--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 17 02:02:15 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/257/Gfrl-PH/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/257/Gfrl-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/257/Gfrl-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -8202.84         -8215.10
2      -8202.88         -8215.76
--------------------------------------
TOTAL    -8202.86         -8215.48
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/257/Gfrl-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfrl-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/257/Gfrl-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.414662    0.000713    0.363573    0.467450    0.413537   1370.40   1385.97    1.000
r(A<->C){all}   0.061374    0.000113    0.040573    0.081410    0.061135   1005.82   1066.34    1.000
r(A<->G){all}   0.236230    0.000500    0.188892    0.277710    0.236061    876.90    918.57    1.000
r(A<->T){all}   0.089659    0.000272    0.057599    0.121314    0.088813    876.32    999.10    1.000
r(C<->G){all}   0.084947    0.000132    0.063714    0.108074    0.084661   1062.46   1086.62    1.000
r(C<->T){all}   0.445975    0.000843    0.391846    0.505521    0.444987    871.29    892.16    1.000
r(G<->T){all}   0.081816    0.000207    0.054442    0.110650    0.081284    903.64    952.96    1.000
pi(A){all}      0.255500    0.000051    0.241785    0.269018    0.255511    979.15   1010.87    1.000
pi(C){all}      0.299955    0.000055    0.285456    0.313765    0.299868    938.56   1114.38    1.000
pi(G){all}      0.263403    0.000052    0.249195    0.277273    0.263502    945.78   1053.00    1.000
pi(T){all}      0.181142    0.000037    0.168252    0.192606    0.181280   1050.20   1064.43    1.000
alpha{1,2}      0.078037    0.001071    0.006567    0.128374    0.084961   1001.89   1032.98    1.000
alpha{3}        3.876799    1.059271    1.993170    5.781153    3.756956   1300.78   1372.15    1.000
pinvar{all}     0.493416    0.001225    0.421490    0.556323    0.493274   1103.00   1192.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-7551.049356
Model 2: PositiveSelection	-7550.85176
Model 0: one-ratio	-7609.51807
Model 3: discrete	-7550.215442
Model 7: beta	-7554.312241
Model 8: beta&w>1	-7550.252122


Model 0 vs 1	116.93742799999927

Model 2 vs 1	0.3951920000017708

Model 8 vs 7	8.120237999999517

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PH)

            Pr(w>1)     post mean +- SE for w

   230 P      0.720         1.474
   243 M      0.981*        1.892
   263 S      0.637         1.341
   341 A      0.965*        1.866
   345 P      0.943         1.831
   348 V      0.785         1.575
   349 D      0.980*        1.890
   388 L      0.516         1.138
   389 P      0.773         1.558
   720 A      0.525         1.153

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Gfrl-PH)

            Pr(w>1)     post mean +- SE for w

   230 P      0.825         1.335 +- 0.376
   232 S      0.519         0.962 +- 0.588
   243 M      0.958*        1.468 +- 0.174
   260 N      0.648         1.148 +- 0.498
   263 S      0.786         1.295 +- 0.411
   280 H      0.558         1.010 +- 0.579
   281 G      0.548         0.998 +- 0.581
   341 A      0.946         1.456 +- 0.201
   342 N      0.711         1.216 +- 0.465
   343 K      0.699         1.204 +- 0.471
   345 P      0.931         1.442 +- 0.229
   348 V      0.848         1.349 +- 0.377
   349 D      0.957*        1.467 +- 0.176
   388 L      0.706         1.186 +- 0.509
   389 P      0.848         1.358 +- 0.352
   395 I      0.653         1.124 +- 0.540
   720 A      0.711         1.192 +- 0.506

