D_erecta_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
D_takahashii_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
D_ficusphila_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
D_elegans_Gfrl-PK KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
**************************************************
D_melanogaster_Gfrl-PK NPCVGKFRLAMLNC
D_sechellia_Gfrl-PK NPCVGKFRLARLNC
D_simulans_Gfrl-PK NPCVGKFRLARLNC
D_erecta_Gfrl-PK NPCVGKFRLARLNC
D_takahashii_Gfrl-PK NPCVGKFRLALLNC
D_ficusphila_Gfrl-PK NPCVGKFRPASLNC
D_elegans_Gfrl-PK NPCVGKFRLARLNC
******** * ***
>D_melanogaster_Gfrl-PK ATGCTGAAACCATTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC CATTAAGGGCGTCGTGGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCTCGCGTC TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTTCGGCCCACCTGCC TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT CTCTTCGATCATCCATGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC GTACCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCATTGC AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA CTCCTGGACCAACCTGCGTCTGTCGCCCATGTTCGGATGCATCTGCCCGA ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AATCCTTGCGTGGGTAAGTTTCGACTGGCGATGCTGAACTGT >D_sechellia_Gfrl-PK ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC CATTAAGGGCGTCGTAGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA GGCTGCCCTGCGCACTCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT CTCTTCGATCATCCATGTGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC GTACCCGATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCATTGC AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA ATAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT >D_simulans_Gfrl-PK ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC CATTAAGGGCGTCGTGGCCATTCTGAACTGTATCCTAGCACGTCAGCTAT GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC TGCGGACCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGTCA GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC TGTGCAAGGAGCCCGGAATGGATCCGGACTGCAATCACTTTCGGGACTTT CTCTTCGATCATCCATGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC GTATCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTTAAAACGCATTGC AAAGTGCGCGACAACAAATGCAAAATGGAAAACAGGGACGCCTGCCACGA CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA ATAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT >D_erecta_Gfrl-PK ATGCTGAAACCGTTCGCCGTGATTATCGGAATTTTTTATTTAGGTTCCAC CATTAAGGGCGTCGTGGCCATTCTGAATTGTATCCTAGCACGTCAGCTTT GCTTCGAGGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC TGCGGGCCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA GGCTGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC TGTGCAAGGAGCCCGGAATGGATCCCGACTGCAATCACTTTCGGGACTTT CTCTTCGATCATCCGTGCGGATTTGTGCTAAAGAAAGCCGAAAAGGATCC GTACCCCATTGATGCCCTACCAACTTGCAACCATGCACTTTCCGTCTGCC AACAGGAACGCAAATGTCTAAAGCTCTTCGAGGACTTCAAAACGCACTGC AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA CTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AATCCGTGCGTGGGTAAGTTTCGACTGGCGAGGCTGAACTGT >D_takahashii_Gfrl-PK ATGCTGAAACCGTTCGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC CATTAAGGGCGTCGTGGCCATACTGAATTGTATCCTGGCACGTCAGCTAT GTTTCGAAGATCCCTCATGTTCGGCCATTTTGGAAATAATACCGCGCGTC TGCGGGCCCATTCCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA GGCGGCCCTGCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC TGTGCAAGGAGCCCGGCATGGATCCCGACTGCAATCACTTTCGGGACTTT CTCTTCGATCATCCCTGCGGATTTGTGCTGAAGAAAGCCGAGAAGGATCC GTATCCCATTGATGCACTACCCACATGCAACCATGCGCTTTCCGTTTGTC AACAGGAACGCAAATGCCTGAAGCTCTTCGAGGACTTTAAAACGCATTGT AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCTTGCCACGA TTCCTGGACCAACCTGCGGCTGTCGCCCATGTTCGGATGCATCTGTCCGA ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AATCCGTGTGTGGGTAAGTTTCGACTGGCGCTGCTGAACTGT >D_ficusphila_Gfrl-PK ATGCTGAAACCGTTGGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC CATTAAAGGTGTCGTGGCCATACTGAATTGTATTCTGGCACGTCAGCTCT GTTTCGAGGATCCATCATGTTCGGCCATACTGGAAATAATTCCGCGTGTC TGCGGACCCATACCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA GGCAGCCCTCCGCACCCTGCAGGCCTTCCAGTTTTTCCGGCCCACCTGCC TCTGCAAGGAGCCCGGCATGGATCCCGACTGCAACCACTTTCGGGACTTC CTCTTCGATCATCCCTGCGGATTTGTGCTGAAGAAAGCCGAAAAGGATCC GTATCCCATTGATGCACTACCAACATGCAACCATGCTCTGTCCGTCTGCC AACAGGAACGAAAATGCCTGAAGCTTTTCGAGGACTTCAAAACGCATTGC AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA TTCCTGGACGAACCTGCGCCTGTCGCCGATGTTCGGATGCATCTGCCCGA ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AATCCGTGTGTGGGTAAGTTTCGTCCGGCGAGCCTGAACTGT >D_elegans_Gfrl-PK ATGCTGAAACCGTTGGCCGTGATTATTGGAATTTTTTATTTAGGTTCCAC CATTAAGGGCGTCGTGGCCATACTGAATTGTATCCTGGCACGTCAGCTAT GTTTCGAGGATCCCTCATGTTCGGCCATATTGGAAATTATACCGCGTGTC TGCGGGCCCATACCAGTGTCCTGCAGCACGGTGACGGTGACCAAGTGCCA GGCTGCCCTCCGCACCCTGCAGGCCTTCCAGTTCTTCCGGCCCACCTGCC TGTGCAAGGAGCCCGGCATGGATCCCGACTGCAATCACTTTCGAGACTTT CTCTTCGATCACCCATGCGGATTCGTACTGAAGAAAGCCGAGAAGGATCC TTATCCCATTGATGCACTACCAACTTGCAACCATGCTCTGTCCGTCTGTC AACAGGAACGCAAATGCCTGAAGCTCTTCGAGGACTTCAAAACGCATTGC AAAGTGCGCGACAACAAGTGCAAAATGGAAAACAGGGACGCCTGCCACGA TTCCTGGACCAACCTTCGGCTGTCGCCCATGTTCGGATGCATCTGCCCGA ACAACCATATGAAAAAGCGCTGTGATCGTATCTTTAATATTGTTAATCAC AACCCGTGTGTGGGTAAGTTTCGTCTGGCGAGGCTGAACTGT
>D_melanogaster_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRLAMLNC >D_sechellia_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRLARLNC >D_simulans_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRLARLNC >D_erecta_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRLARLNC >D_takahashii_Gfrl-PK MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRLALLNC >D_ficusphila_Gfrl-PK MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRPASLNC >D_elegans_Gfrl-PK MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH NPCVGKFRLARLNC
#NEXUS
[ID: 9927724857]
begin taxa;
dimensions ntax=7;
taxlabels
D_melanogaster_Gfrl-PK
D_sechellia_Gfrl-PK
D_simulans_Gfrl-PK
D_erecta_Gfrl-PK
D_takahashii_Gfrl-PK
D_ficusphila_Gfrl-PK
D_elegans_Gfrl-PK
;
end;
begin trees;
translate
1 D_melanogaster_Gfrl-PK,
2 D_sechellia_Gfrl-PK,
3 D_simulans_Gfrl-PK,
4 D_erecta_Gfrl-PK,
5 D_takahashii_Gfrl-PK,
