--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 16 23:51:51 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/257/Gfat1-PF/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2935.96         -2944.93
2      -2936.07         -2946.00
--------------------------------------
TOTAL    -2936.02         -2945.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.912159    0.015608    0.690897    1.174277    0.900269   1475.62   1488.31    1.000
r(A<->C){all}   0.125304    0.000816    0.068366    0.179000    0.123795    934.77   1145.14    1.000
r(A<->G){all}   0.373520    0.003134    0.265740    0.481918    0.370770    798.46    867.97    1.000
r(A<->T){all}   0.058165    0.000700    0.011073    0.111344    0.055579    835.86    959.69    1.000
r(C<->G){all}   0.012636    0.000087    0.000001    0.030822    0.010816   1318.22   1324.31    1.000
r(C<->T){all}   0.368232    0.002515    0.272497    0.467975    0.367262    844.67    945.65    1.000
r(G<->T){all}   0.062142    0.000382    0.026698    0.101515    0.060087   1227.71   1228.66    1.000
pi(A){all}      0.229834    0.000119    0.207942    0.250007    0.229575   1227.82   1261.00    1.000
pi(C){all}      0.275758    0.000125    0.254969    0.298191    0.275586   1501.00   1501.00    1.000
pi(G){all}      0.260222    0.000132    0.237722    0.282347    0.260090    895.06   1198.03    1.000
pi(T){all}      0.234186    0.000115    0.212297    0.254238    0.234397   1202.43   1265.64    1.000
alpha{1,2}      0.030872    0.000370    0.000153    0.063604    0.029572   1298.22   1344.84    1.000
alpha{3}        3.881736    1.109113    1.913491    5.866375    3.752311   1501.00   1501.00    1.000
pinvar{all}     0.446452    0.001438    0.371988    0.520269    0.446483   1411.94   1431.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2671.201949
Model 2: PositiveSelection	-2671.201949
Model 0: one-ratio	-2672.907872
Model 3: discrete	-2670.402957
Model 7: beta	-2670.827861
Model 8: beta&w>1	-2670.827932


Model 0 vs 1	3.411846000000878

Model 2 vs 1	0.0

Model 8 vs 7	1.4199999986885814E-4
>C1
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C2
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C3
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C4
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=434 

C1              MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
C2              MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
C3              MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
C4              MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
                **************************************************

C1              LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
C2              LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
C3              LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
C4              LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
                **************************************************

C1              GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
C2              GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
C3              GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
C4              GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
                **************************************************

C1              VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
C2              VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
C3              VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
C4              VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
                **************************************************

C1              NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
C2              NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
C3              NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
C4              NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
                **************************************************

C1              SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY
C2              SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
C3              SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
C4              SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY
                **************:****** **:**:**:*******************

C1              NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
C2              NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
C3              NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
C4              NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
                **************************************************

C1              VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
C2              VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
C3              VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
C4              VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI
                ******************************:*******************

C1              LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
C2              LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
C3              LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
C4              LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
                **********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  434 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  434 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5208]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [5208]--->[5208]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.260 Mb, Max= 30.585 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C2
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C3
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C4
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE

FORMAT of file /tmp/tmp6783399981136000706aln Not Supported[FATAL:T-COFFEE]
>C1
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C2
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C3
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C4
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:434 S:100 BS:434
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.31 C1	 C2	 99.31
TOP	    1    0	 99.31 C2	 C1	 99.31
BOT	    0    2	 99.54 C1	 C3	 99.54
TOP	    2    0	 99.54 C3	 C1	 99.54
BOT	    0    3	 98.85 C1	 C4	 98.85
TOP	    3    0	 98.85 C4	 C1	 98.85
BOT	    1    2	 99.77 C2	 C3	 99.77
TOP	    2    1	 99.77 C3	 C2	 99.77
BOT	    1    3	 98.85 C2	 C4	 98.85
TOP	    3    1	 98.85 C4	 C2	 98.85
BOT	    2    3	 99.08 C3	 C4	 99.08
TOP	    3    2	 99.08 C4	 C3	 99.08
AVG	 0	 C1	  *	 99.23
AVG	 1	 C2	  *	 99.31
AVG	 2	 C3	  *	 99.46
AVG	 3	 C4	  *	 98.92
TOT	 TOT	  *	 99.23
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTTTTCGCATCGGACGCCTC
C2              ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC
C3              ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC
C4              ATGCCCTTGGAAGAAAAGGAAGTAGAATACTTCTTCGCATCGGATGCCTC
                **************.********:**.***** *****.***** *****

C1              AGCCGTCATAGAGCACACTAACCGGGTCATCTATTTGGAGGACGACGATG
C2              AGCCGTCATAGAGCACACTAACAGGGTCATCTATTTGGAGGACGACGATG
C3              AGCCGTCATAGAGCACACTAACCGAGTCATCTATTTGGAGGACGACGATG
C4              GGCCGTCATTGAGCACACTAACCGGGTGATCTATTTGGAGGACGACGATG
                .********:************.*.** **********************

C1              TTGCTGCTGTTCGGGATGGAACTTTGAGTATACATCGCCTAAAGAAGAGC
C2              TTGCTGCTGTTCGGGATGGTACATTGAGTATCCATCGCCTGAAGAAGAGC
C3              TTGCTGCTGTTCGGGATGGTACCTTGAGTATCCATCGCCTAAAGAAGAGC
C4              TGGCCGCAGTTCGGGACGGAACTCTGAGTATTCATCGTCTAAAGAAAAGT
                * ** **:******** **:**  ******* ***** **.*****.** 

C1              CTGGATGATCCGCACGCTCGCGAAATCACTACCCTAAAAATGGAAATTCA
C2              CTGGATGATCCGCATGCTCGTGAAATCACTACCCTAAAGATGGAAATTCA
C3              CTGGATGATCCGCACGCGCGCGAAATCACTACCCTGAAGATGGAAATTCA
C4              TTAGATGACCCGCATGCCCGTGAGATCACTACATTAAAGATGGAAATCCA
                 *.***** ***** ** ** **.********. *.**.******** **

C1              ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG
C2              ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTTG
C3              ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG
C4              ACAGATCATGAAGGGCAACTATGACTACTTCATGCAGAAGGAGATTTTTG
                ***************.*********** ** *****.*********** *

C1              AGCAGCCCGACTCCGTGGTGAACACAATGCGCGGTCGCGTCCGCTTCGAT
C2              AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT
C3              AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT
C4              AGCAGCCCGACTCTGTGGTCAACACGATGCGTGGTCGCGTTCGCTTCGAC
                ************* ***** ** **.***** ******** ******** 

C1              GGTAACGCCATAGTGCTCGGCGGGATCAAAGACTACATTCCTGAAATCAA
C2              GGGAACGCCATAGTGCTCGGCGGAATTAAGGACTACATTCCTGAAATCAA
C3              GGGAACGCCATAGTGCTCGGCGGAATCAAAGACTACATTCCTGAAATCAA
C4              GGTAACGCGATTGTGCTCGGCGGTATCAAGGACTACATTCCGGAAATCAA
                ** ***** **:*********** ** **.*********** ********

C1              ACGCTGTCGACGCCTGATGTTGATTGGATGTGGCACATCTTACCACAGCG
C2              ACGCTGTCGACGCCTGATGTTGATAGGATGTGGCACATCCTACCACAGCG
C3              ACGCTGTCGACGCCTGATGTTGATTGGCTGTGGCACATCTTACCACAGCG
C4              ACGTTGTCGCCGTCTCATGCTGATCGGGTGTGGCACGTCTTACCACAGCG
                *** *****.** ** *** **** ** ********.** **********

C1              CTGTAGCCACTAGGCAGCTGCTCGAAGAACTCACAGAGCTTCCCGTGATG
C2              CTGTTGCCACTAGACAGCTTTTAGAAGAGCTCACGGAGCTCCCCGTGATG
C3              CTGTTGCCACTAGGCAGCTTCTGGAAGAGCTCACGGAGCTTCCCGTGATG
C4              CCGTAGCCACCAGGCAGCTGCTCGAAGAGCTCACTGAGCTTCCTGTCATG
                * **:***** **.*****  * *****.***** ***** ** ** ***

C1              GTTGAGCTGGCTTCCGACTTTTTAGACCGAAACACTCCTATTTTTCGAGA
C2              GTTGAGCTTGCTTCCGATTTCTTAGACCGGAACACGCCTATTTTCAGAGA
C3              GTCGAGCTGGCTTCCGATTTCTTAGACCGGAATACGCCTATTTTCCGAGA
C4              GTCGAGCTGGCGTCTGACTTCCTGGACCGCAACACACCAATCTTCCGCGA
                ** ***** ** ** ** **  *.***** ** ** **:** ** .*.**

C1              CGACGTCTGCTTTTTTATATCGCAGTCCGGAGAGACTGCCGACACCCTGA
C2              CGACGTCTGCTTCTTCATATCGCAGTCTGGAGAGACTGCCGACACCCTAA
C3              CGACGTCTGCTTCTTCATATCGCAGTCCGGAGAGACTGCCGACACCCTGA
C4              CGACGTCTGCTTCTTTATATCGCAGTCCGGCGAGACGGCGGACACCCTAA
                ************ ** *********** **.***** ** ********.*

C1              TGGCCTTACGTTACTGTAAGCAGCGAGGAGCCCTGATTGTGGGCATTACG
C2              TGGCCTTGCGCTACTGTAAGCAGCGGGGAGCTCTGATTGTGGGAATTACG
C3              TGGCCTTGCGTTACTGTAAGCAGCGGGGAGCCCTAATTGTGGGCATTACG
C4              TGGCTTTGCGATACTGCAAACAGCGGGGAGCCCTGATTGTGGGCATTACA
                **** **.** ***** **.*****.***** **.********.*****.

C1              AATACCGTAGGCAGCAGCATATGTCGGGAATCGCATTGTGGAGTGCACAT
C2              AATACCGTAGGTAGCAGCATCTGTCGCGAATCGCATTGTGGAGTGCACAT
C3              AATACCGTAGGCAGCAGCATCTGTCGCGAATCGCATTGTGGAGTTCACAT
C4              AACACTGTAGGCAGCAGTATCTGCCGGGAATCGCATTGTGGAGTCCACAT
                ** ** ***** ***** **.** ** ***************** *****

C1              TAATGCCGGACCAGAGATAGGCGTGGCCTCGACCAAGGCATACACCTCCC
C2              AAACGCTGGGCCAGAGATAGGCGTAGCCTCGACCAAGGCCTACACCTCCC
C3              TAACGCCGGCCCAGAGATAGGCGTGGCCTCGACCAAGGCCTACACCTCCC
C4              TAACGCTGGCCCCGAGATTGGAGTGGCCTCTACAAAGGCATACACCTCGC
                :** ** ** **.*****:**.**.***** **.*****.******** *

C1              AATTCATTTCCCTGGTGATGTTCGCTCTAGTTATGTCCGAAGATCGACTG
C2              AGTTCATTTCTTTGGTGATGTTCGCTCTAGTTATGTCCGAGGATCGGCTG
C3              AGTTCATTTCCCTGGTGATGTTCGCTCTGGTTATGTCCGAGGATCGGCTG
C4              AGTTCATTTCCCTGGTGATGTTCGCACTGGTTATGTCAGAGGATCGTCTT
                *.********  *************:**.********.**.***** ** 

C1              TCACTGCAACAGCGACGGCTTGAGATTCTGCAGGCGTTGTCCAAGCTCGC
C2              TCACTGCAGCAGCGACGGCTTGAAATTCTGCAGGCGTTGTCCAATCTCGC
C3              TCATTGCAACAGCGACGGCTGGAGATTCTGCAGGCGTTGTCAAAGCTCGC
C4              TCACTGCAACAGCGACGGCTGGAGATCCTGCAAGCGCTGTCCAAGCTTGC
                *** ****.*********** **.** *****.*** ****.** ** **

C1              GGATCAAATCCGAGACGTTCTGCAGCTGGACTCCAAAGTTAAAGAACTGG
C2              GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAGGTTCAAGAACTGG
C3              GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAAGTTCAAGAACTGG
C4              TGACCAAATCCGCGAAGTTCTCAAGCTTGATACAAAAGTTCAAGAGCTGG
                 ** ********.*..***** .**** ** :*.**.***.****.****

C1              CCAAAGACCTATACCAACACAAGTCGCTTCTGATAATGGGTAGGGGCTAC
C2              CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC
C3              CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC
C4              CCAAAGACCTTTACCAACACAAGTCGCTACTTATCATGGGTCGCGGCTAC
                **********:**************.**:** **.******.* ******

C1              AACTTTGCCACTTGCCTAGAAGGTGCATTGAAAGTCAAAGAGTTGACTTA
C2              AACTTTGCCACCTGCCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA
C3              AACTTTGCCACCTGTCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA
C4              AATTTCGCAACCTGTCTGGAAGGTGCCCTGAAAGTCAAGGAGCTGACCTA
                ** ** **.** ** **.********. **********.*** **** **

C1              CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG
C2              CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG
C3              CATGCACAGTGAGGGCATCATGGCTGGTGAATTGAAGCACGGTCCACTGG
C4              CATGCACAGCGAGGGCATTATGGCCGGTGAACTAAAGCACGGCCCTCTGG
                ********* ******** ***** ****** *.******** **:****

C1              CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTGCGGGACCCC
C2              CTCTTGTAGACGACTCCATGCCCGTGCTGATGATTGTCTTGCGGGACCCC
C3              CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTACGCGACCCC
C4              CCCTCGTGGACGACTCCATGCCAGTTCTAATGATAGTCCTTCGGGACCCC
                * ** **.**************.** **.*****:**  * ** ******

C1              GTTTACGTAAAGTGCATGAACGCTCTACAGCAGGTCACATCCCGCAAAGG
C2              GTTTACGTAAAGTGCATGAACGCCTTACAACAGGTAACATCCCGCAAGGG
C3              GTTTACGTAAAGTGCATGAACGCTCTACAACAGGTCACATCCCGCAAGGG
C4              GTTTATGTCAAGTGCATGAACGCTCTGCAGCAGGTCACATCGCGCAAGGG
                ***** **.**************  *.**.*****.***** *****.**

C1              ATGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT
C2              CTGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT
C3              CTGCCCGATTATTATCTGCGAGGAAGGCGACGAGGAGACCAAGGCTTTCT
C4              CTGCCCTATTATTATTTGTGAGGAGGGAGACGAGGAGACCCAGGCCTTCT
                .***** ******** ** *****.**.************.**** ****

C1              CCTCCCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT
C2              CCTCTCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT
C3              CTTCCCGCCATCTGGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT
C4              CATCCCGGCACCTCGAGATCCCTCGCACCGTTGACTGTCTGCAGGGAATT
                * ** ** ** ** ***** *********** ***** *****.******

C1              CTCACCGTTATCCCAATGCAACTACTGTCTTATCATATTGCCGTGCTTCG
C2              CTCACCGTTATACCAATGCAACTGCTGTCTTATCATATTGCCGTTCTCCG
C3              CTCACTGTTATCCCAATGCAACTGCTGTCTTATCATATTGCCGTGCTCCG
C4              CTCACCGTTATTCCCATGCAACTCTTATCCTATCATATTGCCGTGCTGCG
                ***** ***** **.********  *.** ************** ** **

C1              CGGATGCGACGTTGACTGTCCTAGAAACTTAGCAAAGTCTGTGACAGTTG
C2              CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAGTCCGTCACAGTTG
C3              CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAATCCGTGACAGTTG
C4              CGGGTGCGATGTTGACTGTCCTAGAAACCTGGCCAAGTCCGTGACGGTTG
                ***.***** *********** ****** *.**.**.** ** **.****