>C1
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQPRPKAKPRPKPKPKSKPKPRQRHHGMNGTEL
MTNNIEYHDEPNGLSDPEDEANETVDEDPGGHGDEDEDEEDDDYDDRIRA
EIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVANKKPPPV
TLHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQSSTTGSGLPGPA
PTIPSPPNTGTKMHKTAPLGDLVAGSDITHRTYTGPSMDERGGQDVEVDL
STEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNACMSS
LQAFYKGPHEDLNLDIAFCLCKKTSSQQNGNGNRHDMCMIAQEKLHPVCA
QRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYEQACAVD
SVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVGWRRLLW
MNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTTTTTRAPPPPPP
PTTTTTTTTSMQPRQTPRKPATHIFKDVITAKEKSEPTSVEHNYLDPPDS
IPLPSVNVESGGNGGNDDYHNGNGNGHGNGNGNGRRKNGGKGRGGSVDFD
DPVIFVDPRETTEFVGISITEPVTTTTTTMATTTTTQPPRNCVVQRPRQS
DQLIREGSSKRIYSLDDVECSELCSCGESLILTCHALCVPFAPCRTALAF
YSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPGGIFLLLGYSAADEA
LLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLFNMTEENIIIAARLP
HDGKLKDIELLRKEKDECTAILKTISHQINSEHSELQSHRLLSIFKMSEV
EVVWPESTSAAARSGHGPGQFAGCDRLLYAAMLALAYLSSWTTLRMSDVA
Toooooooooooooo
>C2
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQPRPKAKPRPKPKAKSKPKPRQRHHGMNGTEL
MTNNIEYHDEPSGLSDPEDEANETEDEDPGGHGDENEDEEDDDYDDRIRA
EIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVPNKKPPPV
TVHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQSSTTGSGLSGPA
PTIPSPPNTGTKMHKTAPLGDLVAGSDITHRTYTGPSMDERGGQDVEVDL
STEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNACMSS
LQAFYKGPHEDLNLDIAFCLCKKTSSSQQNGNGNRHDMCMIAQEKLHPVC
AQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYEQACAV
DSVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVGWRRLL
WMNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTSTTTTRAPPPPP
PPTTTTTTTTSMQPRQTPRKPATHIFKDVITAKEKSEPTSVEHNYLDPPD
SIPLPSVNVESGGNGGNDDYHNGNGNGHGNGNGNGNGRRKNGGKGRGGSV
DFDDPVIFVDPRETTEFVGISITEPVTTSTTTMATTTTTQPPRNCVVQRP
RQSDQLIREGSSKRIYSLDDVECSELCSCGESLILTCHALCVPFAPCRTA
LAFYSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPGGIFLLLGYSAA
DEALLRPHTNLGVQDAVRALQQYITTYIDNQTQCTLTLFNMTEENIIIAA
RLPHDGKLKDIELLRKEKDECTAILKTISHQINSEHSELQSHRLLSIFKM
SEVEVVWPESTSAAARSGHGPGQFAGCHRLLYAAMLALAYLSSWTTLRMS
DVATooooooooooo
>C3
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQPRPKAKPRPKPKAKPKPKPRQRHHGMNGTEL
MTNNIEYHDEPNGLSDPEDEANETEDEDPGSHGDEDEDEEDDDYDDRIRA
EIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVANKKPPPV
TVHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQSSTTGSGLPGPA
PTIPSPPNTGTKMHKTAPLGDLVAGSDITHRTYTGPSIDERGGQDVEVDL
STEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNACMSS
LQAFYKGPHEDLNLDIAFCLCKKTSSSQQNGNGNRHDMCMIAQEKLHPVC
AQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYEQACAV
DSVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVGWRRLL
WMNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTTTTTRAPPPPP
PPTTTTTTTTSMQPRQTPRKPATHIFKDVITAKEKSEPTSVEHNYLDPPD
SIPLPSVNVESGGNGGNDDYHNGNGNGHGNGNGNGNGRRKNGGKGRVGSV
DFDDPVIFVDPRETTEFVGISITEPVTTTTTTMATTTTTQPPRNCVVQRP
RQSDQLIREGSSKRIYSLDDVECSELCSCGESLILTCHALCVPFAPCRTA
LAFYSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPGGIFLLLGYSAA
DEALLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLFNMTEENIIIAA
RLPHDGKLKDIELLRKEKDECTAILKTISHQINSEHSELQSHRLLSIFKM
SEVEVVWPESTSAAARSGHGPGQFAGCHRLLYAAMLALAYLSSWTTLRMS
DVATooooooooooo
>C4
MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQPRAKPKPRPKPKAKSKPKPRQKQKHHGLNGT
ELMTNNIEYHDEPNGLNDPEDEGNETEDEDPGGHGDGDEDEDEEDDDYDD
RIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVANKR
PPPVTVHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQSSTTGSGL
PGPAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHRTYTGPSMDERGGQDV
EVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNA
CMSSLQAFYKGPHEDLNLDIAFCLCKKTSSSQQNGNGNRHDMCMIAQEKL
HPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYEQ
ACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVGW
RRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTTTTTRAP
PPPPPPTTTTTTTTSLQPRQTPRKPATHIFKDVITAKEKSEPSSVEHNYL
DPPDSIPLPSVNVESGGNGGNDDYHNGNGHGNGHGNGNGNGNGRRKNGGK
GRGGSVDFDDPVIFVDPRETTEFVGISITEPVTTTTTTMATTTTTQPPRN
CVVQRPRQSDQLIREGSSKRIYSLDDVECSELCSCGESLILTCHALCVPF
APCRTALAFYSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPGGIFLL
LGYSAADEALLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLFNMTEE
NIIIAARLPHDGKLKDIDLLRKEKDECTAILKTISHQINSEHSELQSHRL
LSIFKMSEVEVVWPESTSAAARSGHGPGQFAGCRRLLYAAMLALAYFSRW
TTVRMSDVATooooo
>C5
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQQRPKAKPRPKPKAKPKPKLKQKHHGINGTEL
MTNNIEYHDEPNGLNEPEEEGNETEVEDPDGNAEDDEDEEDDDYDDRIRA
EIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVSNKKPPPS
VHHHNTELEHDVVVVVDAGPHSHSHPHSHTYYSHGDQSSTTGSGSGSGLS
VPAPTLPSPPNTGTKMHKTAPLGDLVAGSDITHRTYTGPTMDERGGQDVE
VDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNAC
MSSLQAFYKGPHEDLNLDIAFCLCKKTSSVQQNGNGNRHDMCMIAQEKLH
PVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYEQA
CAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVGWR
RLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTTTTTRAPP
PPPPPTTTTTTTTSLQPKQTPRKPATHIFKDVIAAKEKSEPTSVEHNYLD
PPDSIPLPSVNVESGGNGGNDDYRSSNGNGHGNGNGNGNGNGNGRRKNGE
KGRGGSIDFDDPVIFVDPRETTEFVGISITEPVTTTTTTMATTTTTQPPR
NCVVQRPRQSDQLIREGSSKRIYSLDDVECSELCSCGESLILTCHALCVP
FAPCRTALAFYSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPGGIFL
LLGYSAADEALLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLFNMTE
ENIIIAARLPHDGKLKDIELLRKEKDECTAILKTISHQINSEHSELQSHR
LLSIFKMSEVEVVWPESTSAAARSGHGPGQFAGCHRLLYATMLALAYLSS
WTTLRMSDVAToooo
>C6
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQQRPKAKPRPKPKGKPKTRPKPRQRHRGSNGT
ELLTNNIEYHDEPGGGLPDPEGEEGNETEDEDPDGNAEEEDEEEDDDYDD
RIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVTTHK
KPPSAPSVHHSGIEMEPDVVVVVDAGPHSHSHPHLHTFYAHGDQSSTTGS
GAPGPAPTVPSPPNTGTKMHKTALGDLVAGSDITHRTYTGPSMEERGGQD
VEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRN
ACMSSLQAFYKGPHEDLNLDIAFCLCKKTTSSLQSGNGNRHDMCMIAQEK
LHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSCKEDRECRLKLEYYE
QACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVG
WRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTTTTTRA
PPPPPPPTTTTTTTTSLQPRQTPRKPATHIFKDVIAPKEKSEPTSVEHNY
LDPPDSIPLPSVNVESGGNGGNDDYHNGNGNGHGNGNGNGNGNSNGNGRR
KNGGKGRGSSVDFDDPVIFVDPRETTEFVGISITEPVTTTTTTMATTTTT
QPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSELCSCGESLTLTCHA
LCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPG
GIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLF
NMTEENIIIAARLPHDGKLKDIELLRKEKDECTAILKTISHQINSEHSEL
QSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFAGCHRLLYAAMLAVA
CLSSWTTLRMSDVAT
>C7
MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
NPCVDRLIFFPNGLPKLKQPRPKAKPRPKSKPKPKPRQRHHGSNGTELMS
NNIEYHDEPNGMNDPEDEGDGTQDEDPDGDVEENQDEDEDEEEDDDYDDR
IRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEVVVANKK
PPLQPLEHDVVVVVDAGPHSHTHPHSHTFYSHGDQGSTTGSGLGSGSGSG
LAGAAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHRTYTGPSMDERGGQD
VEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRN
ACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSNQQNGNRHDMCMIAQEKLH
PVCAQRPPDNSNPASSNGIYYHPPPACHVVAESCKEDRECRLKLEYYEQA
CAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCACQGTDPQHLYQCVGWR
RLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTTTTTTTTTTSTTTRAPP
PPPPSTTTTTSTTSLQPRQTPRKPATHIFKDVTAPKEKSEPTSVEHNYLD
PPDSIPLPSVNVESGGNGGNDDYHNGNGHGNGNGNGNGNGNGNGSRRKNG
GKGRGGNVDFDDPVIFVDPRETTEFVGISITEPVTTTTTTMATTTTTQPP
RNCVVQRPRQSDQLIREGSSKRIYSLDDVECSELCSCGESLTLTCHALCV
PFAPCRTALAFYSHASPAYQAFRGRCLCYSGRFICMKPPLGEYILPGGIF
LLLGYSAADEALLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLFNMT
EENIIIAARLPHDGKLKDIELLRKEKDECTAILKTISHQINSEHSELQSH
RLLSIFKMSEVEVVWPESTSAAARSGHGPGQFAGCQCHRLLYAAMLALAY
LSSWTTLRMSDVATo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=1145 