6 D_ficusphila_Gfrl-PK,
7 D_elegans_Gfrl-PK
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02406486,(4:0.0137456,(5:0.05032735,(6:0.1081113,7:0.03913139)0.996:0.04047278)1.000:0.06677108)0.998:0.0234004,(2:0.01541665,3:0.008068849)0.584:0.004495396);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02406486,(4:0.0137456,(5:0.05032735,(6:0.1081113,7:0.03913139):0.04047278):0.06677108):0.0234004,(2:0.01541665,3:0.008068849):0.004495396);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1389.51 -1403.31
2 -1389.39 -1401.84
--------------------------------------
TOTAL -1389.45 -1402.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/257/Gfrl-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.418859 0.005755 0.282118 0.569366 0.410320 1151.71 1229.84 1.000
r(A<->C){all} 0.074556 0.001489 0.008541 0.151292 0.069042 787.88 813.01 1.000
r(A<->G){all} 0.205707 0.003355 0.104436 0.326428 0.200830 684.47 843.42 1.000
r(A<->T){all} 0.178883 0.003405 0.072312 0.295420 0.174954 599.84 697.86 1.000
r(C<->G){all} 0.068277 0.000793 0.018922 0.124104 0.064628 814.96 904.25 1.000
r(C<->T){all} 0.377833 0.004807 0.250552 0.517958 0.375776 871.96 943.03 1.000
r(G<->T){all} 0.094743 0.001229 0.034242 0.167762 0.090959 891.68 900.16 1.000
pi(A){all} 0.230734 0.000260 0.200419 0.264386 0.230640 1239.65 1248.09 1.000
pi(C){all} 0.279343 0.000288 0.247889 0.313647 0.279134 1106.40 1280.74 1.000
pi(G){all} 0.237679 0.000264 0.204947 0.267415 0.237720 1268.21 1270.28 1.000
pi(T){all} 0.252244 0.000269 0.221648 0.283985 0.251696 1105.04 1255.36 1.000
alpha{1,2} 0.040665 0.000676 0.000119 0.086539 0.037870 1176.48 1248.95 1.000
alpha{3} 2.725638 0.770167 1.218363 4.384799 2.616761 1501.00 1501.00 1.001
pinvar{all} 0.619385 0.002331 0.523372 0.708294 0.622645 1432.65 1466.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/257/Gfrl-PK/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 214
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 7 6 7 6 7 6 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 2 1 2 2 | Cys TGT 6 7 6 5 9 6
TTC 8 9 8 9 8 8 | TCC 4 4 4 4 4 4 | TAC 1 1 0 1 0 0 | TGC 15 14 15 16 12 15
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 2 1 1 | Pro CCT 2 0 0 0 0 0 | His CAT 4 4 4 3 4 4 | Arg CGT 3 2 2 2 2 4
CTC 2 2 2 2 2 4 | CCC 6 5 6 7 9 6 | CAC 3 3 3 4 3 3 | CGC 5 5 5 5 5 4
CTA 4 4 4 4 2 1 | CCA 4 3 3 2 1 3 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 10 10 10 9 13 11 | CCG 3 7 6 6 5 7 | CAG 5 5 5 5 5 5 | CGG 2 3 3 3 3 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 8 8 8 8 8 8 | Thr ACT 1 2 1 1 0 0 | Asn AAT 4 5 5 5 5 4 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 3 2 | ACC 5 4 5 5 5 4 | AAC 8 7 7 7 7 8 | AGC 1 1 1 1 1 2
ATA 2 2 2 2 3 4 | ACA 0 0 0 0 1 1 | Lys AAA 8 8 8 7 7 8 | Arg AGA 0 0 0 0 0 0
Met ATG 6 5 5 5 5 5 | ACG 3 3 3 3 3 4 | AAG 8 8 8 9 9 8 | AGG 1 2 2 2 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 2 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 7 7 | Gly GGT 2 2 2 2 2 3
GTC 3 3 3 3 2 3 | GCC 8 8 8 8 6 7 | GAC 6 6 6 6 5 5 | GGC 1 1 1 1 2 1