C1              AG
C2              AG
C3              AG
C4              AG
                **



>C1
ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTTTTCGCATCGGACGCCTC
AGCCGTCATAGAGCACACTAACCGGGTCATCTATTTGGAGGACGACGATG
TTGCTGCTGTTCGGGATGGAACTTTGAGTATACATCGCCTAAAGAAGAGC
CTGGATGATCCGCACGCTCGCGAAATCACTACCCTAAAAATGGAAATTCA
ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG
AGCAGCCCGACTCCGTGGTGAACACAATGCGCGGTCGCGTCCGCTTCGAT
GGTAACGCCATAGTGCTCGGCGGGATCAAAGACTACATTCCTGAAATCAA
ACGCTGTCGACGCCTGATGTTGATTGGATGTGGCACATCTTACCACAGCG
CTGTAGCCACTAGGCAGCTGCTCGAAGAACTCACAGAGCTTCCCGTGATG
GTTGAGCTGGCTTCCGACTTTTTAGACCGAAACACTCCTATTTTTCGAGA
CGACGTCTGCTTTTTTATATCGCAGTCCGGAGAGACTGCCGACACCCTGA
TGGCCTTACGTTACTGTAAGCAGCGAGGAGCCCTGATTGTGGGCATTACG
AATACCGTAGGCAGCAGCATATGTCGGGAATCGCATTGTGGAGTGCACAT
TAATGCCGGACCAGAGATAGGCGTGGCCTCGACCAAGGCATACACCTCCC
AATTCATTTCCCTGGTGATGTTCGCTCTAGTTATGTCCGAAGATCGACTG
TCACTGCAACAGCGACGGCTTGAGATTCTGCAGGCGTTGTCCAAGCTCGC
GGATCAAATCCGAGACGTTCTGCAGCTGGACTCCAAAGTTAAAGAACTGG
CCAAAGACCTATACCAACACAAGTCGCTTCTGATAATGGGTAGGGGCTAC
AACTTTGCCACTTGCCTAGAAGGTGCATTGAAAGTCAAAGAGTTGACTTA
CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG
CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTGCGGGACCCC
GTTTACGTAAAGTGCATGAACGCTCTACAGCAGGTCACATCCCGCAAAGG
ATGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT
CCTCCCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT
CTCACCGTTATCCCAATGCAACTACTGTCTTATCATATTGCCGTGCTTCG
CGGATGCGACGTTGACTGTCCTAGAAACTTAGCAAAGTCTGTGACAGTTG
AG
>C2
ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC
AGCCGTCATAGAGCACACTAACAGGGTCATCTATTTGGAGGACGACGATG
TTGCTGCTGTTCGGGATGGTACATTGAGTATCCATCGCCTGAAGAAGAGC
CTGGATGATCCGCATGCTCGTGAAATCACTACCCTAAAGATGGAAATTCA
ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTTG
AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT
GGGAACGCCATAGTGCTCGGCGGAATTAAGGACTACATTCCTGAAATCAA
ACGCTGTCGACGCCTGATGTTGATAGGATGTGGCACATCCTACCACAGCG
CTGTTGCCACTAGACAGCTTTTAGAAGAGCTCACGGAGCTCCCCGTGATG
GTTGAGCTTGCTTCCGATTTCTTAGACCGGAACACGCCTATTTTCAGAGA
CGACGTCTGCTTCTTCATATCGCAGTCTGGAGAGACTGCCGACACCCTAA
TGGCCTTGCGCTACTGTAAGCAGCGGGGAGCTCTGATTGTGGGAATTACG
AATACCGTAGGTAGCAGCATCTGTCGCGAATCGCATTGTGGAGTGCACAT
AAACGCTGGGCCAGAGATAGGCGTAGCCTCGACCAAGGCCTACACCTCCC
AGTTCATTTCTTTGGTGATGTTCGCTCTAGTTATGTCCGAGGATCGGCTG
TCACTGCAGCAGCGACGGCTTGAAATTCTGCAGGCGTTGTCCAATCTCGC
GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAGGTTCAAGAACTGG
CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC
AACTTTGCCACCTGCCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA
CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG
CTCTTGTAGACGACTCCATGCCCGTGCTGATGATTGTCTTGCGGGACCCC
GTTTACGTAAAGTGCATGAACGCCTTACAACAGGTAACATCCCGCAAGGG
CTGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT
CCTCTCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT
CTCACCGTTATACCAATGCAACTGCTGTCTTATCATATTGCCGTTCTCCG
CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAGTCCGTCACAGTTG
AG
>C3
ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC
AGCCGTCATAGAGCACACTAACCGAGTCATCTATTTGGAGGACGACGATG
TTGCTGCTGTTCGGGATGGTACCTTGAGTATCCATCGCCTAAAGAAGAGC
CTGGATGATCCGCACGCGCGCGAAATCACTACCCTGAAGATGGAAATTCA
ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG
AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT
GGGAACGCCATAGTGCTCGGCGGAATCAAAGACTACATTCCTGAAATCAA
ACGCTGTCGACGCCTGATGTTGATTGGCTGTGGCACATCTTACCACAGCG
CTGTTGCCACTAGGCAGCTTCTGGAAGAGCTCACGGAGCTTCCCGTGATG
GTCGAGCTGGCTTCCGATTTCTTAGACCGGAATACGCCTATTTTCCGAGA
CGACGTCTGCTTCTTCATATCGCAGTCCGGAGAGACTGCCGACACCCTGA
TGGCCTTGCGTTACTGTAAGCAGCGGGGAGCCCTAATTGTGGGCATTACG
AATACCGTAGGCAGCAGCATCTGTCGCGAATCGCATTGTGGAGTTCACAT
TAACGCCGGCCCAGAGATAGGCGTGGCCTCGACCAAGGCCTACACCTCCC
AGTTCATTTCCCTGGTGATGTTCGCTCTGGTTATGTCCGAGGATCGGCTG
TCATTGCAACAGCGACGGCTGGAGATTCTGCAGGCGTTGTCAAAGCTCGC
GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAAGTTCAAGAACTGG
CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC
AACTTTGCCACCTGTCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA
CATGCACAGTGAGGGCATCATGGCTGGTGAATTGAAGCACGGTCCACTGG
CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTACGCGACCCC
GTTTACGTAAAGTGCATGAACGCTCTACAACAGGTCACATCCCGCAAGGG
CTGCCCGATTATTATCTGCGAGGAAGGCGACGAGGAGACCAAGGCTTTCT
CTTCCCGCCATCTGGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT
CTCACTGTTATCCCAATGCAACTGCTGTCTTATCATATTGCCGTGCTCCG
CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAATCCGTGACAGTTG
AG
>C4
ATGCCCTTGGAAGAAAAGGAAGTAGAATACTTCTTCGCATCGGATGCCTC
GGCCGTCATTGAGCACACTAACCGGGTGATCTATTTGGAGGACGACGATG
TGGCCGCAGTTCGGGACGGAACTCTGAGTATTCATCGTCTAAAGAAAAGT
TTAGATGACCCGCATGCCCGTGAGATCACTACATTAAAGATGGAAATCCA
ACAGATCATGAAGGGCAACTATGACTACTTCATGCAGAAGGAGATTTTTG
AGCAGCCCGACTCTGTGGTCAACACGATGCGTGGTCGCGTTCGCTTCGAC
GGTAACGCGATTGTGCTCGGCGGTATCAAGGACTACATTCCGGAAATCAA
ACGTTGTCGCCGTCTCATGCTGATCGGGTGTGGCACGTCTTACCACAGCG
CCGTAGCCACCAGGCAGCTGCTCGAAGAGCTCACTGAGCTTCCTGTCATG
GTCGAGCTGGCGTCTGACTTCCTGGACCGCAACACACCAATCTTCCGCGA
CGACGTCTGCTTCTTTATATCGCAGTCCGGCGAGACGGCGGACACCCTAA
TGGCTTTGCGATACTGCAAACAGCGGGGAGCCCTGATTGTGGGCATTACA
AACACTGTAGGCAGCAGTATCTGCCGGGAATCGCATTGTGGAGTCCACAT
TAACGCTGGCCCCGAGATTGGAGTGGCCTCTACAAAGGCATACACCTCGC
AGTTCATTTCCCTGGTGATGTTCGCACTGGTTATGTCAGAGGATCGTCTT
TCACTGCAACAGCGACGGCTGGAGATCCTGCAAGCGCTGTCCAAGCTTGC
TGACCAAATCCGCGAAGTTCTCAAGCTTGATACAAAAGTTCAAGAGCTGG
CCAAAGACCTTTACCAACACAAGTCGCTACTTATCATGGGTCGCGGCTAC
AATTTCGCAACCTGTCTGGAAGGTGCCCTGAAAGTCAAGGAGCTGACCTA
CATGCACAGCGAGGGCATTATGGCCGGTGAACTAAAGCACGGCCCTCTGG
CCCTCGTGGACGACTCCATGCCAGTTCTAATGATAGTCCTTCGGGACCCC
GTTTATGTCAAGTGCATGAACGCTCTGCAGCAGGTCACATCGCGCAAGGG
CTGCCCTATTATTATTTGTGAGGAGGGAGACGAGGAGACCCAGGCCTTCT
CATCCCGGCACCTCGAGATCCCTCGCACCGTTGACTGTCTGCAGGGAATT
CTCACCGTTATTCCCATGCAACTCTTATCCTATCATATTGCCGTGCTGCG
CGGGTGCGATGTTGACTGTCCTAGAAACCTGGCCAAGTCCGTGACGGTTG
AG
>C1
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C2
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C3
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
>C4
MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS
LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD
GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM
VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT
NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL
SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY
NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP
VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI
LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 1302 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479340077
      Setting output file names to "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1126488652
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8654051536
      Seed = 1540926020
      Swapseed = 1479340077
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 14 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 71 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3330.500238 -- -26.620141
         Chain 2 -- -3360.855848 -- -26.620141
         Chain 3 -- -3360.855848 -- -26.620141
         Chain 4 -- -3356.696147 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3360.855848 -- -26.620141
         Chain 2 -- -3330.500238 -- -26.620141
         Chain 3 -- -3360.855848 -- -26.620141
         Chain 4 -- -3330.500238 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3330.500] (-3360.856) (-3360.856) (-3356.696) * [-3360.856] (-3330.500) (-3360.856) (-3330.500) 
        500 -- (-3096.325) (-3092.169) (-3096.966) [-3090.738] * [-3073.191] (-3095.174) (-3082.515) (-3092.656) -- 0:00:00
       1000 -- (-3092.622) (-3071.317) [-3067.943] (-3067.553) * (-3019.317) (-3075.934) (-3048.549) [-3028.424] -- 0:00:00
       1500 -- (-3057.730) [-2988.315] (-3029.790) (-3040.840) * [-2961.427] (-3049.398) (-2984.070) (-2979.761) -- 0:00:00
       2000 -- (-3012.660) [-2961.125] (-3015.212) (-2967.168) * (-2946.489) (-2977.499) [-2957.440] (-2964.634) -- 0:00:00
       2500 -- (-2951.352) (-2962.554) (-2950.249) [-2946.143] * (-2948.019) (-2956.258) [-2942.838] (-2966.079) -- 0:00:00
       3000 -- (-2945.142) (-2952.058) [-2946.653] (-2941.040) * (-2941.530) (-2958.436) [-2941.022] (-2961.169) -- 0:00:00
       3500 -- (-2943.929) [-2946.523] (-2950.037) (-2937.356) * (-2945.340) (-2950.203) [-2933.632] (-2949.351) -- 0:00:00
       4000 -- [-2936.372] (-2946.796) (-2952.774) (-2937.794) * (-2941.001) (-2948.734) [-2938.617] (-2944.226) -- 0:00:00
       4500 -- (-2940.775) (-2944.347) (-2947.048) [-2940.807] * (-2938.321) [-2944.203] (-2937.525) (-2940.854) -- 0:00:00
       5000 -- [-2940.742] (-2939.669) (-2949.057) (-2942.836) * (-2945.744) (-2944.457) (-2938.905) [-2939.975] -- 0:00:00

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-2939.401) (-2942.430) [-2943.018] (-2941.584) * (-2942.376) (-2945.749) [-2939.942] (-2937.038) -- 0:00:00
       6000 -- (-2940.566) [-2941.112] (-2945.448) (-2939.987) * (-2939.625) [-2938.089] (-2939.343) (-2942.211) -- 0:02:45
       6500 -- (-2936.956) (-2937.298) (-2945.681) [-2944.762] * (-2936.952) [-2944.145] (-2938.735) (-2935.471) -- 0:02:32
       7000 -- (-2940.592) [-2934.393] (-2941.052) (-2938.695) * (-2938.546) (-2936.470) [-2936.744] (-2943.558) -- 0:02:21
       7500 -- [-2947.684] (-2939.124) (-2942.248) (-2940.478) * [-2934.953] (-2937.474) (-2941.237) (-2941.305) -- 0:02:12
       8000 -- (-2939.276) (-2939.153) [-2935.806] (-2940.347) * (-2936.848) (-2939.927) [-2939.009] (-2936.666) -- 0:02:04
       8500 -- [-2936.025] (-2943.009) (-2933.476) (-2942.822) * (-2942.163) (-2946.789) [-2936.348] (-2936.107) -- 0:01:56
       9000 -- (-2937.749) [-2936.268] (-2936.816) (-2937.544) * (-2935.526) (-2943.566) [-2939.033] (-2942.094) -- 0:01:50
       9500 -- (-2940.174) (-2938.236) (-2935.114) [-2943.295] * (-2937.190) (-2937.193) [-2933.782] (-2935.262) -- 0:01:44
      10000 -- (-2938.746) (-2940.023) [-2939.944] (-2940.939) * [-2940.360] (-2944.011) (-2941.339) (-2938.573) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-2942.209] (-2937.859) (-2935.795) (-2936.850) * (-2947.703) [-2936.194] (-2944.920) (-2944.373) -- 0:01:34
      11000 -- (-2939.792) [-2943.360] (-2938.743) (-2936.756) * (-2937.783) [-2939.525] (-2941.130) (-2936.393) -- 0:01:29
      11500 -- [-2936.704] (-2943.687) (-2937.374) (-2936.284) * (-2944.838) (-2939.386) (-2946.119) [-2937.100] -- 0:01:25
      12000 -- (-2939.252) (-2939.410) (-2935.247) [-2935.135] * (-2938.173) (-2941.896) [-2938.263] (-2953.286) -- 0:01:22
      12500 -- [-2936.675] (-2940.035) (-2945.765) (-2937.441) * [-2934.654] (-2942.762) (-2942.615) (-2943.763) -- 0:02:38
      13000 -- (-2941.069) (-2934.199) (-2939.273) [-2937.950] * (-2942.428) [-2934.688] (-2935.834) (-2948.052) -- 0:02:31
      13500 -- [-2938.473] (-2938.245) (-2940.924) (-2939.034) * (-2936.333) (-2936.925) [-2939.786] (-2936.872) -- 0:02:26
      14000 -- (-2942.618) (-2936.932) [-2940.334] (-2940.455) * (-2937.247) [-2941.759] (-2940.470) (-2947.459) -- 0:02:20
      14500 -- (-2936.053) [-2940.131] (-2935.269) (-2939.257) * (-2947.294) (-2945.935) (-2937.746) [-2937.512] -- 0:02:15
      15000 -- (-2942.342) (-2942.641) (-2938.605) [-2941.338] * (-2937.476) (-2942.289) [-2936.226] (-2934.842) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-2939.564) (-2935.833) [-2938.278] (-2943.804) * (-2943.468) (-2937.277) (-2936.260) [-2937.124] -- 0:02:07
      16000 -- (-2941.756) (-2935.880) (-2937.844) [-2940.231] * (-2938.611) (-2937.978) (-2936.323) [-2939.857] -- 0:02:03
      16500 -- (-2948.959) [-2934.112] (-2938.655) (-2940.487) * (-2937.661) (-2937.793) (-2942.538) [-2943.436] -- 0:01:59
      17000 -- [-2945.715] (-2933.736) (-2945.676) (-2939.675) * (-2940.719) (-2937.048) [-2939.207] (-2939.178) -- 0:01:55
      17500 -- [-2935.482] (-2937.437) (-2941.853) (-2938.758) * (-2946.140) [-2940.936] (-2939.979) (-2944.408) -- 0:01:52
      18000 -- (-2951.432) (-2942.675) [-2934.680] (-2938.369) * (-2939.393) (-2942.249) (-2948.598) [-2941.375] -- 0:01:49
      18500 -- (-2945.679) [-2938.509] (-2935.790) (-2939.647) * [-2943.708] (-2938.077) (-2937.016) (-2943.284) -- 0:01:46
      19000 -- (-2934.470) (-2937.434) (-2941.334) [-2936.994] * (-2941.590) (-2937.381) [-2940.080] (-2942.790) -- 0:02:34
      19500 -- [-2934.697] (-2943.317) (-2937.484) (-2939.130) * (-2943.379) (-2944.242) (-2942.502) [-2942.850] -- 0:02:30
      20000 -- (-2944.173) [-2935.222] (-2937.150) (-2943.705) * [-2936.588] (-2937.490) (-2939.035) (-2939.455) -- 0:02:27