C1              MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C2              MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C3              MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C4              MLKPFAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C5              MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C6              MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
C7              MLKPLAVIIGIFYLGSTIKGVVAILNCILARQLCFEDPSCSAILEIIPRV
                ****:*********************************************

C1              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C2              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C3              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C4              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C5              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C6              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
C7              CGPIPVSCSTVTVTKCQAALRTLQAFQFFRPTCLCKEPGMDPDCNHFRDF
                **************************************************

C1              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C2              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C3              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C4              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C5              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C6              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
C7              LFDHPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHC
                **************************************************

C1              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C2              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C3              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C4              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C5              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C6              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
C7              KVRDNKCKMENRDACHDSWTNLRLSPMFGCICPNNHMKKRCDRIFNIVNH
                **************************************************

C1              NPCVDRLIFFPNGLPKLKQPRPKAKPRPKPKPKSKPKPRQR--HHGMNGT
C2              NPCVDRLIFFPNGLPKLKQPRPKAKPRPKPKAKSKPKPRQR--HHGMNGT
C3              NPCVDRLIFFPNGLPKLKQPRPKAKPRPKPKAKPKPKPRQR--HHGMNGT
C4              NPCVDRLIFFPNGLPKLKQPRAKPKPRPKPKAKSKPKPRQKQKHHGLNGT
C5              NPCVDRLIFFPNGLPKLKQQRPKAKPRPKPKAKPKPKLKQK--HHGINGT
C6              NPCVDRLIFFPNGLPKLKQQRPKAKPRPKPKGKPKTRPKPRQRHRGSNGT
C7              NPCVDRLIFFPNGLPKLKQPRPKAKPRP--KSKPKPKPRQR--HHGSNGT
                ******************* *.*.****  * *.*.: : :  *:* ***