GTA 0 1 0 0 0 0 | GCA 2 2 2 2 2 3 | Glu GAA 4 4 4 4 4 4 | GGA 5 5 5 4 3 4
GTG 8 7 8 8 8 8 | GCG 1 1 1 1 3 1 | GAG 3 3 3 3 3 3 | GGG 0 0 0 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 5 | Ser TCT 0 | Tyr TAT 2 | Cys TGT 7
TTC 9 | TCC 4 | TAC 0 | TGC 14
Leu TTA 1 | TCA 1 | *** TAA 0 | *** TGA 0
TTG 2 | TCG 2 | TAG 0 | Trp TGG 1
------------------------------------------------------
Leu CTT 1 | Pro CCT 1 | His CAT 3 | Arg CGT 4
CTC 3 | CCC 7 | CAC 4 | CGC 4
CTA 2 | CCA 3 | Gln CAA 1 | CGA 1
CTG 11 | CCG 4 | CAG 5 | CGG 2
------------------------------------------------------
Ile ATT 7 | Thr ACT 1 | Asn AAT 4 | Ser AGT 0
ATC 3 | ACC 5 | AAC 8 | AGC 1
ATA 4 | ACA 0 | Lys AAA 7 | Arg AGA 0
Met ATG 5 | ACG 3 | AAG 9 | AGG 2
------------------------------------------------------
Val GTT 1 | Ala GCT 2 | Asp GAT 7 | Gly GGT 2
GTC 3 | GCC 7 | GAC 5 | GGC 2
GTA 1 | GCA 2 | Glu GAA 3 | GGA 3
GTG 7 | GCG 1 | GAG 4 | GGG 1
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Gfrl-PK
position 1: T:0.22430 C:0.26168 A:0.27570 G:0.23832
position 2: T:0.30841 C:0.20093 A:0.28972 G:0.20093
position 3: T:0.21963 C:0.37383 A:0.15421 G:0.25234
Average T:0.25078 C:0.27882 A:0.23988 G:0.23053
#2: D_sechellia_Gfrl-PK
position 1: T:0.22430 C:0.26168 A:0.27570 G:0.23832
position 2: T:0.30374 C:0.20093 A:0.28972 G:0.20561
position 3: T:0.21495 C:0.35981 A:0.15421 G:0.27103
Average T:0.24766 C:0.27414 A:0.23988 G:0.23832
#3: D_simulans_Gfrl-PK
position 1: T:0.22430 C:0.26168 A:0.27570 G:0.23832
position 2: T:0.30374 C:0.20093 A:0.28972 G:0.20561
position 3: T:0.21495 C:0.36449 A:0.14953 G:0.27103
Average T:0.24766 C:0.27570 A:0.23832 G:0.23832
#4: D_erecta_Gfrl-PK
position 1: T:0.22430 C:0.26168 A:0.27570 G:0.23832
position 2: T:0.30374 C:0.20093 A:0.28972 G:0.20561
position 3: T:0.20093 C:0.38785 A:0.13551 G:0.27570
Average T:0.24299 C:0.28349 A:0.23364 G:0.23988
#5: D_takahashii_Gfrl-PK
position 1: T:0.22430 C:0.26636 A:0.27103 G:0.23832
position 2: T:0.30841 C:0.20093 A:0.28972 G:0.20093
position 3: T:0.23364 C:0.34579 A:0.12617 G:0.29439
Average T:0.25545 C:0.27103 A:0.22897 G:0.24455
#6: D_ficusphila_Gfrl-PK
position 1: T:0.21963 C:0.26636 A:0.27570 G:0.23832
position 2: T:0.29907 C:0.20561 A:0.28972 G:0.20561
position 3: T:0.21963 C:0.35514 A:0.14953 G:0.27570
Average T:0.24611 C:0.27570 A:0.23832 G:0.23988
#7: D_elegans_Gfrl-PK
position 1: T:0.22430 C:0.26168 A:0.27570 G:0.23832
position 2: T:0.30374 C:0.20093 A:0.28972 G:0.20561
position 3: T:0.21963 C:0.36916 A:0.13551 G:0.27570
Average T:0.24922 C:0.27726 A:0.23364 G:0.23988
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 44 | Ser S TCT 0 | Tyr Y TAT 11 | Cys C TGT 46
TTC 59 | TCC 28 | TAC 3 | TGC 101
Leu L TTA 7 | TCA 7 | *** * TAA 0 | *** * TGA 0
TTG 8 | TCG 14 | TAG 0 | Trp W TGG 7
------------------------------------------------------------------------------
Leu L CTT 8 | Pro P CCT 3 | His H CAT 26 | Arg R CGT 19
CTC 17 | CCC 46 | CAC 23 | CGC 33
CTA 21 | CCA 19 | Gln Q CAA 7 | CGA 7