      Average standard deviation of split frequencies: 0.045620

      20500 -- [-2941.148] (-2944.542) (-2936.390) (-2943.804) * (-2938.742) (-2940.295) [-2940.484] (-2940.102) -- 0:02:23
      21000 -- [-2945.321] (-2946.575) (-2939.870) (-2936.204) * (-2943.125) (-2942.043) [-2936.600] (-2941.416) -- 0:02:19
      21500 -- (-2940.796) [-2943.055] (-2937.486) (-2937.290) * (-2938.835) (-2938.404) (-2937.823) [-2935.344] -- 0:02:16
      22000 -- [-2940.724] (-2942.506) (-2936.876) (-2940.048) * (-2933.771) (-2945.387) (-2938.468) [-2941.259] -- 0:02:13
      22500 -- [-2942.729] (-2936.710) (-2940.616) (-2938.094) * [-2934.326] (-2943.434) (-2949.126) (-2941.885) -- 0:02:10
      23000 -- (-2938.353) [-2939.595] (-2949.200) (-2939.516) * (-2937.624) (-2938.054) [-2937.548] (-2944.257) -- 0:02:07
      23500 -- (-2939.922) (-2940.157) [-2942.730] (-2948.014) * (-2941.331) [-2937.012] (-2939.414) (-2934.629) -- 0:02:04
      24000 -- (-2936.332) (-2936.654) (-2938.484) [-2937.542] * [-2941.028] (-2938.555) (-2942.787) (-2934.163) -- 0:02:02
      24500 -- (-2938.785) (-2943.968) (-2942.854) [-2936.597] * (-2938.786) (-2939.821) [-2942.135] (-2943.794) -- 0:01:59
      25000 -- (-2940.129) [-2939.350] (-2947.115) (-2939.606) * (-2936.807) (-2938.798) [-2937.131] (-2936.094) -- 0:01:57

      Average standard deviation of split frequencies: 0.018131

      25500 -- (-2939.898) [-2942.814] (-2942.065) (-2938.983) * (-2945.357) (-2943.997) [-2931.985] (-2940.652) -- 0:01:54
      26000 -- (-2937.074) (-2944.301) (-2946.669) [-2937.357] * (-2938.901) (-2940.684) [-2940.521] (-2937.681) -- 0:02:29
      26500 -- (-2936.774) (-2939.065) [-2946.631] (-2936.233) * [-2936.108] (-2947.487) (-2940.101) (-2938.223) -- 0:02:26
      27000 -- (-2947.872) (-2939.129) [-2942.774] (-2935.204) * (-2940.934) [-2948.453] (-2940.827) (-2940.908) -- 0:02:24
      27500 -- (-2943.091) [-2939.211] (-2935.540) (-2939.595) * (-2936.499) (-2940.258) (-2937.250) [-2944.013] -- 0:02:21
      28000 -- (-2942.815) [-2941.313] (-2938.354) (-2942.878) * [-2940.501] (-2943.904) (-2938.261) (-2937.963) -- 0:02:18
      28500 -- [-2938.545] (-2944.118) (-2941.372) (-2937.197) * (-2941.572) (-2941.984) (-2942.011) [-2940.329] -- 0:02:16
      29000 -- [-2935.522] (-2939.471) (-2943.879) (-2940.770) * (-2937.771) (-2941.895) (-2945.016) [-2939.416] -- 0:02:13
      29500 -- [-2934.781] (-2942.342) (-2947.609) (-2940.245) * (-2935.452) [-2941.558] (-2956.831) (-2939.965) -- 0:02:11
      30000 -- [-2939.783] (-2945.978) (-2939.360) (-2935.844) * (-2940.313) [-2935.320] (-2942.884) (-2943.448) -- 0:02:09

      Average standard deviation of split frequencies: 0.015372

      30500 -- (-2943.857) (-2944.438) [-2940.175] (-2938.727) * (-2940.318) (-2939.898) [-2941.771] (-2945.593) -- 0:02:07
      31000 -- (-2941.636) (-2939.161) (-2943.144) [-2939.081] * [-2944.322] (-2942.417) (-2935.763) (-2940.927) -- 0:02:05
      31500 -- (-2940.434) (-2938.849) (-2946.588) [-2933.910] * (-2936.638) (-2939.591) (-2934.363) [-2937.821] -- 0:02:02
      32000 -- [-2942.523] (-2941.906) (-2944.880) (-2939.817) * (-2943.117) [-2944.546] (-2945.128) (-2951.985) -- 0:02:01
      32500 -- [-2941.000] (-2937.738) (-2944.059) (-2936.490) * (-2941.047) (-2939.621) (-2940.225) [-2937.008] -- 0:02:28
      33000 -- (-2939.068) (-2939.772) (-2944.336) [-2935.685] * (-2934.351) (-2942.196) [-2938.834] (-2942.008) -- 0:02:26
      33500 -- (-2939.938) (-2936.572) (-2939.365) [-2936.320] * (-2939.017) [-2938.341] (-2947.309) (-2944.707) -- 0:02:24
      34000 -- (-2936.832) (-2941.119) (-2938.033) [-2937.488] * (-2934.865) (-2935.608) (-2938.556) [-2943.884] -- 0:02:22
      34500 -- [-2937.225] (-2941.121) (-2947.557) (-2934.759) * (-2941.222) (-2939.093) (-2937.219) [-2939.351] -- 0:02:19
      35000 -- [-2943.406] (-2941.854) (-2943.244) (-2944.108) * (-2941.112) [-2939.867] (-2946.254) (-2936.285) -- 0:02:17

      Average standard deviation of split frequencies: 0.026189

      35500 -- (-2943.889) [-2938.674] (-2938.158) (-2940.508) * (-2937.218) (-2935.346) [-2947.140] (-2943.545) -- 0:02:15
      36000 -- (-2945.231) (-2938.308) (-2942.513) [-2945.728] * (-2940.645) (-2939.679) (-2941.960) [-2939.056] -- 0:02:13
      36500 -- (-2950.798) (-2942.570) [-2944.576] (-2943.648) * (-2945.899) [-2938.087] (-2942.564) (-2942.558) -- 0:02:11
      37000 -- (-2937.250) [-2940.628] (-2941.206) (-2938.451) * [-2941.999] (-2940.136) (-2944.331) (-2940.838) -- 0:02:10
      37500 -- (-2941.005) [-2940.064] (-2937.125) (-2944.017) * (-2943.077) (-2942.195) [-2937.816] (-2946.555) -- 0:02:08
      38000 -- [-2943.780] (-2942.090) (-2944.787) (-2936.374) * (-2942.507) [-2936.590] (-2949.319) (-2941.408) -- 0:02:06
      38500 -- (-2940.629) (-2940.362) [-2936.381] (-2942.106) * (-2939.974) [-2939.836] (-2941.966) (-2945.976) -- 0:02:04
      39000 -- (-2940.578) (-2941.126) [-2939.415] (-2937.975) * (-2949.423) (-2940.841) [-2942.964] (-2936.614) -- 0:02:27
      39500 -- (-2936.588) [-2934.586] (-2942.816) (-2943.461) * (-2939.515) [-2933.664] (-2940.106) (-2934.865) -- 0:02:25
      40000 -- [-2937.918] (-2936.484) (-2939.953) (-2940.680) * (-2949.192) (-2940.611) (-2941.606) [-2942.905] -- 0:02:24

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-2938.560) [-2936.039] (-2939.621) (-2938.058) * (-2941.542) [-2936.552] (-2941.953) (-2943.433) -- 0:02:22
      41000 -- [-2941.668] (-2940.605) (-2940.173) (-2938.424) * (-2938.727) (-2940.459) (-2942.098) [-2942.517] -- 0:02:20
      41500 -- (-2939.868) [-2940.326] (-2947.030) (-2938.978) * (-2941.095) (-2945.858) (-2938.301) [-2943.048] -- 0:02:18
      42000 -- (-2939.513) (-2949.064) [-2938.443] (-2939.248) * (-2935.249) (-2944.548) (-2946.247) [-2938.398] -- 0:02:16
      42500 -- (-2937.459) (-2939.110) (-2937.234) [-2935.127] * (-2941.170) [-2935.076] (-2946.983) (-2936.088) -- 0:02:15
      43000 -- [-2948.202] (-2935.650) (-2944.488) (-2932.130) * (-2934.670) (-2940.024) [-2944.824] (-2950.672) -- 0:02:13
      43500 -- (-2936.909) (-2937.037) [-2937.773] (-2938.982) * (-2945.386) (-2943.547) (-2937.847) [-2942.605] -- 0:02:11
      44000 -- (-2940.966) (-2937.742) [-2941.854] (-2937.563) * (-2939.269) [-2940.809] (-2938.771) (-2940.548) -- 0:02:10
      44500 -- (-2937.885) [-2936.871] (-2943.283) (-2939.172) * [-2936.920] (-2937.976) (-2939.730) (-2936.300) -- 0:02:08
      45000 -- (-2941.715) (-2947.586) [-2935.821] (-2936.644) * (-2944.059) [-2938.295] (-2941.649) (-2940.422) -- 0:02:07

      Average standard deviation of split frequencies: 0.020496

      45500 -- [-2940.496] (-2941.122) (-2939.656) (-2935.650) * (-2945.112) (-2944.866) (-2941.974) [-2938.318] -- 0:02:26
      46000 -- [-2944.076] (-2944.470) (-2941.440) (-2937.005) * (-2944.961) [-2943.635] (-2939.616) (-2939.887) -- 0:02:25
      46500 -- (-2944.548) (-2938.344) (-2936.303) [-2935.313] * (-2941.208) (-2943.231) [-2941.349] (-2949.125) -- 0:02:23
      47000 -- (-2944.518) [-2937.527] (-2942.713) (-2937.017) * (-2937.912) [-2938.718] (-2940.062) (-2943.068) -- 0:02:21
      47500 -- (-2942.637) (-2940.430) (-2940.735) [-2938.723] * (-2939.570) (-2942.714) (-2936.325) [-2937.480] -- 0:02:20
      48000 -- (-2938.722) [-2936.192] (-2937.697) (-2939.508) * (-2939.875) (-2937.549) [-2937.387] (-2939.897) -- 0:02:18
      48500 -- (-2942.872) (-2937.206) [-2945.792] (-2936.376) * (-2951.971) (-2937.721) [-2946.844] (-2937.330) -- 0:02:17
      49000 -- (-2937.456) (-2936.296) (-2943.087) [-2934.722] * (-2945.463) (-2936.809) (-2941.332) [-2940.472] -- 0:02:15
      49500 -- (-2946.762) [-2949.637] (-2953.103) (-2939.391) * (-2949.191) (-2943.414) (-2953.945) [-2938.349] -- 0:02:14
      50000 -- [-2937.364] (-2939.259) (-2941.496) (-2944.561) * (-2953.643) (-2934.826) (-2943.241) [-2940.577] -- 0:02:13

      Average standard deviation of split frequencies: 0.018608

      50500 -- (-2941.993) (-2938.116) (-2938.460) [-2937.948] * (-2946.233) (-2938.282) [-2938.283] (-2939.760) -- 0:02:11
      51000 -- [-2938.243] (-2938.834) (-2942.363) (-2936.764) * (-2941.065) (-2946.453) (-2940.608) [-2939.368] -- 0:02:10
      51500 -- (-2941.449) [-2937.913] (-2940.066) (-2937.518) * (-2939.016) (-2937.345) [-2935.355] (-2938.627) -- 0:02:08
      52000 -- [-2940.397] (-2937.317) (-2942.648) (-2937.358) * (-2946.667) (-2946.199) (-2939.610) [-2934.816] -- 0:02:25
      52500 -- (-2948.533) (-2938.324) [-2940.333] (-2939.661) * (-2938.372) [-2941.689] (-2943.938) (-2941.589) -- 0:02:24
      53000 -- (-2943.129) (-2944.902) (-2936.770) [-2943.008] * (-2945.060) (-2939.306) [-2947.255] (-2943.302) -- 0:02:22
      53500 -- (-2941.830) (-2942.483) [-2939.369] (-2939.954) * (-2943.240) (-2939.296) [-2936.596] (-2947.402) -- 0:02:21
      54000 -- [-2948.362] (-2951.880) (-2938.894) (-2934.314) * (-2942.685) (-2938.923) [-2937.061] (-2943.540) -- 0:02:20
      54500 -- (-2942.064) (-2939.596) (-2956.166) [-2936.855] * (-2939.959) (-2943.554) (-2942.966) [-2938.934] -- 0:02:18
      55000 -- (-2945.382) [-2942.322] (-2952.222) (-2935.436) * (-2945.549) (-2937.672) (-2941.192) [-2936.065] -- 0:02:17

      Average standard deviation of split frequencies: 0.016836

      55500 -- (-2950.866) (-2944.670) [-2938.149] (-2934.900) * (-2939.280) (-2935.691) (-2940.165) [-2936.928] -- 0:02:16
      56000 -- [-2940.097] (-2940.474) (-2939.088) (-2942.009) * (-2935.673) (-2937.955) [-2938.954] (-2941.295) -- 0:02:14
      56500 -- [-2950.174] (-2942.571) (-2943.285) (-2933.687) * (-2937.931) (-2937.537) [-2941.661] (-2939.781) -- 0:02:13
      57000 -- (-2942.740) (-2942.477) (-2941.446) [-2942.074] * (-2940.493) (-2933.589) (-2938.661) [-2937.856] -- 0:02:12
      57500 -- (-2951.485) [-2944.470] (-2943.863) (-2940.060) * (-2935.136) (-2937.369) (-2940.426) [-2947.788] -- 0:02:11
      58000 -- (-2942.371) (-2938.164) [-2939.988] (-2939.403) * (-2941.755) (-2933.626) (-2935.566) [-2943.686] -- 0:02:09
      58500 -- [-2944.343] (-2943.617) (-2942.709) (-2936.669) * (-2939.936) [-2934.948] (-2937.449) (-2940.223) -- 0:02:08
      59000 -- (-2940.667) (-2947.651) (-2937.738) [-2943.300] * (-2940.208) (-2936.651) (-2946.510) [-2939.629] -- 0:02:23
      59500 -- (-2942.440) (-2942.959) (-2941.100) [-2935.816] * (-2937.811) [-2943.600] (-2935.171) (-2938.846) -- 0:02:22
      60000 -- (-2946.971) (-2947.867) (-2931.197) [-2937.002] * (-2939.520) (-2943.357) (-2938.369) [-2936.974] -- 0:02:21