C1              ELMTNNIEYHDEPNG-LSDPE-DEANETVDEDPGGHGD--EDEDE---ED
C2              ELMTNNIEYHDEPSG-LSDPE-DEANETEDEDPGGHGD--ENEDE---ED
C3              ELMTNNIEYHDEPNG-LSDPE-DEANETEDEDPGSHGD--EDEDE---ED
C4              ELMTNNIEYHDEPNG-LNDPE-DEGNETEDEDPGGHGDGDEDEDE---ED
C5              ELMTNNIEYHDEPNG-LNEPE-EEGNETEVEDPDGNAE--DDEDE---ED
C6              ELLTNNIEYHDEPGGGLPDPEGEEGNETEDEDPDGNAE--EEDEE---ED
C7              ELMSNNIEYHDEPNG-MNDPE-DEGDGTQDEDPDGDVEENQDEDEDEEED
                **::*********.* : :** :*.: *  ***... :  ::::*   **

C1              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
C2              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
C3              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
C4              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
C5              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
C6              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
C7              DDYDDRIRAEIYSNYPHYLHPPSWGINNPLVLASHSPHTLDDDDDVVVEV
                **************************************************

C1              VANKKPPPVT--LHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQS
C2              VPNKKPPPVT--VHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQS
C3              VANKKPPPVT--VHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQS
C4              VANKRPPPVT--VHHHNDELDHDVVVVVDAGPHSHSHPHSHTFYSHGDQS
C5              VSNKKPPPS---VHHHNTELEHDVVVVVDAGPHSHSHPHSHTYYSHGDQS
C6              VTTHKKPPSAPSVHHSGIEMEPDVVVVVDAGPHSHSHPHLHTFYAHGDQS
C7              VVANKKPPL--------QPLEHDVVVVVDAGPHSHTHPHSHTFYSHGDQG
                *  :: **           :: *************:*** **:*:****.

C1              STTGSG--------LPGPAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHR
C2              STTGSG--------LSGPAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHR
C3              STTGSG--------LPGPAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHR
C4              STTGSG--------LPGPAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHR
C5              STTGSGSGSG----LSVPAPTLPSPPNTGTKMHKTAPLGDLVAGSDITHR
C6              STTGSG--------APGPAPTVPSPPNTGTKMHKTA-LGDLVAGSDITHR
C7              STTGSGLGSGSGSGLAGAAPTIPSPPNTGTKMHKTAPLGDLVAGSDITHR
                ******         . .***:************** *************

C1              TYTGPSMDERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
C2              TYTGPSMDERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
C3              TYTGPSIDERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
C4              TYTGPSMDERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
C5              TYTGPTMDERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
C6              TYTGPSMEERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
C7              TYTGPSMDERGGQDVEVDLSTEIIKQHFQSTCHTALDTCREDPSCSSSLQ
                *****:::******************************************

C1              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSS-QQNG
C2              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSSQQNG
C3              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSSQQNG
C4              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSSQQNG
C5              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSVQQNG
C6              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTTSSLQSG
C7              PMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKTSSNQQNG
                *******************************************:*  *.*

C1              NGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSC
C2              NGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSC
C3              NGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSC
C4              NGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSC
C5              NGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSC
C6              NGNRHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVADSC
C7              N--RHDMCMIAQEKLHPVCAQRPPDNSNPASSNGIYYHPPPACHVVAESC
                *  ********************************************:**

C1              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
C2              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
C3              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
C4              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
C5              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
C6              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
C7              KEDRECRLKLEYYEQACAVDSVTKKCAGRPSGCRTAMIGILGTMLRTTCA
                **************************************************

C1              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
C2              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
C3              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
C4              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
C5              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
C6              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
C7              CQGTDPQHLYQCVGWRRLLWMNPCVVEAQKDFHMKRLAELGFLTTTTTTT
                **************************************************

C1              TTTTTTTTTTTTRAPPPPPPPTTTTTTTTSMQPRQTPRKPATHIFKDVIT
C2              TTTTTTTSTTTTRAPPPPPPPTTTTTTTTSMQPRQTPRKPATHIFKDVIT
C3              TTTTTTTTTTTTRAPPPPPPPTTTTTTTTSMQPRQTPRKPATHIFKDVIT
C4              TTTTTTTTTTTTRAPPPPPPPTTTTTTTTSLQPRQTPRKPATHIFKDVIT
C5              TTTTTTTTTTTTRAPPPPPPPTTTTTTTTSLQPKQTPRKPATHIFKDVIA
C6              TTTTTTTTTTTTRAPPPPPPPTTTTTTTTSLQPRQTPRKPATHIFKDVIA
C7              TTTTTTTTSTTTRAPPPPPPSTTTTTSTTSLQPRQTPRKPATHIFKDVTA
                *******::***********.*****:***:**:************** :