CTG 74 | CCG 38 | CAG 35 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 55 | Thr T ACT 6 | Asn N AAT 32 | Ser S AGT 0
ATC 24 | ACC 33 | AAC 52 | AGC 8
ATA 19 | ACA 2 | Lys K AAA 53 | Arg R AGA 0
Met M ATG 36 | ACG 22 | AAG 59 | AGG 11
------------------------------------------------------------------------------
Val V GTT 8 | Ala A GCT 8 | Asp D GAT 45 | Gly G GGT 15
GTC 20 | GCC 52 | GAC 39 | GGC 9
GTA 2 | GCA 15 | Glu E GAA 27 | GGA 29
GTG 54 | GCG 9 | GAG 22 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22363 C:0.26302 A:0.27503 G:0.23832
position 2: T:0.30441 C:0.20160 A:0.28972 G:0.20427
position 3: T:0.21762 C:0.36515 A:0.14352 G:0.27370
Average T:0.24855 C:0.27659 A:0.23609 G:0.23876
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Gfrl-PK
D_sechellia_Gfrl-PK 0.0283 (0.0020 0.0714)
D_simulans_Gfrl-PK 0.0357 (0.0020 0.0566)-1.0000 (0.0000 0.0419)
D_erecta_Gfrl-PK 0.0198 (0.0020 0.1022)-1.0000 (0.0000 0.1018)-1.0000 (0.0000 0.0864)
D_takahashii_Gfrl-PK 0.0073 (0.0020 0.2765) 0.0108 (0.0030 0.2802) 0.0136 (0.0030 0.2234) 0.0142 (0.0030 0.2146)
D_ficusphila_Gfrl-PK 0.0205 (0.0081 0.3956) 0.0150 (0.0061 0.4054) 0.0169 (0.0061 0.3600) 0.0179 (0.0061 0.3390) 0.0312 (0.0088 0.2828)
D_elegans_Gfrl-PK 0.0127 (0.0040 0.3182) 0.0064 (0.0020 0.3168) 0.0073 (0.0020 0.2764) 0.0079 (0.0020 0.2574) 0.0258 (0.0051 0.1968) 0.0170 (0.0040 0.2388)
Model 0: one-ratio
TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 87
check convergence..
lnL(ntime: 11 np: 13): -1301.893192 +0.000000
8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3
0.030382 0.026694 0.018919 0.074020 0.063921 0.039867 0.123481 0.047305 0.004099 0.019646 0.009565 1.254461 0.015196
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.45790
(1: 0.030382, (4: 0.018919, (5: 0.063921, (6: 0.123481, 7: 0.047305): 0.039867): 0.074020): 0.026694, (2: 0.019646, 3: 0.009565): 0.004099);
(D_melanogaster_Gfrl-PK: 0.030382, (D_erecta_Gfrl-PK: 0.018919, (D_takahashii_Gfrl-PK: 0.063921, (D_ficusphila_Gfrl-PK: 0.123481, D_elegans_Gfrl-PK: 0.047305): 0.039867): 0.074020): 0.026694, (D_sechellia_Gfrl-PK: 0.019646, D_simulans_Gfrl-PK: 0.009565): 0.004099);
Detailed output identifying parameters
kappa (ts/tv) = 1.25446
omega (dN/dS) = 0.01520
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.030 500.8 141.2 0.0152 0.0007 0.0437 0.3 6.2
8..9 0.027 500.8 141.2 0.0152 0.0006 0.0384 0.3 5.4
9..4 0.019 500.8 141.2 0.0152 0.0004 0.0272 0.2 3.8
9..10 0.074 500.8 141.2 0.0152 0.0016 0.1064 0.8 15.0
10..5 0.064 500.8 141.2 0.0152 0.0014 0.0919 0.7 13.0
10..11 0.040 500.8 141.2 0.0152 0.0009 0.0573 0.4 8.1
11..6 0.123 500.8 141.2 0.0152 0.0027 0.1776 1.4 25.1
11..7 0.047 500.8 141.2 0.0152 0.0010 0.0680 0.5 9.6
8..12 0.004 500.8 141.2 0.0152 0.0001 0.0059 0.0 0.8
12..2 0.020 500.8 141.2 0.0152 0.0004 0.0283 0.2 4.0
12..3 0.010 500.8 141.2 0.0152 0.0002 0.0138 0.1 1.9
tree length for dN: 0.0100
tree length for dS: 0.6585
Time used: 0:05
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 87
lnL(ntime: 11 np: 14): -1294.075885 +0.000000