      Average standard deviation of split frequencies: 0.007770

      60500 -- (-2939.792) [-2940.299] (-2936.357) (-2937.366) * (-2940.186) (-2939.152) [-2941.190] (-2942.242) -- 0:02:19
      61000 -- (-2942.713) (-2940.502) [-2936.623] (-2933.559) * (-2940.646) (-2941.444) [-2939.056] (-2939.756) -- 0:02:18
      61500 -- (-2935.588) (-2939.492) [-2937.343] (-2941.846) * (-2939.529) (-2941.321) (-2935.874) [-2946.746] -- 0:02:17
      62000 -- (-2951.164) (-2940.847) [-2936.151] (-2935.581) * (-2935.665) [-2944.621] (-2933.603) (-2948.197) -- 0:02:16
      62500 -- (-2941.019) (-2947.005) [-2937.669] (-2938.560) * [-2934.766] (-2948.065) (-2938.656) (-2943.922) -- 0:02:15
      63000 -- (-2942.512) (-2942.145) (-2940.846) [-2943.668] * (-2939.012) (-2947.596) (-2945.031) [-2943.693] -- 0:02:13
      63500 -- [-2937.477] (-2938.751) (-2937.099) (-2944.960) * (-2942.263) (-2954.987) [-2935.455] (-2936.444) -- 0:02:12
      64000 -- (-2939.522) [-2936.960] (-2938.710) (-2935.417) * (-2936.258) [-2946.588] (-2934.815) (-2936.747) -- 0:02:11
      64500 -- (-2933.456) [-2938.662] (-2943.960) (-2936.159) * (-2945.053) [-2941.592] (-2938.791) (-2941.439) -- 0:02:10
      65000 -- (-2933.388) (-2942.364) (-2939.087) [-2938.330] * (-2938.488) (-2954.307) (-2936.542) [-2943.126] -- 0:02:09

      Average standard deviation of split frequencies: 0.007142

      65500 -- (-2939.010) (-2936.059) (-2940.594) [-2939.885] * [-2936.606] (-2944.842) (-2935.757) (-2937.494) -- 0:02:22
      66000 -- (-2934.854) [-2939.227] (-2936.274) (-2936.236) * [-2936.573] (-2939.653) (-2945.129) (-2934.874) -- 0:02:21
      66500 -- (-2942.431) (-2949.046) [-2938.024] (-2937.193) * (-2940.417) [-2946.164] (-2942.081) (-2940.648) -- 0:02:20
      67000 -- (-2937.756) [-2937.989] (-2946.115) (-2939.689) * (-2939.587) (-2939.284) (-2938.917) [-2937.976] -- 0:02:19
      67500 -- (-2944.434) (-2940.641) (-2948.985) [-2941.087] * (-2940.443) (-2932.680) [-2938.617] (-2948.718) -- 0:02:18
      68000 -- (-2932.288) [-2932.949] (-2944.221) (-2939.511) * (-2939.611) (-2939.053) (-2940.235) [-2937.085] -- 0:02:17
      68500 -- (-2939.374) (-2946.786) [-2940.053] (-2942.984) * (-2940.283) (-2941.655) (-2936.643) [-2940.595] -- 0:02:15
      69000 -- (-2932.892) (-2947.441) [-2940.389] (-2937.302) * (-2938.006) [-2936.885] (-2939.855) (-2943.240) -- 0:02:14
      69500 -- [-2941.939] (-2939.590) (-2940.354) (-2946.329) * [-2937.530] (-2940.103) (-2942.112) (-2942.091) -- 0:02:13
      70000 -- (-2945.079) (-2943.059) [-2934.872] (-2939.974) * (-2941.692) [-2940.919] (-2940.619) (-2940.660) -- 0:02:12

      Average standard deviation of split frequencies: 0.006671

      70500 -- [-2938.835] (-2940.325) (-2941.138) (-2942.926) * (-2943.597) (-2940.293) (-2940.536) [-2939.317] -- 0:02:11
      71000 -- (-2947.510) (-2947.111) (-2941.668) [-2940.459] * (-2937.032) (-2939.275) [-2944.878] (-2940.367) -- 0:02:10
      71500 -- [-2940.783] (-2944.641) (-2948.863) (-2939.249) * (-2940.416) (-2934.796) (-2940.938) [-2937.438] -- 0:02:09
      72000 -- (-2938.302) [-2935.310] (-2935.408) (-2941.929) * (-2937.704) (-2940.942) [-2936.408] (-2933.975) -- 0:02:21
      72500 -- (-2942.187) [-2940.029] (-2942.285) (-2943.910) * [-2943.340] (-2936.247) (-2937.659) (-2942.651) -- 0:02:20
      73000 -- (-2938.348) [-2938.651] (-2934.400) (-2936.443) * (-2943.336) (-2935.956) (-2936.538) [-2934.379] -- 0:02:19
      73500 -- [-2937.038] (-2942.780) (-2941.782) (-2936.479) * (-2947.412) (-2939.232) [-2935.689] (-2941.006) -- 0:02:18
      74000 -- (-2936.038) (-2944.571) (-2937.499) [-2935.269] * (-2939.186) (-2940.798) [-2936.406] (-2940.725) -- 0:02:17
      74500 -- (-2942.221) [-2941.181] (-2946.361) (-2934.653) * (-2937.279) (-2943.629) [-2943.730] (-2943.729) -- 0:02:16
      75000 -- (-2944.876) (-2939.408) (-2939.865) [-2941.990] * (-2939.863) [-2949.265] (-2944.657) (-2944.890) -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-2940.307) (-2942.122) [-2940.830] (-2941.946) * [-2941.201] (-2944.691) (-2942.622) (-2948.408) -- 0:02:14
      76000 -- [-2935.684] (-2934.698) (-2940.728) (-2944.032) * (-2936.966) [-2948.039] (-2941.566) (-2942.880) -- 0:02:13
      76500 -- (-2939.713) (-2941.740) [-2942.715] (-2948.560) * (-2937.508) [-2940.399] (-2942.281) (-2943.117) -- 0:02:12
      77000 -- [-2935.607] (-2940.019) (-2934.001) (-2938.804) * [-2939.263] (-2940.066) (-2938.945) (-2938.323) -- 0:02:11
      77500 -- (-2939.246) (-2941.097) [-2939.837] (-2942.167) * (-2940.235) [-2941.299] (-2944.686) (-2936.718) -- 0:02:10
      78000 -- (-2940.713) (-2941.459) [-2940.753] (-2937.417) * (-2939.055) (-2936.345) (-2945.213) [-2941.270] -- 0:02:10
      78500 -- (-2949.408) [-2937.987] (-2949.730) (-2942.065) * (-2949.960) (-2940.123) (-2935.998) [-2939.439] -- 0:02:20
      79000 -- (-2943.871) [-2939.703] (-2940.758) (-2934.765) * (-2935.985) [-2937.977] (-2944.823) (-2938.826) -- 0:02:19
      79500 -- (-2943.897) (-2937.438) (-2941.369) [-2937.866] * (-2941.109) (-2947.977) [-2939.301] (-2939.687) -- 0:02:18
      80000 -- (-2941.113) (-2939.309) (-2952.837) [-2945.228] * (-2943.680) [-2936.732] (-2939.103) (-2945.469) -- 0:02:18

      Average standard deviation of split frequencies: 0.011688

      80500 -- (-2938.025) [-2942.883] (-2946.828) (-2941.530) * (-2940.823) (-2937.567) (-2935.978) [-2938.176] -- 0:02:17
      81000 -- (-2941.797) (-2939.121) (-2944.349) [-2948.540] * (-2940.537) (-2937.360) [-2946.344] (-2947.197) -- 0:02:16
      81500 -- (-2937.893) (-2937.650) (-2937.580) [-2941.091] * (-2942.347) (-2942.414) [-2947.690] (-2938.909) -- 0:02:15
      82000 -- (-2933.993) (-2938.433) (-2937.171) [-2939.376] * [-2940.800] (-2941.013) (-2950.400) (-2938.825) -- 0:02:14
      82500 -- (-2934.788) (-2940.330) [-2939.225] (-2948.794) * (-2935.992) [-2937.385] (-2945.072) (-2945.840) -- 0:02:13
      83000 -- (-2941.245) (-2937.077) (-2944.374) [-2939.973] * (-2941.191) (-2944.736) (-2940.341) [-2942.398] -- 0:02:12
      83500 -- (-2941.645) (-2939.893) [-2938.499] (-2938.967) * (-2941.676) (-2939.520) [-2939.397] (-2936.812) -- 0:02:11
      84000 -- (-2944.043) [-2935.883] (-2941.857) (-2942.793) * (-2937.553) [-2936.831] (-2943.407) (-2941.040) -- 0:02:10
      84500 -- (-2944.307) (-2938.886) [-2937.240] (-2937.857) * [-2938.958] (-2936.428) (-2939.832) (-2937.754) -- 0:02:10
      85000 -- (-2943.861) (-2938.806) (-2935.018) [-2936.812] * (-2939.499) (-2936.145) [-2938.031] (-2944.029) -- 0:02:19

      Average standard deviation of split frequencies: 0.016444

      85500 -- (-2942.208) (-2943.248) (-2935.412) [-2937.298] * (-2940.397) (-2945.619) [-2936.730] (-2939.474) -- 0:02:19
      86000 -- [-2938.094] (-2944.830) (-2934.594) (-2939.179) * [-2940.910] (-2937.987) (-2937.859) (-2939.487) -- 0:02:18
      86500 -- (-2941.709) (-2943.398) (-2948.500) [-2944.960] * [-2941.910] (-2939.437) (-2939.119) (-2938.490) -- 0:02:17
      87000 -- (-2941.680) (-2941.349) (-2941.137) [-2939.506] * (-2944.400) (-2936.710) [-2940.785] (-2938.948) -- 0:02:16
      87500 -- (-2944.491) [-2943.018] (-2948.817) (-2938.624) * (-2940.752) (-2938.278) [-2942.180] (-2941.823) -- 0:02:15
      88000 -- (-2943.893) [-2941.619] (-2944.321) (-2934.733) * [-2942.477] (-2946.441) (-2940.823) (-2936.867) -- 0:02:14
      88500 -- (-2942.428) (-2943.685) (-2946.126) [-2939.693] * (-2940.923) (-2944.243) (-2942.007) [-2942.752] -- 0:02:13
      89000 -- (-2945.089) [-2940.332] (-2944.754) (-2938.721) * [-2937.509] (-2944.179) (-2939.581) (-2939.959) -- 0:02:13
      89500 -- [-2941.478] (-2940.028) (-2939.724) (-2936.566) * (-2936.694) (-2948.048) [-2937.884] (-2940.353) -- 0:02:12
      90000 -- (-2948.393) (-2931.753) [-2941.835] (-2940.319) * [-2937.161] (-2939.466) (-2936.741) (-2938.822) -- 0:02:11

      Average standard deviation of split frequencies: 0.005199

      90500 -- (-2941.996) [-2938.922] (-2941.255) (-2938.707) * (-2940.732) (-2945.136) (-2941.487) [-2940.281] -- 0:02:10
      91000 -- (-2942.891) (-2935.276) (-2933.698) [-2936.725] * (-2939.558) (-2943.733) (-2947.775) [-2932.679] -- 0:02:09
      91500 -- (-2937.676) (-2944.979) [-2938.477] (-2942.511) * (-2940.805) (-2938.285) [-2943.064] (-2940.175) -- 0:02:19
      92000 -- (-2936.398) (-2945.104) [-2936.094] (-2941.544) * (-2939.295) (-2938.565) (-2939.126) [-2938.306] -- 0:02:18
      92500 -- (-2940.041) (-2938.686) [-2941.838] (-2947.226) * (-2947.493) [-2939.979] (-2935.183) (-2938.494) -- 0:02:17
      93000 -- [-2937.174] (-2940.611) (-2944.400) (-2939.992) * [-2934.477] (-2936.875) (-2944.127) (-2935.054) -- 0:02:16
      93500 -- (-2946.353) (-2941.910) (-2941.060) [-2939.242] * (-2940.970) (-2935.689) [-2947.254] (-2939.801) -- 0:02:15
      94000 -- [-2940.634] (-2939.286) (-2936.817) (-2942.799) * [-2939.300] (-2941.351) (-2935.673) (-2942.662) -- 0:02:14
      94500 -- (-2938.203) (-2936.845) [-2938.131] (-2943.882) * (-2940.787) (-2949.947) (-2937.250) [-2944.953] -- 0:02:14
      95000 -- (-2937.974) [-2937.418] (-2936.998) (-2943.805) * [-2939.228] (-2941.986) (-2935.148) (-2940.956) -- 0:02:13

      Average standard deviation of split frequencies: 0.004910

      95500 -- [-2939.772] (-2937.582) (-2940.876) (-2936.167) * (-2938.831) (-2937.268) [-2939.140] (-2944.177) -- 0:02:12
      96000 -- (-2933.125) [-2940.614] (-2948.460) (-2937.319) * (-2935.506) [-2937.056] (-2938.885) (-2943.513) -- 0:02:11
      96500 -- [-2935.956] (-2936.574) (-2947.233) (-2945.077) * [-2934.376] (-2938.476) (-2941.294) (-2952.259) -- 0:02:11
      97000 -- [-2935.452] (-2940.303) (-2944.783) (-2942.060) * [-2936.971] (-2940.502) (-2940.960) (-2935.285) -- 0:02:10
      97500 -- [-2939.085] (-2938.224) (-2942.129) (-2946.337) * [-2943.146] (-2942.141) (-2947.116) (-2940.649) -- 0:02:09
      98000 -- (-2941.010) (-2937.708) (-2941.448) [-2936.149] * (-2937.755) (-2944.391) [-2938.079] (-2937.752) -- 0:02:18
      98500 -- (-2939.067) (-2938.924) [-2934.906] (-2950.919) * (-2943.568) (-2939.762) (-2936.821) [-2939.557] -- 0:02:17
      99000 -- [-2939.740] (-2937.716) (-2939.440) (-2945.697) * (-2946.636) (-2936.888) [-2935.370] (-2935.269) -- 0:02:16
      99500 -- (-2942.038) [-2938.992] (-2943.497) (-2933.995) * (-2936.589) [-2941.716] (-2948.728) (-2940.557) -- 0:02:15
      100000 -- (-2937.855) [-2937.546] (-2939.411) (-2937.426) * (-2942.983) (-2941.543) [-2944.865] (-2943.013) -- 0:02:15