C1              AKEKSEPTSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYH--NGN--GNG
C2              AKEKSEPTSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYH--NGN--GNG
C3              AKEKSEPTSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYH--NGN--GNG
C4              AKEKSEPSSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYH--NGNGHGNG
C5              AKEKSEPTSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYRSSNGNGHGNG
C6              PKEKSEPTSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYHNGNGNGHGNG
C7              PKEKSEPTSVEHNYLDPPDSIPLPSVNVESGGNGGNDDYHNGNGHGNGNG
                .******:*******************************:  **:  ***

C1              HGNGNGNG----RRKNGGKGRGGSVDFDDPVIFVDPRETTEFVGISITEP
C2              HGNGNGNGNG--RRKNGGKGRGGSVDFDDPVIFVDPRETTEFVGISITEP
C3              HGNGNGNGNG--RRKNGGKGRVGSVDFDDPVIFVDPRETTEFVGISITEP
C4              HGNGNGNGNG--RRKNGGKGRGGSVDFDDPVIFVDPRETTEFVGISITEP
C5              NGNGNGNGNG--RRKNGEKGRGGSIDFDDPVIFVDPRETTEFVGISITEP
C6              NGNGNGNSNGNGRRKNGGKGRGSSVDFDDPVIFVDPRETTEFVGISITEP
C7              NGNGNGNGNGS-RRKNGGKGRGGNVDFDDPVIFVDPRETTEFVGISITEP
                :******.    ***** *** ..:*************************

C1              VTTTTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
C2              VTTSTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
C3              VTTTTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
C4              VTTTTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
C5              VTTTTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
C6              VTTTTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
C7              VTTTTTTMATTTTTQPPRNCVVQRPRQSDQLIREGSSKRIYSLDDVECSE
                ***:**********************************************

C1              LCSCGESLILTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
C2              LCSCGESLILTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
C3              LCSCGESLILTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
C4              LCSCGESLILTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
C5              LCSCGESLILTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
C6              LCSCGESLTLTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
C7              LCSCGESLTLTCHALCVPFAPCRTALAFYSHASPAYQAFRGRCLCYSGRF
                ******** *****************************************

C1              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVT
C2              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYIT
C3              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVT
C4              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVT
C5              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVT
C6              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVT
C7              ICMKPPLGEYILPGGIFLLLGYSAADEALLRPHTNLGVQDAVRALQQYVT
                ************************************************:*

C1              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIELLRKEKDECTAIL
C2              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIELLRKEKDECTAIL
C3              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIELLRKEKDECTAIL
C4              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIDLLRKEKDECTAIL
C5              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIELLRKEKDECTAIL
C6              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIELLRKEKDECTAIL
C7              TYIDNQTQCTLTLFNMTEENIIIAARLPHDGKLKDIELLRKEKDECTAIL
                ************************************:*************

C1              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
C2              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
C3              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
C4              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
C5              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
C6              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
C7              KTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGHGPGQFA
                **************************************************

C1              G--CDRLLYAAMLALAYLSSWTTLRMSDVAToooooooooooooo
C2              G--CHRLLYAAMLALAYLSSWTTLRMSDVATooooooooooo---
C3              G--CHRLLYAAMLALAYLSSWTTLRMSDVATooooooooooo---
C4              G--CRRLLYAAMLALAYFSRWTTVRMSDVATooooo---------
C5              G--CHRLLYATMLALAYLSSWTTLRMSDVAToooo----------
C6              G--CHRLLYAAMLAVACLSSWTTLRMSDVAT--------------
C7              GCQCHRLLYAAMLALAYLSSWTTLRMSDVATo-------------
                *  * *****:***:* :* ***:*******              




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [51606]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfrl-PH/batch/allfiles/tcof