8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3
0.030373 0.026728 0.018934 0.074465 0.064792 0.039681 0.124248 0.047870 0.004112 0.019654 0.009568 1.255713 0.987635 0.002993
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.46043
(1: 0.030373, (4: 0.018934, (5: 0.064792, (6: 0.124248, 7: 0.047870): 0.039681): 0.074465): 0.026728, (2: 0.019654, 3: 0.009568): 0.004112);
(D_melanogaster_Gfrl-PK: 0.030373, (D_erecta_Gfrl-PK: 0.018934, (D_takahashii_Gfrl-PK: 0.064792, (D_ficusphila_Gfrl-PK: 0.124248, D_elegans_Gfrl-PK: 0.047870): 0.039681): 0.074465): 0.026728, (D_sechellia_Gfrl-PK: 0.019654, D_simulans_Gfrl-PK: 0.009568): 0.004112);
Detailed output identifying parameters
kappa (ts/tv) = 1.25571
dN/dS (w) for site classes (K=2)
p: 0.98764 0.01236
w: 0.00299 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.030 500.8 141.2 0.0153 0.0007 0.0437 0.3 6.2
8..9 0.027 500.8 141.2 0.0153 0.0006 0.0384 0.3 5.4
9..4 0.019 500.8 141.2 0.0153 0.0004 0.0272 0.2 3.8
9..10 0.074 500.8 141.2 0.0153 0.0016 0.1070 0.8 15.1
10..5 0.065 500.8 141.2 0.0153 0.0014 0.0931 0.7 13.2
10..11 0.040 500.8 141.2 0.0153 0.0009 0.0570 0.4 8.1
11..6 0.124 500.8 141.2 0.0153 0.0027 0.1786 1.4 25.2
11..7 0.048 500.8 141.2 0.0153 0.0011 0.0688 0.5 9.7
8..12 0.004 500.8 141.2 0.0153 0.0001 0.0059 0.0 0.8
12..2 0.020 500.8 141.2 0.0153 0.0004 0.0282 0.2 4.0
12..3 0.010 500.8 141.2 0.0153 0.0002 0.0138 0.1 1.9
Time used: 0:16
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 87
check convergence..
lnL(ntime: 11 np: 16): -1294.075885 +0.000000
8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3
0.030373 0.026728 0.018934 0.074466 0.064792 0.039681 0.124248 0.047870 0.004112 0.019654 0.009568 1.255714 0.987636 0.012364 0.002993 41.786901
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.46043
(1: 0.030373, (4: 0.018934, (5: 0.064792, (6: 0.124248, 7: 0.047870): 0.039681): 0.074466): 0.026728, (2: 0.019654, 3: 0.009568): 0.004112);
(D_melanogaster_Gfrl-PK: 0.030373, (D_erecta_Gfrl-PK: 0.018934, (D_takahashii_Gfrl-PK: 0.064792, (D_ficusphila_Gfrl-PK: 0.124248, D_elegans_Gfrl-PK: 0.047870): 0.039681): 0.074466): 0.026728, (D_sechellia_Gfrl-PK: 0.019654, D_simulans_Gfrl-PK: 0.009568): 0.004112);
Detailed output identifying parameters
kappa (ts/tv) = 1.25571
dN/dS (w) for site classes (K=3)
p: 0.98764 0.01236 0.00000
w: 0.00299 1.00000 41.78690
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.030 500.8 141.2 0.0153 0.0007 0.0437 0.3 6.2
8..9 0.027 500.8 141.2 0.0153 0.0006 0.0384 0.3 5.4
9..4 0.019 500.8 141.2 0.0153 0.0004 0.0272 0.2 3.8
9..10 0.074 500.8 141.2 0.0153 0.0016 0.1070 0.8 15.1
10..5 0.065 500.8 141.2 0.0153 0.0014 0.0931 0.7 13.2
10..11 0.040 500.8 141.2 0.0153 0.0009 0.0570 0.4 8.1
11..6 0.124 500.8 141.2 0.0153 0.0027 0.1786 1.4 25.2
11..7 0.048 500.8 141.2 0.0153 0.0011 0.0688 0.5 9.7
8..12 0.004 500.8 141.2 0.0153 0.0001 0.0059 0.0 0.8
12..2 0.020 500.8 141.2 0.0153 0.0004 0.0282 0.2 4.0
12..3 0.010 500.8 141.2 0.0153 0.0002 0.0138 0.1 1.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 0.666 2.781 +- 2.208