      Average standard deviation of split frequencies: 0.004683

      100500 -- (-2943.941) (-2938.120) [-2938.010] (-2945.809) * (-2946.560) (-2946.289) (-2948.691) [-2937.338] -- 0:02:14
      101000 -- (-2944.005) (-2946.738) [-2935.910] (-2938.652) * (-2945.624) (-2941.027) (-2940.236) [-2940.074] -- 0:02:13
      101500 -- [-2938.104] (-2947.716) (-2940.142) (-2948.361) * [-2937.323] (-2943.542) (-2941.070) (-2940.364) -- 0:02:12
      102000 -- (-2943.179) [-2943.292] (-2943.573) (-2936.937) * (-2937.090) (-2939.291) [-2940.400] (-2937.373) -- 0:02:12
      102500 -- (-2939.312) (-2939.290) [-2945.279] (-2937.569) * (-2937.977) (-2935.237) [-2944.576] (-2939.142) -- 0:02:11
      103000 -- (-2938.199) [-2943.359] (-2941.851) (-2934.566) * (-2940.942) [-2938.049] (-2942.357) (-2942.908) -- 0:02:10
      103500 -- (-2953.725) (-2939.540) (-2945.633) [-2943.735] * [-2941.666] (-2938.423) (-2941.362) (-2940.473) -- 0:02:09
      104000 -- (-2938.130) (-2943.785) [-2935.134] (-2944.081) * (-2939.761) (-2939.861) (-2948.178) [-2937.824] -- 0:02:09
      104500 -- (-2937.798) (-2934.756) [-2936.578] (-2940.719) * (-2938.195) [-2936.741] (-2946.049) (-2940.163) -- 0:02:17
      105000 -- [-2941.168] (-2945.062) (-2937.400) (-2946.540) * (-2941.143) (-2942.174) [-2941.276] (-2941.310) -- 0:02:16

      Average standard deviation of split frequencies: 0.013342

      105500 -- (-2942.983) [-2939.023] (-2941.645) (-2946.060) * (-2945.613) (-2937.534) [-2939.465] (-2936.373) -- 0:02:15
      106000 -- (-2940.853) (-2937.473) (-2940.498) [-2943.563] * (-2938.524) (-2942.297) [-2939.783] (-2936.734) -- 0:02:14
      106500 -- [-2937.841] (-2940.049) (-2938.743) (-2940.111) * (-2939.321) [-2940.343] (-2940.439) (-2936.701) -- 0:02:14
      107000 -- (-2939.157) (-2942.806) (-2942.605) [-2933.811] * (-2936.621) [-2937.355] (-2947.708) (-2944.262) -- 0:02:13
      107500 -- (-2945.421) (-2940.786) (-2942.167) [-2936.093] * (-2939.215) (-2935.944) (-2937.911) [-2936.330] -- 0:02:12
      108000 -- (-2941.876) [-2942.753] (-2942.678) (-2937.429) * (-2943.270) [-2935.559] (-2943.109) (-2938.339) -- 0:02:12
      108500 -- (-2933.934) (-2941.655) (-2938.344) [-2933.858] * [-2939.975] (-2942.328) (-2939.614) (-2940.879) -- 0:02:11
      109000 -- (-2942.775) [-2939.662] (-2946.205) (-2938.360) * [-2941.669] (-2938.087) (-2942.705) (-2941.000) -- 0:02:10
      109500 -- (-2937.077) (-2941.050) (-2942.621) [-2940.671] * (-2937.333) [-2936.154] (-2938.033) (-2944.334) -- 0:02:10
      110000 -- (-2953.465) (-2943.321) (-2944.058) [-2942.013] * [-2937.543] (-2935.635) (-2941.614) (-2938.528) -- 0:02:09

      Average standard deviation of split frequencies: 0.012779

      110500 -- [-2944.574] (-2940.726) (-2943.913) (-2945.910) * [-2944.353] (-2942.214) (-2940.991) (-2934.421) -- 0:02:08
      111000 -- (-2941.757) (-2942.732) (-2942.651) [-2942.428] * (-2943.026) (-2936.780) [-2941.034] (-2942.968) -- 0:02:16
      111500 -- (-2938.926) [-2940.303] (-2941.915) (-2937.771) * (-2934.876) [-2937.292] (-2936.210) (-2940.539) -- 0:02:15
      112000 -- [-2941.635] (-2940.116) (-2935.318) (-2940.952) * (-2942.988) (-2935.371) (-2936.659) [-2939.384] -- 0:02:14
      112500 -- (-2936.619) (-2940.912) (-2937.833) [-2936.038] * (-2939.560) [-2938.483] (-2937.704) (-2937.269) -- 0:02:14
      113000 -- (-2939.011) [-2940.298] (-2945.484) (-2942.241) * (-2942.332) (-2943.222) [-2947.495] (-2942.689) -- 0:02:13
      113500 -- (-2942.736) [-2941.762] (-2942.618) (-2944.098) * (-2946.156) (-2943.734) [-2939.541] (-2950.181) -- 0:02:12
      114000 -- (-2947.344) [-2940.822] (-2940.174) (-2942.381) * (-2940.667) [-2935.944] (-2936.675) (-2950.800) -- 0:02:12
      114500 -- (-2942.928) (-2943.176) [-2936.319] (-2935.710) * (-2937.530) [-2937.399] (-2937.536) (-2941.167) -- 0:02:11
      115000 -- (-2936.733) [-2939.267] (-2941.091) (-2937.275) * [-2943.086] (-2938.008) (-2936.545) (-2939.657) -- 0:02:10

      Average standard deviation of split frequencies: 0.020319

      115500 -- (-2936.748) (-2946.308) [-2944.278] (-2934.445) * [-2945.027] (-2939.818) (-2939.055) (-2941.648) -- 0:02:10
      116000 -- (-2945.728) [-2940.455] (-2938.171) (-2936.932) * (-2943.163) [-2935.480] (-2940.288) (-2946.588) -- 0:02:09
      116500 -- (-2941.025) (-2939.606) [-2940.026] (-2939.361) * (-2939.455) (-2941.230) [-2939.595] (-2939.687) -- 0:02:08
      117000 -- [-2939.141] (-2937.479) (-2936.090) (-2943.480) * (-2943.006) (-2935.804) (-2939.025) [-2947.950] -- 0:02:08
      117500 -- [-2939.995] (-2938.967) (-2939.003) (-2938.407) * [-2937.598] (-2937.565) (-2939.152) (-2946.383) -- 0:02:15
      118000 -- (-2941.301) (-2946.535) (-2940.573) [-2942.317] * [-2941.137] (-2946.162) (-2938.142) (-2941.585) -- 0:02:14
      118500 -- [-2936.548] (-2937.038) (-2936.643) (-2938.958) * (-2937.783) (-2948.418) (-2940.897) [-2938.160] -- 0:02:13
      119000 -- (-2942.361) [-2935.707] (-2943.593) (-2938.217) * (-2943.461) (-2943.317) (-2942.128) [-2936.035] -- 0:02:13
      119500 -- (-2945.818) [-2938.452] (-2938.450) (-2939.263) * (-2944.690) [-2943.276] (-2942.532) (-2937.217) -- 0:02:12
      120000 -- (-2942.027) [-2936.772] (-2947.857) (-2943.335) * [-2938.916] (-2939.751) (-2935.390) (-2940.803) -- 0:02:12

      Average standard deviation of split frequencies: 0.015627

      120500 -- (-2936.294) [-2940.336] (-2942.625) (-2940.603) * (-2944.576) (-2942.277) [-2941.034] (-2938.127) -- 0:02:11
      121000 -- [-2942.409] (-2937.610) (-2943.319) (-2937.397) * (-2945.542) [-2938.374] (-2939.670) (-2942.196) -- 0:02:10
      121500 -- [-2940.468] (-2936.348) (-2939.949) (-2935.794) * (-2939.571) [-2940.209] (-2943.087) (-2944.749) -- 0:02:10
      122000 -- (-2943.179) (-2936.884) (-2941.877) [-2940.547] * (-2946.237) (-2936.371) [-2942.833] (-2942.366) -- 0:02:09
      122500 -- (-2939.859) (-2937.905) (-2946.420) [-2940.141] * [-2937.974] (-2936.750) (-2934.210) (-2935.219) -- 0:02:08
      123000 -- [-2935.908] (-2936.781) (-2937.533) (-2936.333) * (-2938.626) (-2935.062) [-2940.877] (-2947.319) -- 0:02:08
      123500 -- [-2942.309] (-2938.450) (-2936.014) (-2938.298) * (-2936.569) (-2944.184) (-2940.099) [-2942.597] -- 0:02:07
      124000 -- (-2936.078) (-2940.553) (-2944.395) [-2934.344] * (-2937.760) [-2937.618] (-2943.192) (-2940.435) -- 0:02:14
      124500 -- (-2944.942) (-2949.690) (-2947.938) [-2937.360] * [-2942.618] (-2938.892) (-2940.571) (-2935.622) -- 0:02:13
      125000 -- (-2946.149) [-2939.901] (-2941.974) (-2946.227) * [-2936.995] (-2943.758) (-2937.015) (-2941.026) -- 0:02:13

      Average standard deviation of split frequencies: 0.011224

      125500 -- (-2950.691) [-2942.871] (-2934.629) (-2946.462) * (-2941.691) [-2936.996] (-2944.999) (-2946.178) -- 0:02:12
      126000 -- [-2944.689] (-2939.629) (-2936.083) (-2950.101) * (-2939.128) [-2940.603] (-2937.750) (-2938.391) -- 0:02:11
      126500 -- (-2935.792) (-2938.616) (-2941.714) [-2939.273] * [-2937.450] (-2934.915) (-2939.337) (-2938.598) -- 0:02:11
      127000 -- [-2933.838] (-2940.786) (-2935.977) (-2937.978) * (-2941.028) (-2943.043) (-2942.010) [-2945.078] -- 0:02:10
      127500 -- (-2937.386) (-2944.999) [-2941.768] (-2939.700) * (-2942.514) (-2942.126) [-2934.116] (-2941.591) -- 0:02:10
      128000 -- (-2944.952) (-2937.281) [-2943.233] (-2937.252) * (-2940.908) (-2935.489) [-2950.101] (-2940.831) -- 0:02:09
      128500 -- (-2945.294) (-2938.874) [-2944.745] (-2946.190) * (-2940.156) (-2942.809) (-2943.673) [-2940.957] -- 0:02:08
      129000 -- (-2940.727) (-2933.560) [-2938.301] (-2941.882) * (-2940.666) [-2944.701] (-2941.710) (-2942.552) -- 0:02:08
      129500 -- [-2936.627] (-2938.747) (-2940.203) (-2940.165) * (-2939.262) (-2943.032) [-2935.344] (-2938.741) -- 0:02:07
      130000 -- [-2934.058] (-2950.897) (-2938.906) (-2937.816) * [-2939.419] (-2945.339) (-2939.910) (-2936.725) -- 0:02:07

      Average standard deviation of split frequencies: 0.010823

      130500 -- [-2934.727] (-2938.801) (-2939.723) (-2939.409) * (-2938.182) [-2945.001] (-2941.969) (-2941.463) -- 0:02:06
      131000 -- (-2936.341) (-2936.128) [-2936.688] (-2933.604) * (-2938.673) (-2942.501) [-2941.002] (-2937.736) -- 0:02:12
      131500 -- (-2942.108) (-2943.877) [-2936.742] (-2941.319) * (-2937.674) (-2943.279) (-2945.262) [-2939.675] -- 0:02:12
      132000 -- (-2936.256) (-2937.541) [-2935.329] (-2942.189) * [-2943.070] (-2935.879) (-2944.082) (-2941.915) -- 0:02:11
      132500 -- [-2936.957] (-2942.020) (-2940.446) (-2939.244) * (-2942.980) (-2940.346) (-2939.633) [-2937.929] -- 0:02:10
      133000 -- (-2943.527) (-2935.950) [-2935.931] (-2940.388) * [-2932.502] (-2939.603) (-2938.818) (-2937.430) -- 0:02:10
      133500 -- (-2940.426) (-2939.842) (-2933.646) [-2935.894] * (-2935.586) (-2939.052) [-2942.852] (-2939.445) -- 0:02:09
      134000 -- (-2937.393) (-2938.248) (-2934.124) [-2936.644] * (-2939.023) (-2935.760) [-2941.330] (-2943.306) -- 0:02:09
      134500 -- (-2937.056) (-2941.271) [-2938.636] (-2939.166) * [-2938.972] (-2935.821) (-2936.444) (-2943.397) -- 0:02:08
      135000 -- (-2941.083) (-2946.882) (-2943.603) [-2935.722] * [-2933.878] (-2941.562) (-2942.369) (-2939.966) -- 0:02:08

      Average standard deviation of split frequencies: 0.010399

      135500 -- (-2938.539) (-2941.185) [-2939.916] (-2939.974) * [-2939.341] (-2938.857) (-2943.514) (-2943.297) -- 0:02:07
      136000 -- (-2935.983) [-2936.484] (-2938.245) (-2936.641) * (-2938.204) (-2943.189) (-2944.389) [-2942.074] -- 0:02:07
      136500 -- (-2938.520) (-2941.459) [-2945.730] (-2935.144) * (-2938.038) (-2944.544) [-2939.373] (-2943.280) -- 0:02:06
      137000 -- [-2942.107] (-2939.201) (-2943.333) (-2935.683) * (-2940.388) (-2937.207) [-2933.276] (-2942.178) -- 0:02:05
      137500 -- (-2941.432) (-2936.707) (-2942.936) [-2939.897] * (-2944.802) (-2936.647) (-2937.890) [-2941.150] -- 0:02:11
      138000 -- (-2936.599) (-2940.989) (-2938.927) [-2943.784] * [-2938.674] (-2938.956) (-2940.273) (-2940.087) -- 0:02:11
      138500 -- (-2938.144) (-2944.863) [-2936.433] (-2936.418) * (-2939.998) (-2939.813) (-2936.452) [-2943.604] -- 0:02:10
      139000 -- (-2940.846) (-2940.855) (-2945.031) [-2937.845] * (-2938.884) (-2944.235) (-2943.710) [-2941.579] -- 0:02:10
      139500 -- (-2937.723) (-2935.370) (-2937.229) [-2943.188] * [-2936.308] (-2939.570) (-2934.204) (-2936.771) -- 0:02:09
      140000 -- (-2941.476) (-2939.628) [-2944.951] (-2938.308) * [-2945.629] (-2932.520) (-2938.887) (-2937.505) -- 0:02:09

      Average standard deviation of split frequencies: 0.010054

      140500 -- (-2940.951) (-2939.644) [-2936.639] (-2934.245) * (-2944.160) (-2939.329) [-2936.348] (-2938.697) -- 0:02:08
      141000 -- (-2941.417) [-2939.298] (-2940.947) (-2939.762) * [-2932.407] (-2940.424) (-2943.873) (-2941.361) -- 0:02:07
      141500 -- [-2938.087] (-2940.199) (-2942.499) (-2942.198) * (-2937.371) [-2935.141] (-2938.087) (-2943.016) -- 0:02:07
      142000 -- (-2940.157) [-2937.899] (-2936.244) (-2939.207) * [-2934.549] (-2934.659) (-2942.352) (-2947.094) -- 0:02:06
      142500 -- [-2937.131] (-2941.610) (-2937.662) (-2944.780) * [-2932.681] (-2937.216) (-2939.741) (-2937.402) -- 0:02:06
      143000 -- (-2943.042) (-2944.285) [-2938.605] (-2941.288) * (-2935.478) (-2937.663) [-2940.062] (-2939.240) -- 0:02:05
      143500 -- [-2940.314] (-2938.870) (-2939.573) (-2942.015) * (-2937.537) [-2933.280] (-2940.357) (-2941.749) -- 0:02:05
      144000 -- [-2939.544] (-2947.694) (-2936.918) (-2941.448) * (-2934.026) [-2937.906] (-2941.944) (-2936.753) -- 0:02:10
      144500 -- (-2941.516) (-2939.323) [-2933.597] (-2941.918) * (-2943.535) [-2934.209] (-2949.128) (-2934.389) -- 0:02:10
      145000 -- (-2949.603) (-2939.667) (-2936.812) [-2943.575] * (-2940.476) (-2939.884) (-2939.807) [-2936.239] -- 0:02:09

      Average standard deviation of split frequencies: 0.009686

      145500 -- (-2933.576) (-2939.093) [-2941.575] (-2934.568) * (-2943.121) (-2941.449) [-2937.679] (-2941.652) -- 0:02:09
      146000 -- (-2938.137) (-2939.932) [-2949.075] (-2938.624) * (-2936.074) (-2943.433) (-2940.785) [-2935.864] -- 0:02:08
      146500 -- (-2940.640) (-2936.723) [-2937.890] (-2939.837) * (-2943.159) [-2941.526] (-2940.623) (-2946.980) -- 0:02:08
      147000 -- (-2941.711) [-2939.417] (-2944.794) (-2937.690) * (-2942.046) (-2940.559) (-2944.579) [-2939.293] -- 0:02:07
      147500 -- (-2939.529) (-2940.479) (-2940.220) [-2936.884] * [-2937.300] (-2942.219) (-2944.347) (-2939.768) -- 0:02:07
      148000 -- (-2951.566) (-2940.665) [-2937.922] (-2935.693) * [-2943.348] (-2939.212) (-2943.516) (-2939.223) -- 0:02:06
      148500 -- (-2941.227) [-2941.532] (-2944.799) (-2938.980) * [-2941.945] (-2936.539) (-2943.142) (-2944.478) -- 0:02:06
      149000 -- (-2942.063) (-2938.973) (-2950.570) [-2934.956] * (-2948.483) (-2939.496) (-2946.601) [-2941.659] -- 0:02:05
      149500 -- [-2943.049] (-2937.249) (-2941.207) (-2932.418) * (-2940.949) [-2935.874] (-2941.841) (-2941.919) -- 0:02:05
      150000 -- (-2943.268) (-2937.077) [-2942.232] (-2935.033) * (-2945.284) [-2938.022] (-2939.382) (-2940.541) -- 0:02:04

      Average standard deviation of split frequencies: 0.012515

      150500 -- (-2942.546) (-2939.070) [-2943.600] (-2936.167) * [-2939.589] (-2937.109) (-2937.998) (-2943.915) -- 0:02:09
      151000 -- (-2947.873) (-2946.171) [-2938.722] (-2940.377) * (-2943.889) (-2935.049) (-2938.325) [-2937.376] -- 0:02:09
      151500 -- (-2936.863) (-2935.053) (-2947.080) [-2935.528] * [-2944.609] (-2940.423) (-2936.934) (-2941.398) -- 0:02:08
      152000 -- [-2937.757] (-2939.965) (-2939.875) (-2936.637) * [-2933.528] (-2939.598) (-2939.444) (-2943.726) -- 0:02:08
      152500 -- (-2940.857) (-2944.406) (-2947.870) [-2937.831] * [-2938.284] (-2954.313) (-2937.630) (-2943.238) -- 0:02:07
      153000 -- (-2934.372) (-2935.457) [-2936.559] (-2935.993) * (-2935.926) (-2946.692) [-2938.042] (-2936.317) -- 0:02:07
      153500 -- [-2937.482] (-2943.374) (-2936.298) (-2946.018) * (-2935.656) (-2949.383) (-2936.649) [-2937.291] -- 0:02:06
      154000 -- [-2939.388] (-2936.686) (-2939.253) (-2943.863) * [-2937.480] (-2944.372) (-2936.162) (-2938.246) -- 0:02:06
      154500 -- (-2940.281) [-2936.934] (-2940.327) (-2935.428) * (-2943.614) (-2942.608) (-2937.724) [-2933.520] -- 0:02:05
      155000 -- [-2940.523] (-2935.897) (-2943.710) (-2938.960) * (-2937.057) (-2937.457) (-2938.860) [-2934.867] -- 0:02:05

      Average standard deviation of split frequencies: 0.012087

      155500 -- (-2939.541) (-2943.669) [-2939.735] (-2939.157) * (-2938.878) (-2939.084) [-2944.872] (-2937.790) -- 0:02:10
      156000 -- [-2945.287] (-2937.314) (-2937.165) (-2938.548) * (-2940.281) [-2940.579] (-2942.423) (-2936.821) -- 0:02:09
      156500 -- (-2941.680) [-2936.366] (-2938.527) (-2938.706) * (-2938.287) (-2941.316) (-2939.762) [-2938.238] -- 0:02:09
      157000 -- (-2939.460) (-2937.049) (-2938.065) [-2937.064] * (-2937.245) (-2938.943) (-2944.978) [-2937.174] -- 0:02:08
      157500 -- (-2940.846) (-2939.509) [-2935.596] (-2942.491) * (-2945.693) (-2936.868) [-2940.417] (-2940.274) -- 0:02:08
      158000 -- (-2937.228) [-2941.887] (-2933.348) (-2938.015) * (-2950.463) (-2943.285) (-2939.550) [-2940.847] -- 0:02:07
      158500 -- [-2934.384] (-2942.432) (-2937.799) (-2940.112) * (-2941.241) (-2945.340) (-2942.419) [-2945.700] -- 0:02:07
      159000 -- (-2947.514) (-2938.664) (-2939.013) [-2944.730] * [-2937.779] (-2936.072) (-2937.780) (-2945.026) -- 0:02:06
      159500 -- (-2943.879) (-2937.066) (-2933.782) [-2941.025] * (-2940.011) (-2940.695) (-2940.362) [-2938.703] -- 0:02:06
      160000 -- [-2940.145] (-2943.379) (-2939.305) (-2939.863) * [-2936.048] (-2940.016) (-2934.530) (-2942.365) -- 0:02:05

      Average standard deviation of split frequencies: 0.011736

      160500 -- (-2938.622) (-2946.852) [-2936.433] (-2941.148) * (-2940.752) [-2937.587] (-2941.602) (-2944.005) -- 0:02:05
      161000 -- [-2941.412] (-2943.907) (-2943.145) (-2939.114) * (-2942.479) [-2938.963] (-2937.043) (-2937.420) -- 0:02:05
      161500 -- (-2943.401) [-2936.782] (-2938.142) (-2945.130) * (-2948.444) (-2948.835) (-2941.829) [-2942.602] -- 0:02:04
      162000 -- (-2939.805) [-2938.494] (-2938.442) (-2939.016) * (-2937.264) (-2941.136) [-2939.816] (-2936.120) -- 0:02:09
      162500 -- (-2935.358) (-2942.641) [-2938.283] (-2936.787) * (-2940.238) (-2936.334) (-2936.321) [-2937.120] -- 0:02:08
      163000 -- (-2939.537) (-2946.088) (-2942.513) [-2935.026] * [-2941.015] (-2935.862) (-2943.114) (-2942.333) -- 0:02:08
      163500 -- (-2939.764) [-2937.006] (-2946.851) (-2937.149) * (-2939.020) (-2937.899) [-2938.353] (-2948.041) -- 0:02:07
      164000 -- (-2938.078) [-2940.376] (-2938.773) (-2936.557) * (-2938.854) (-2947.132) (-2934.944) [-2936.816] -- 0:02:07
      164500 -- [-2937.067] (-2941.842) (-2939.656) (-2935.652) * [-2936.079] (-2945.060) (-2943.293) (-2946.033) -- 0:02:06
      165000 -- (-2936.216) [-2941.992] (-2939.359) (-2937.267) * (-2938.806) [-2939.742] (-2938.204) (-2942.880) -- 0:02:06

      Average standard deviation of split frequencies: 0.014199

      165500 -- (-2939.513) [-2940.493] (-2939.487) (-2944.575) * (-2942.788) [-2942.581] (-2939.114) (-2938.825) -- 0:02:06
      166000 -- (-2943.042) (-2945.291) (-2943.791) [-2939.350] * (-2949.417) (-2947.521) (-2937.280) [-2946.236] -- 0:02:05
      166500 -- (-2945.371) [-2935.308] (-2937.596) (-2939.345) * (-2935.251) (-2940.660) [-2936.167] (-2934.870) -- 0:02:05
      167000 -- (-2945.767) (-2939.843) [-2934.172] (-2942.187) * (-2940.203) [-2937.696] (-2939.584) (-2936.789) -- 0:02:04
      167500 -- (-2938.403) (-2937.560) (-2942.419) [-2936.267] * (-2937.564) (-2940.362) (-2942.101) [-2938.414] -- 0:02:04
      168000 -- (-2940.233) (-2945.380) [-2936.414] (-2942.173) * (-2942.327) [-2935.551] (-2936.730) (-2939.104) -- 0:02:03
      168500 -- [-2938.635] (-2944.597) (-2942.494) (-2948.211) * (-2938.056) [-2939.394] (-2942.982) (-2938.795) -- 0:02:08
      169000 -- (-2936.806) (-2937.344) [-2938.210] (-2940.363) * (-2934.461) [-2933.059] (-2944.802) (-2939.347) -- 0:02:07
      169500 -- (-2944.358) (-2943.849) (-2937.101) [-2940.866] * (-2940.193) (-2944.370) (-2944.420) [-2941.714] -- 0:02:07
      170000 -- (-2939.683) (-2941.066) [-2937.747] (-2935.335) * [-2941.717] (-2941.264) (-2940.709) (-2938.405) -- 0:02:06

      Average standard deviation of split frequencies: 0.013811

      170500 -- [-2945.635] (-2941.033) (-2945.237) (-2938.956) * (-2941.734) (-2932.203) [-2937.105] (-2949.017) -- 0:02:06
      171000 -- [-2943.152] (-2949.100) (-2940.864) (-2935.790) * (-2939.506) (-2937.575) [-2935.390] (-2938.454) -- 0:02:06
      171500 -- [-2942.253] (-2938.384) (-2947.867) (-2937.087) * (-2939.205) [-2945.572] (-2939.473) (-2939.712) -- 0:02:05
      172000 -- (-2937.128) [-2938.196] (-2941.051) (-2938.779) * (-2941.749) (-2942.756) [-2945.361] (-2950.772) -- 0:02:05
      172500 -- (-2940.904) [-2941.103] (-2939.157) (-2938.513) * (-2937.540) (-2937.348) (-2940.734) [-2937.397] -- 0:02:04
      173000 -- (-2942.548) (-2936.034) (-2946.289) [-2937.412] * (-2938.943) (-2938.982) [-2941.345] (-2933.778) -- 0:02:04
      173500 -- (-2935.663) (-2946.637) (-2940.151) [-2940.206] * [-2937.427] (-2936.086) (-2933.564) (-2936.702) -- 0:02:03
      174000 -- (-2945.335) (-2943.858) [-2940.441] (-2946.534) * (-2940.245) (-2941.466) (-2934.991) [-2939.555] -- 0:02:03
      174500 -- (-2945.548) (-2938.226) (-2941.865) [-2944.779] * (-2941.400) (-2940.376) (-2939.080) [-2938.800] -- 0:02:02
      175000 -- (-2940.849) [-2936.464] (-2938.445) (-2944.396) * [-2935.923] (-2942.376) (-2943.093) (-2945.885) -- 0:02:02

      Average standard deviation of split frequencies: 0.016071

      175500 -- [-2937.477] (-2943.536) (-2947.711) (-2944.447) * (-2942.112) (-2939.168) (-2942.809) [-2940.615] -- 0:02:06
      176000 -- (-2936.795) [-2940.229] (-2937.367) (-2948.371) * (-2944.207) [-2938.102] (-2938.206) (-2942.238) -- 0:02:06
      176500 -- (-2937.318) (-2936.254) [-2937.924] (-2946.723) * [-2939.085] (-2945.426) (-2940.051) (-2939.236) -- 0:02:05
      177000 -- (-2940.192) (-2935.997) (-2940.804) [-2941.500] * (-2943.437) [-2937.237] (-2944.455) (-2937.076) -- 0:02:05
      177500 -- [-2938.969] (-2943.071) (-2939.658) (-2939.275) * (-2938.742) (-2948.207) [-2940.255] (-2939.554) -- 0:02:05
      178000 -- (-2938.404) [-2936.530] (-2936.868) (-2940.531) * (-2937.392) [-2939.882] (-2944.531) (-2943.589) -- 0:02:04
      178500 -- [-2939.720] (-2938.728) (-2936.798) (-2949.145) * (-2939.367) (-2939.933) [-2935.950] (-2946.843) -- 0:02:04
      179000 -- (-2938.138) (-2938.312) [-2939.990] (-2941.221) * (-2941.179) (-2935.027) (-2933.377) [-2947.907] -- 0:02:03
      179500 -- (-2938.697) [-2942.816] (-2938.319) (-2943.727) * (-2940.808) [-2947.508] (-2936.206) (-2948.264) -- 0:02:03
      180000 -- [-2937.504] (-2944.471) (-2939.287) (-2943.885) * (-2942.929) (-2952.205) (-2944.906) [-2938.635] -- 0:02:02

      Average standard deviation of split frequencies: 0.013046

      180500 -- [-2943.457] (-2939.379) (-2941.012) (-2935.330) * [-2942.433] (-2940.594) (-2946.654) (-2943.075) -- 0:02:02
      181000 -- (-2950.568) (-2943.595) (-2941.762) [-2938.204] * (-2939.092) [-2943.866] (-2935.738) (-2944.988) -- 0:02:02
      181500 -- (-2946.254) (-2939.939) [-2935.134] (-2938.817) * (-2942.124) [-2938.398] (-2947.059) (-2942.923) -- 0:02:06
      182000 -- (-2943.837) [-2936.616] (-2933.981) (-2950.496) * (-2937.132) [-2937.034] (-2936.771) (-2942.423) -- 0:02:05
      182500 -- (-2938.728) (-2935.420) [-2937.866] (-2942.853) * [-2940.993] (-2942.013) (-2938.970) (-2946.114) -- 0:02:05
      183000 -- (-2944.041) [-2935.713] (-2942.782) (-2942.361) * (-2943.200) [-2941.857] (-2942.426) (-2937.933) -- 0:02:05
      183500 -- (-2933.247) (-2934.075) (-2948.771) [-2942.156] * (-2942.383) [-2936.079] (-2938.272) (-2936.373) -- 0:02:04
      184000 -- (-2935.038) (-2934.710) [-2940.599] (-2937.607) * (-2939.043) (-2939.241) (-2937.256) [-2934.354] -- 0:02:04
      184500 -- (-2939.762) (-2934.829) [-2936.042] (-2937.620) * [-2945.703] (-2939.248) (-2936.576) (-2946.307) -- 0:02:03
      185000 -- (-2934.888) (-2936.866) (-2932.203) [-2938.472] * (-2943.757) [-2937.257] (-2932.831) (-2944.202) -- 0:02:03