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.270 0.181 0.138 0.104 0.079 0.062 0.050 0.043 0.038 0.035
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:44
Model 3: discrete (3 categories)
TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 87
lnL(ntime: 11 np: 17): -1293.534955 +0.000000
8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3
0.030343 0.026742 0.018942 0.074808 0.064867 0.040471 0.123662 0.047698 0.004137 0.019659 0.009572 1.278941 0.994107 0.000002 0.005533 2.494202 2.494322
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.46090
(1: 0.030343, (4: 0.018942, (5: 0.064867, (6: 0.123662, 7: 0.047698): 0.040471): 0.074808): 0.026742, (2: 0.019659, 3: 0.009572): 0.004137);
(D_melanogaster_Gfrl-PK: 0.030343, (D_erecta_Gfrl-PK: 0.018942, (D_takahashii_Gfrl-PK: 0.064867, (D_ficusphila_Gfrl-PK: 0.123662, D_elegans_Gfrl-PK: 0.047698): 0.040471): 0.074808): 0.026742, (D_sechellia_Gfrl-PK: 0.019659, D_simulans_Gfrl-PK: 0.009572): 0.004137);
Detailed output identifying parameters
kappa (ts/tv) = 1.27894
dN/dS (w) for site classes (K=3)
p: 0.99411 0.00000 0.00589
w: 0.00553 2.49420 2.49432
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.030 500.3 141.7 0.0202 0.0009 0.0428 0.4 6.1
8..9 0.027 500.3 141.7 0.0202 0.0008 0.0377 0.4 5.3
9..4 0.019 500.3 141.7 0.0202 0.0005 0.0267 0.3 3.8
9..10 0.075 500.3 141.7 0.0202 0.0021 0.1055 1.1 14.9
10..5 0.065 500.3 141.7 0.0202 0.0018 0.0914 0.9 13.0
10..11 0.040 500.3 141.7 0.0202 0.0012 0.0571 0.6 8.1
11..6 0.124 500.3 141.7 0.0202 0.0035 0.1743 1.8 24.7
11..7 0.048 500.3 141.7 0.0202 0.0014 0.0672 0.7 9.5
8..12 0.004 500.3 141.7 0.0202 0.0001 0.0058 0.1 0.8
12..2 0.020 500.3 141.7 0.0202 0.0006 0.0277 0.3 3.9
12..3 0.010 500.3 141.7 0.0202 0.0003 0.0135 0.1 1.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 1.000** 2.494
Note: more than one w>1. Check rst for details
Time used: 1:06
Model 7: beta (10 categories)
TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 87
check convergence..
lnL(ntime: 11 np: 14): -1297.105863 +0.000000
8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3
0.030548 0.026843 0.019028 0.074473 0.064529 0.039929 0.124440 0.047771 0.004126 0.019757 0.009620 1.259361 0.010345 0.261662
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.46107
(1: 0.030548, (4: 0.019028, (5: 0.064529, (6: 0.124440, 7: 0.047771): 0.039929): 0.074473): 0.026843, (2: 0.019757, 3: 0.009620): 0.004126);
(D_melanogaster_Gfrl-PK: 0.030548, (D_erecta_Gfrl-PK: 0.019028, (D_takahashii_Gfrl-PK: 0.064529, (D_ficusphila_Gfrl-PK: 0.124440, D_elegans_Gfrl-PK: 0.047771): 0.039929): 0.074473): 0.026843, (D_sechellia_Gfrl-PK: 0.019757, D_simulans_Gfrl-PK: 0.009620): 0.004126);
Detailed output identifying parameters
kappa (ts/tv) = 1.25936
Parameters in M7 (beta):
p = 0.01035 q = 0.26166
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.18007
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.031 500.7 141.3 0.0180 0.0008 0.0435 0.4 6.1
8..9 0.027 500.7 141.3 0.0180 0.0007 0.0382 0.3 5.4