      Average standard deviation of split frequencies: 0.012672

      185500 -- (-2938.160) (-2938.667) [-2944.368] (-2939.543) * [-2941.387] (-2938.577) (-2935.257) (-2939.303) -- 0:02:02
      186000 -- [-2941.719] (-2944.902) (-2942.101) (-2940.974) * (-2949.564) [-2934.544] (-2935.890) (-2938.291) -- 0:02:02
      186500 -- [-2940.411] (-2942.968) (-2947.085) (-2936.288) * (-2942.210) (-2939.057) (-2941.517) [-2935.146] -- 0:02:02
      187000 -- (-2941.238) (-2943.855) (-2943.418) [-2937.102] * [-2940.335] (-2939.092) (-2946.085) (-2937.518) -- 0:02:01
      187500 -- (-2942.243) (-2949.984) (-2942.494) [-2935.928] * (-2941.695) [-2937.854] (-2941.038) (-2934.284) -- 0:02:01
      188000 -- [-2940.280] (-2943.467) (-2944.718) (-2936.272) * (-2940.401) [-2940.976] (-2941.433) (-2939.820) -- 0:02:05
      188500 -- (-2938.440) [-2944.414] (-2941.196) (-2941.130) * [-2941.924] (-2938.215) (-2944.463) (-2934.098) -- 0:02:04
      189000 -- (-2949.348) [-2939.812] (-2943.569) (-2937.821) * (-2939.853) [-2936.615] (-2943.412) (-2935.121) -- 0:02:04
      189500 -- (-2944.068) (-2938.269) [-2937.363] (-2937.477) * (-2938.256) [-2937.818] (-2939.876) (-2934.157) -- 0:02:04
      190000 -- (-2940.027) (-2942.295) (-2945.821) [-2935.058] * (-2948.282) (-2945.295) (-2940.344) [-2937.838] -- 0:02:03

      Average standard deviation of split frequencies: 0.012362

      190500 -- (-2938.285) (-2951.532) [-2940.811] (-2943.845) * [-2937.960] (-2932.810) (-2939.758) (-2939.543) -- 0:02:03
      191000 -- (-2940.500) (-2943.096) [-2940.296] (-2943.651) * (-2946.044) (-2937.570) (-2937.161) [-2942.467] -- 0:02:02
      191500 -- (-2939.006) (-2943.039) (-2938.927) [-2939.600] * (-2940.898) [-2937.321] (-2944.558) (-2940.300) -- 0:02:02
      192000 -- [-2943.246] (-2939.797) (-2940.674) (-2947.145) * (-2941.027) (-2940.380) [-2941.307] (-2942.050) -- 0:02:02
      192500 -- [-2941.166] (-2938.155) (-2937.590) (-2943.245) * (-2936.916) (-2946.515) (-2946.121) [-2945.685] -- 0:02:01
      193000 -- [-2941.798] (-2937.530) (-2945.282) (-2941.966) * [-2936.132] (-2943.565) (-2939.449) (-2936.040) -- 0:02:01
      193500 -- [-2940.045] (-2943.734) (-2940.783) (-2941.891) * (-2935.495) (-2937.716) [-2937.801] (-2939.954) -- 0:02:00
      194000 -- [-2942.886] (-2946.792) (-2938.203) (-2934.193) * (-2935.218) [-2939.553] (-2943.249) (-2940.491) -- 0:02:00
      194500 -- [-2940.597] (-2941.973) (-2940.852) (-2933.312) * (-2934.692) [-2937.436] (-2943.910) (-2938.291) -- 0:02:04
      195000 -- (-2941.218) [-2943.504] (-2940.435) (-2937.441) * (-2939.276) (-2940.382) [-2939.193] (-2938.742) -- 0:02:03

      Average standard deviation of split frequencies: 0.012026

      195500 -- (-2932.190) (-2939.224) [-2945.742] (-2942.251) * (-2941.836) [-2936.261] (-2948.651) (-2937.454) -- 0:02:03
      196000 -- (-2934.145) (-2941.565) [-2940.834] (-2938.341) * [-2935.040] (-2940.137) (-2940.726) (-2941.484) -- 0:02:03
      196500 -- (-2939.033) (-2938.245) [-2936.486] (-2937.522) * (-2934.517) [-2940.093] (-2941.897) (-2945.111) -- 0:02:02
      197000 -- (-2935.703) (-2936.788) (-2939.231) [-2936.388] * [-2942.258] (-2936.657) (-2938.877) (-2943.009) -- 0:02:02
      197500 -- [-2937.240] (-2945.637) (-2937.339) (-2937.741) * (-2937.474) [-2933.419] (-2935.345) (-2945.957) -- 0:02:01
      198000 -- [-2935.044] (-2940.223) (-2936.391) (-2941.251) * (-2936.540) (-2937.369) [-2935.417] (-2936.369) -- 0:02:01
      198500 -- (-2941.214) [-2936.692] (-2939.467) (-2933.206) * (-2935.400) [-2937.617] (-2940.585) (-2941.414) -- 0:02:01
      199000 -- (-2937.372) [-2939.345] (-2933.730) (-2940.654) * (-2938.063) [-2941.870] (-2946.204) (-2938.038) -- 0:02:00
      199500 -- [-2938.461] (-2938.843) (-2938.012) (-2943.201) * [-2938.726] (-2944.830) (-2937.650) (-2939.912) -- 0:02:00
      200000 -- (-2934.712) (-2935.595) (-2939.130) [-2938.015] * (-2942.105) (-2949.283) [-2945.523] (-2940.468) -- 0:01:59

      Average standard deviation of split frequencies: 0.014095

      200500 -- [-2937.781] (-2939.364) (-2942.488) (-2942.868) * (-2941.620) (-2943.236) [-2936.388] (-2947.821) -- 0:01:59
      201000 -- [-2942.564] (-2942.027) (-2950.628) (-2937.307) * [-2941.856] (-2943.782) (-2937.885) (-2941.336) -- 0:02:03
      201500 -- (-2939.760) (-2941.266) (-2944.204) [-2939.040] * (-2941.747) (-2938.788) [-2934.618] (-2945.299) -- 0:02:02
      202000 -- (-2937.318) (-2938.849) [-2938.762] (-2939.186) * (-2941.741) (-2934.067) [-2943.354] (-2939.772) -- 0:02:02
      202500 -- [-2937.239] (-2937.159) (-2937.494) (-2938.006) * (-2941.954) (-2939.396) (-2944.418) [-2945.581] -- 0:02:02
      203000 -- [-2939.213] (-2937.587) (-2943.346) (-2940.483) * (-2939.194) (-2939.426) [-2941.871] (-2938.839) -- 0:02:01
      203500 -- (-2943.962) [-2940.818] (-2945.812) (-2942.258) * (-2945.319) (-2952.804) [-2937.188] (-2942.338) -- 0:02:01
      204000 -- (-2938.818) (-2934.347) (-2941.331) [-2942.922] * [-2939.414] (-2941.540) (-2935.915) (-2939.743) -- 0:02:00
      204500 -- (-2939.603) (-2937.041) (-2943.515) [-2944.084] * (-2940.975) (-2936.467) [-2945.557] (-2940.451) -- 0:02:00
      205000 -- (-2946.685) (-2942.477) [-2935.563] (-2936.112) * (-2943.211) (-2939.722) (-2937.462) [-2945.722] -- 0:02:00

      Average standard deviation of split frequencies: 0.016019

      205500 -- (-2938.137) (-2939.228) (-2937.155) [-2936.880] * (-2948.496) (-2941.454) [-2935.054] (-2943.907) -- 0:01:59
      206000 -- (-2933.067) (-2942.558) [-2938.454] (-2939.620) * (-2943.912) (-2939.480) [-2934.531] (-2942.544) -- 0:01:59
      206500 -- (-2933.669) [-2936.827] (-2937.362) (-2945.218) * (-2943.397) (-2952.087) (-2941.516) [-2941.393] -- 0:01:59
      207000 -- [-2937.072] (-2944.398) (-2943.002) (-2932.816) * [-2940.855] (-2941.253) (-2942.100) (-2946.231) -- 0:01:58
      207500 -- (-2940.596) (-2943.374) (-2936.719) [-2937.839] * (-2950.407) [-2938.975] (-2946.637) (-2945.371) -- 0:02:02
      208000 -- [-2943.204] (-2941.890) (-2938.733) (-2941.077) * (-2946.787) [-2939.481] (-2944.019) (-2936.775) -- 0:02:01
      208500 -- [-2935.346] (-2942.662) (-2935.562) (-2940.280) * (-2941.080) (-2938.282) (-2939.564) [-2938.803] -- 0:02:01
      209000 -- [-2933.709] (-2935.892) (-2939.151) (-2940.354) * (-2940.148) (-2941.237) [-2939.059] (-2937.469) -- 0:02:01
      209500 -- (-2935.519) (-2941.629) [-2934.180] (-2936.481) * (-2935.094) [-2938.517] (-2936.763) (-2939.839) -- 0:02:00
      210000 -- [-2944.646] (-2939.340) (-2937.987) (-2940.758) * (-2939.472) [-2939.437] (-2942.812) (-2943.346) -- 0:02:00

      Average standard deviation of split frequencies: 0.015664

      210500 -- (-2943.621) (-2934.201) [-2940.133] (-2937.429) * (-2942.308) (-2938.988) (-2937.181) [-2935.092] -- 0:02:00
      211000 -- (-2936.079) (-2939.279) (-2932.687) [-2940.973] * (-2937.508) (-2937.528) (-2936.390) [-2939.594] -- 0:01:59
      211500 -- (-2934.498) (-2940.940) [-2935.544] (-2936.921) * [-2941.898] (-2942.781) (-2936.533) (-2937.132) -- 0:01:59
      212000 -- [-2936.853] (-2938.413) (-2934.647) (-2942.642) * (-2939.353) [-2938.766] (-2945.431) (-2936.982) -- 0:01:58
      212500 -- [-2940.998] (-2937.369) (-2943.043) (-2938.688) * [-2941.008] (-2937.188) (-2944.163) (-2936.808) -- 0:01:58
      213000 -- (-2937.625) [-2936.267] (-2938.235) (-2935.452) * (-2934.382) [-2936.014] (-2946.473) (-2935.191) -- 0:01:58
      213500 -- (-2948.015) (-2940.354) [-2938.539] (-2940.162) * (-2938.343) (-2940.369) (-2939.782) [-2937.190] -- 0:01:57
      214000 -- (-2942.623) [-2936.180] (-2941.766) (-2945.204) * [-2933.387] (-2939.557) (-2944.624) (-2936.867) -- 0:01:57
      214500 -- (-2941.904) [-2942.319] (-2935.838) (-2942.706) * [-2942.598] (-2937.932) (-2941.407) (-2937.165) -- 0:02:00
      215000 -- (-2939.232) (-2934.368) [-2941.679] (-2939.047) * (-2938.524) (-2937.281) [-2940.803] (-2938.067) -- 0:02:00

      Average standard deviation of split frequencies: 0.013095

      215500 -- (-2937.811) (-2942.347) (-2936.615) [-2941.362] * (-2938.822) [-2942.488] (-2946.045) (-2938.173) -- 0:02:00
      216000 -- [-2938.123] (-2945.098) (-2943.177) (-2938.688) * (-2941.584) [-2940.669] (-2942.792) (-2943.401) -- 0:01:59
      216500 -- (-2939.097) [-2942.433] (-2935.887) (-2941.968) * (-2937.802) (-2942.912) [-2942.833] (-2943.897) -- 0:01:59
      217000 -- (-2947.035) [-2937.682] (-2944.818) (-2942.908) * (-2941.895) (-2942.019) [-2939.203] (-2944.410) -- 0:01:59
      217500 -- (-2943.155) (-2942.215) (-2942.530) [-2934.125] * [-2936.465] (-2943.227) (-2942.172) (-2935.066) -- 0:01:58
      218000 -- (-2936.867) [-2941.676] (-2939.779) (-2939.945) * (-2937.518) [-2939.613] (-2942.673) (-2944.882) -- 0:01:58
      218500 -- (-2940.112) (-2943.855) [-2945.161] (-2940.503) * (-2941.424) [-2936.893] (-2938.429) (-2938.535) -- 0:01:58
      219000 -- (-2939.033) [-2935.633] (-2944.357) (-2935.726) * (-2939.403) (-2942.380) [-2935.563] (-2941.245) -- 0:01:57
      219500 -- (-2938.795) [-2944.464] (-2939.931) (-2943.392) * (-2939.606) (-2940.841) (-2939.461) [-2940.868] -- 0:01:57
      220000 -- (-2936.881) (-2940.768) [-2938.158] (-2933.370) * (-2940.301) [-2941.512] (-2941.578) (-2940.546) -- 0:01:56

      Average standard deviation of split frequencies: 0.010681

      220500 -- [-2940.488] (-2944.765) (-2933.413) (-2937.499) * (-2943.002) [-2936.746] (-2938.634) (-2935.411) -- 0:01:56
      221000 -- [-2938.206] (-2938.265) (-2937.515) (-2940.360) * [-2948.469] (-2940.584) (-2941.601) (-2937.327) -- 0:01:59
      221500 -- (-2942.364) (-2940.513) (-2937.804) [-2938.939] * (-2934.977) (-2936.439) [-2937.840] (-2941.014) -- 0:01:59
      222000 -- [-2939.092] (-2938.915) (-2942.176) (-2941.908) * [-2937.641] (-2941.428) (-2938.268) (-2942.880) -- 0:01:59
      222500 -- [-2935.244] (-2938.028) (-2939.016) (-2944.777) * (-2938.244) (-2937.482) (-2938.201) [-2944.525] -- 0:01:58
      223000 -- (-2944.954) (-2938.906) [-2940.931] (-2933.339) * [-2941.478] (-2944.387) (-2934.305) (-2939.502) -- 0:01:58
      223500 -- (-2938.143) (-2939.490) (-2938.336) [-2939.282] * (-2940.806) (-2935.086) (-2943.553) [-2942.113] -- 0:01:58
      224000 -- (-2946.686) (-2942.767) [-2937.359] (-2936.746) * (-2945.579) (-2940.460) [-2936.189] (-2941.018) -- 0:01:57
      224500 -- (-2939.821) (-2939.033) (-2941.476) [-2945.856] * (-2936.201) (-2934.996) [-2936.739] (-2942.752) -- 0:01:57
      225000 -- (-2941.997) (-2945.063) (-2944.495) [-2941.804] * [-2942.049] (-2944.804) (-2938.791) (-2937.335) -- 0:01:57

      Average standard deviation of split frequencies: 0.010429

      225500 -- (-2943.308) (-2939.015) (-2944.916) [-2939.341] * (-2936.548) (-2947.839) [-2938.236] (-2939.783) -- 0:01:56
      226000 -- (-2936.937) (-2937.917) [-2934.283] (-2936.559) * [-2935.489] (-2947.215) (-2942.424) (-2941.288) -- 0:01:56
      226500 -- (-2943.614) (-2943.338) [-2938.835] (-2934.622) * (-2942.247) (-2939.373) [-2945.091] (-2940.999) -- 0:01:56
      227000 -- (-2937.093) (-2943.733) [-2936.089] (-2940.313) * (-2946.695) [-2936.740] (-2942.076) (-2945.087) -- 0:01:55
      227500 -- (-2937.206) (-2935.873) [-2935.731] (-2940.056) * (-2937.743) (-2939.399) (-2942.951) [-2936.929] -- 0:01:58
      228000 -- (-2941.263) (-2937.063) (-2937.288) [-2935.765] * (-2943.506) [-2938.210] (-2948.380) (-2936.316) -- 0:01:58
      228500 -- (-2941.396) [-2937.187] (-2941.338) (-2944.609) * (-2940.443) [-2932.945] (-2945.124) (-2939.700) -- 0:01:58
      229000 -- (-2937.594) (-2942.325) [-2939.895] (-2940.099) * (-2939.591) (-2937.974) (-2939.735) [-2938.781] -- 0:01:57
      229500 -- [-2935.740] (-2941.838) (-2946.678) (-2939.294) * (-2940.759) (-2940.225) [-2942.191] (-2942.755) -- 0:01:57
      230000 -- [-2937.687] (-2946.253) (-2937.699) (-2936.455) * (-2940.532) [-2941.362] (-2942.399) (-2939.662) -- 0:01:57