9..4 0.019 500.7 141.3 0.0180 0.0005 0.0271 0.2 3.8
9..10 0.074 500.7 141.3 0.0180 0.0019 0.1060 1.0 15.0
10..5 0.065 500.7 141.3 0.0180 0.0017 0.0919 0.8 13.0
10..11 0.040 500.7 141.3 0.0180 0.0010 0.0568 0.5 8.0
11..6 0.124 500.7 141.3 0.0180 0.0032 0.1772 1.6 25.0
11..7 0.048 500.7 141.3 0.0180 0.0012 0.0680 0.6 9.6
8..12 0.004 500.7 141.3 0.0180 0.0001 0.0059 0.1 0.8
12..2 0.020 500.7 141.3 0.0180 0.0005 0.0281 0.3 4.0
12..3 0.010 500.7 141.3 0.0180 0.0002 0.0137 0.1 1.9
Time used: 2:15
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 87
lnL(ntime: 11 np: 16): -1293.542373 +0.000000
8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3
0.030342 0.026742 0.018941 0.074808 0.064869 0.040463 0.123674 0.047705 0.004137 0.019659 0.009572 1.279095 0.994100 0.584328 99.000000 2.492110
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.46091
(1: 0.030342, (4: 0.018941, (5: 0.064869, (6: 0.123674, 7: 0.047705): 0.040463): 0.074808): 0.026742, (2: 0.019659, 3: 0.009572): 0.004137);
(D_melanogaster_Gfrl-PK: 0.030342, (D_erecta_Gfrl-PK: 0.018941, (D_takahashii_Gfrl-PK: 0.064869, (D_ficusphila_Gfrl-PK: 0.123674, D_elegans_Gfrl-PK: 0.047705): 0.040463): 0.074808): 0.026742, (D_sechellia_Gfrl-PK: 0.019659, D_simulans_Gfrl-PK: 0.009572): 0.004137);
Detailed output identifying parameters
kappa (ts/tv) = 1.27909
Parameters in M8 (beta&w>1):
p0 = 0.99410 p = 0.58433 q = 99.00000
(p1 = 0.00590) w = 2.49211
dN/dS (w) for site classes (K=11)
p: 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.00590
w: 0.00005 0.00033 0.00082 0.00151 0.00246 0.00373 0.00547 0.00797 0.01201 0.02126 2.49211
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.030 500.3 141.7 0.0202 0.0009 0.0428 0.4 6.1
8..9 0.027 500.3 141.7 0.0202 0.0008 0.0377 0.4 5.3
9..4 0.019 500.3 141.7 0.0202 0.0005 0.0267 0.3 3.8
9..10 0.075 500.3 141.7 0.0202 0.0021 0.1054 1.1 14.9
10..5 0.065 500.3 141.7 0.0202 0.0018 0.0914 0.9 13.0
10..11 0.040 500.3 141.7 0.0202 0.0012 0.0570 0.6 8.1
11..6 0.124 500.3 141.7 0.0202 0.0035 0.1743 1.8 24.7
11..7 0.048 500.3 141.7 0.0202 0.0014 0.0672 0.7 9.5
8..12 0.004 500.3 141.7 0.0202 0.0001 0.0058 0.1 0.8
12..2 0.020 500.3 141.7 0.0202 0.0006 0.0277 0.3 3.9
12..3 0.010 500.3 141.7 0.0202 0.0003 0.0135 0.1 1.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 1.000** 2.492
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 0.889 2.988 +- 2.194
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.002 0.013 0.067 0.242 0.676
ws: 0.386 0.190 0.128 0.090 0.063 0.045 0.034 0.026 0.020 0.017
Time used: 3:53
Model 1: NearlyNeutral -1294.075885
Model 2: PositiveSelection -1294.075885
Model 0: one-ratio -1301.893192
Model 3: discrete -1293.534955
Model 7: beta -1297.105863
Model 8: beta&w>1 -1293.542373
Model 0 vs 1 15.634614000000056
Model 2 vs 1 0.0
Model 8 vs 7 7.126980000000003
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 1.000** 2.492
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PK)
Pr(w>1) post mean +- SE for w
211 M 0.889 2.988 +- 2.194
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