      Average standard deviation of split frequencies: 0.010218

      230500 -- (-2935.150) [-2941.410] (-2942.287) (-2937.867) * [-2938.288] (-2941.497) (-2938.432) (-2939.901) -- 0:01:56
      231000 -- (-2936.862) (-2940.997) [-2935.841] (-2935.488) * [-2935.063] (-2941.911) (-2936.522) (-2937.481) -- 0:01:56
      231500 -- (-2936.306) (-2945.966) [-2943.554] (-2942.783) * (-2939.594) (-2936.308) (-2952.439) [-2937.503] -- 0:01:56
      232000 -- [-2947.752] (-2942.666) (-2942.169) (-2939.774) * [-2940.123] (-2940.254) (-2947.500) (-2942.075) -- 0:01:55
      232500 -- [-2941.116] (-2938.826) (-2945.650) (-2941.127) * (-2939.805) (-2938.680) [-2942.271] (-2939.036) -- 0:01:55
      233000 -- [-2946.358] (-2936.499) (-2939.442) (-2940.114) * (-2939.863) (-2945.224) (-2942.219) [-2939.911] -- 0:01:55
      233500 -- (-2943.587) (-2938.766) (-2937.502) [-2940.352] * [-2932.651] (-2941.210) (-2938.648) (-2940.061) -- 0:01:58
      234000 -- (-2938.986) [-2939.491] (-2950.273) (-2940.546) * [-2937.926] (-2941.840) (-2937.584) (-2941.064) -- 0:01:57
      234500 -- (-2940.376) [-2937.857] (-2933.800) (-2939.984) * [-2935.794] (-2934.970) (-2935.984) (-2938.105) -- 0:01:57
      235000 -- (-2944.122) (-2934.915) (-2942.640) [-2937.966] * (-2947.515) (-2946.274) (-2938.010) [-2936.569] -- 0:01:57

      Average standard deviation of split frequencies: 0.005992

      235500 -- (-2940.295) (-2943.623) (-2930.790) [-2938.596] * (-2940.415) [-2939.736] (-2938.842) (-2935.972) -- 0:01:56
      236000 -- (-2947.959) (-2940.811) (-2943.712) [-2936.026] * (-2936.986) (-2940.374) (-2938.104) [-2933.342] -- 0:01:56
      236500 -- (-2938.059) (-2942.258) (-2938.050) [-2939.801] * (-2946.291) [-2940.996] (-2945.881) (-2939.247) -- 0:01:56
      237000 -- (-2949.242) [-2934.464] (-2942.588) (-2941.343) * (-2938.991) (-2941.996) (-2945.079) [-2936.356] -- 0:01:55
      237500 -- (-2953.827) (-2938.546) [-2938.283] (-2936.104) * [-2934.787] (-2940.891) (-2937.150) (-2940.921) -- 0:01:55
      238000 -- (-2948.465) (-2946.697) [-2939.242] (-2936.830) * (-2942.153) (-2943.808) (-2937.626) [-2937.584] -- 0:01:55
      238500 -- (-2945.680) (-2942.259) (-2948.341) [-2939.755] * (-2944.752) (-2942.293) (-2941.322) [-2939.416] -- 0:01:54
      239000 -- (-2947.316) (-2940.991) [-2943.227] (-2936.310) * [-2940.033] (-2941.354) (-2936.954) (-2937.762) -- 0:01:54
      239500 -- [-2939.615] (-2943.073) (-2942.295) (-2948.250) * (-2943.369) [-2935.835] (-2935.898) (-2937.504) -- 0:01:54
      240000 -- [-2942.787] (-2941.229) (-2939.437) (-2941.534) * [-2938.838] (-2936.381) (-2936.484) (-2943.924) -- 0:01:57

      Average standard deviation of split frequencies: 0.007835

      240500 -- (-2940.654) (-2936.214) (-2942.120) [-2937.914] * [-2939.565] (-2943.879) (-2940.616) (-2937.923) -- 0:01:56
      241000 -- (-2936.434) (-2944.188) [-2936.527] (-2941.195) * [-2940.911] (-2944.056) (-2942.216) (-2941.481) -- 0:01:56
      241500 -- [-2938.823] (-2944.920) (-2936.594) (-2939.058) * (-2940.173) (-2948.973) (-2934.844) [-2938.716] -- 0:01:56
      242000 -- [-2937.073] (-2941.482) (-2942.828) (-2939.165) * (-2937.292) (-2937.922) (-2934.824) [-2937.333] -- 0:01:55
      242500 -- (-2935.826) (-2939.591) (-2937.094) [-2935.300] * (-2937.824) (-2938.529) [-2937.287] (-2943.735) -- 0:01:55
      243000 -- (-2937.852) [-2934.953] (-2937.625) (-2937.834) * [-2938.602] (-2937.764) (-2946.057) (-2950.204) -- 0:01:55
      243500 -- [-2932.301] (-2943.426) (-2944.303) (-2937.101) * [-2939.519] (-2938.120) (-2939.264) (-2944.533) -- 0:01:54
      244000 -- (-2937.291) (-2942.592) (-2935.788) [-2936.625] * (-2942.258) [-2937.860] (-2943.338) (-2941.691) -- 0:01:54
      244500 -- (-2945.431) [-2937.170] (-2941.467) (-2946.034) * (-2941.218) [-2942.109] (-2947.889) (-2937.882) -- 0:01:54
      245000 -- [-2945.416] (-2937.233) (-2947.393) (-2934.511) * (-2944.471) [-2943.423] (-2939.014) (-2935.710) -- 0:01:54

      Average standard deviation of split frequencies: 0.007665

      245500 -- (-2937.935) (-2940.889) [-2943.419] (-2934.383) * (-2944.822) (-2956.514) (-2936.236) [-2936.317] -- 0:01:53
      246000 -- (-2936.075) (-2941.605) (-2933.691) [-2936.444] * (-2938.040) (-2942.678) (-2940.874) [-2939.796] -- 0:01:53
      246500 -- [-2938.890] (-2943.131) (-2942.280) (-2941.683) * (-2939.056) (-2943.050) (-2941.189) [-2936.930] -- 0:01:56
      247000 -- [-2936.831] (-2932.330) (-2936.262) (-2938.221) * (-2943.109) (-2940.302) (-2940.895) [-2934.255] -- 0:01:55
      247500 -- (-2938.468) [-2937.532] (-2940.099) (-2941.531) * (-2936.421) (-2941.984) [-2940.684] (-2935.940) -- 0:01:55
      248000 -- [-2941.293] (-2949.058) (-2938.293) (-2941.870) * [-2937.363] (-2935.702) (-2945.790) (-2946.095) -- 0:01:55
      248500 -- [-2932.258] (-2941.014) (-2940.553) (-2942.980) * (-2938.544) (-2939.635) (-2938.887) [-2944.098] -- 0:01:54
      249000 -- (-2936.174) (-2947.560) (-2934.957) [-2945.308] * (-2949.574) (-2936.446) [-2940.168] (-2937.667) -- 0:01:54
      249500 -- [-2938.965] (-2940.037) (-2936.757) (-2948.373) * (-2938.169) [-2938.439] (-2938.908) (-2937.593) -- 0:01:54
      250000 -- [-2943.227] (-2944.158) (-2938.718) (-2937.314) * [-2937.702] (-2935.964) (-2948.942) (-2938.566) -- 0:01:54

      Average standard deviation of split frequencies: 0.007522

      250500 -- (-2940.550) (-2935.478) [-2941.087] (-2938.875) * (-2940.767) [-2938.632] (-2949.585) (-2943.254) -- 0:01:53
      251000 -- (-2940.766) (-2938.046) [-2935.573] (-2937.654) * (-2942.219) [-2933.899] (-2942.975) (-2941.623) -- 0:01:53
      251500 -- (-2939.567) (-2944.469) [-2941.180] (-2938.416) * (-2937.845) (-2947.045) (-2940.758) [-2940.943] -- 0:01:53
      252000 -- (-2939.795) (-2942.451) (-2945.101) [-2941.935] * [-2946.331] (-2939.839) (-2943.481) (-2951.537) -- 0:01:52
      252500 -- (-2939.469) (-2944.494) [-2939.145] (-2939.294) * [-2935.607] (-2952.747) (-2942.789) (-2939.909) -- 0:01:52
      253000 -- (-2943.480) (-2945.548) [-2944.216] (-2944.421) * (-2937.763) (-2940.475) (-2940.978) [-2937.975] -- 0:01:55
      253500 -- [-2936.466] (-2941.076) (-2937.694) (-2945.540) * (-2935.605) (-2937.844) (-2936.157) [-2941.681] -- 0:01:54
      254000 -- (-2936.617) [-2945.453] (-2935.188) (-2937.302) * [-2937.568] (-2938.605) (-2939.977) (-2942.822) -- 0:01:54
      254500 -- [-2938.899] (-2939.773) (-2937.894) (-2934.852) * (-2946.682) (-2938.166) [-2934.643] (-2940.044) -- 0:01:54
      255000 -- (-2941.620) (-2942.236) (-2943.617) [-2934.515] * (-2942.787) (-2938.732) [-2935.161] (-2940.258) -- 0:01:53

      Average standard deviation of split frequencies: 0.011049

      255500 -- (-2939.622) [-2936.762] (-2936.833) (-2941.826) * [-2934.056] (-2937.492) (-2942.850) (-2939.044) -- 0:01:53
      256000 -- (-2947.349) [-2942.577] (-2934.298) (-2941.448) * (-2934.131) (-2936.789) [-2943.070] (-2937.208) -- 0:01:53
      256500 -- [-2949.952] (-2934.161) (-2936.873) (-2945.144) * [-2937.556] (-2943.336) (-2942.782) (-2936.941) -- 0:01:53
      257000 -- (-2946.110) (-2950.906) (-2941.688) [-2939.870] * (-2937.870) (-2938.240) (-2935.085) [-2935.889] -- 0:01:52
      257500 -- (-2936.999) [-2938.229] (-2941.430) (-2942.201) * (-2937.557) (-2936.643) [-2935.712] (-2937.424) -- 0:01:52
      258000 -- (-2940.561) (-2945.780) (-2938.986) [-2939.479] * (-2936.475) (-2948.502) [-2939.804] (-2941.622) -- 0:01:52
      258500 -- (-2940.338) (-2949.243) (-2939.675) [-2943.118] * (-2938.074) (-2941.241) [-2936.098] (-2941.960) -- 0:01:51
      259000 -- [-2946.766] (-2941.495) (-2945.110) (-2937.821) * (-2941.363) (-2936.224) [-2933.056] (-2940.838) -- 0:01:51
      259500 -- (-2936.976) (-2938.024) [-2934.134] (-2941.062) * [-2945.072] (-2939.212) (-2934.833) (-2938.687) -- 0:01:54
      260000 -- (-2943.094) (-2941.039) [-2940.971] (-2934.496) * (-2946.566) (-2943.766) (-2946.600) [-2940.112] -- 0:01:53

      Average standard deviation of split frequencies: 0.016276

      260500 -- [-2943.379] (-2938.385) (-2940.641) (-2939.868) * (-2942.762) [-2942.932] (-2954.120) (-2938.851) -- 0:01:53
      261000 -- [-2939.962] (-2932.679) (-2935.588) (-2943.766) * (-2945.119) [-2937.397] (-2942.269) (-2936.741) -- 0:01:53
      261500 -- [-2946.077] (-2937.511) (-2937.809) (-2941.871) * (-2943.724) (-2935.779) (-2939.666) [-2934.262] -- 0:01:52
      262000 -- (-2938.476) (-2939.431) [-2939.385] (-2943.804) * (-2944.536) (-2940.932) [-2944.876] (-2935.279) -- 0:01:52
      262500 -- [-2941.887] (-2936.169) (-2943.062) (-2942.919) * (-2943.349) [-2939.050] (-2937.587) (-2940.142) -- 0:01:52
      263000 -- (-2944.541) [-2935.589] (-2952.463) (-2942.209) * (-2939.349) [-2937.595] (-2935.158) (-2940.457) -- 0:01:52
      263500 -- (-2936.698) (-2938.297) (-2943.854) [-2937.879] * (-2939.586) (-2932.671) [-2942.838] (-2944.241) -- 0:01:51
      264000 -- (-2942.938) [-2935.443] (-2947.463) (-2936.657) * (-2942.458) [-2941.902] (-2939.826) (-2939.460) -- 0:01:51
      264500 -- [-2945.292] (-2944.904) (-2942.333) (-2938.073) * (-2936.433) (-2942.586) (-2939.031) [-2939.727] -- 0:01:51
      265000 -- (-2943.714) (-2939.396) [-2937.570] (-2943.018) * (-2940.703) (-2942.578) (-2946.138) [-2939.894] -- 0:01:50

      Average standard deviation of split frequencies: 0.015950

      265500 -- (-2939.440) (-2940.086) [-2942.365] (-2940.407) * [-2936.558] (-2943.661) (-2938.018) (-2942.676) -- 0:01:50
      266000 -- (-2936.259) (-2935.885) [-2937.646] (-2938.094) * (-2940.532) (-2940.867) (-2942.948) [-2942.393] -- 0:01:53
      266500 -- (-2935.235) [-2937.568] (-2936.145) (-2942.897) * (-2941.621) (-2938.456) (-2942.770) [-2942.524] -- 0:01:52
      267000 -- (-2940.364) (-2940.480) (-2944.860) [-2939.428] * (-2939.254) (-2937.290) (-2939.988) [-2934.383] -- 0:01:52
      267500 -- (-2938.881) [-2939.112] (-2939.552) (-2937.525) * (-2936.749) (-2941.441) [-2937.736] (-2935.301) -- 0:01:52
      268000 -- (-2935.192) (-2940.188) [-2938.682] (-2938.585) * (-2936.848) (-2939.102) [-2938.369] (-2934.835) -- 0:01:51
      268500 -- [-2940.824] (-2946.183) (-2937.069) (-2940.029) * (-2945.321) [-2939.895] (-2941.017) (-2938.575) -- 0:01:51
      269000 -- (-2934.848) (-2941.395) [-2944.018] (-2940.091) * (-2937.537) (-2939.212) (-2937.635) [-2937.252] -- 0:01:51
      269500 -- (-2944.402) (-2941.062) (-2944.198) [-2936.854] * (-2938.551) (-2937.577) [-2939.230] (-2938.383) -- 0:01:51
      270000 -- (-2936.301) (-2942.712) [-2936.014] (-2939.079) * (-2941.026) (-2948.306) (-2939.130) [-2938.359] -- 0:01:50

      Average standard deviation of split frequencies: 0.015675

      270500 -- [-2939.160] (-2947.217) (-2945.319) (-2937.187) * (-2937.376) (-2940.755) (-2944.142) [-2935.576] -- 0:01:50
      271000 -- (-2937.595) (-2945.931) [-2944.639] (-2937.205) * (-2940.494) (-2939.776) (-2948.046) [-2936.137] -- 0:01:50
      271500 -- (-2939.079) (-2945.056) (-2944.437) [-2933.635] * [-2933.872] (-2940.914) (-2937.142) (-2943.886) -- 0:01:50
      272000 -- [-2939.740] (-2945.849) (-2938.255) (-2934.351) * (-2937.782) (-2943.729) (-2937.194) [-2940.113] -- 0:01:49
      272500 -- (-2939.655) (-2940.328) (-2942.964) [-2934.957] * [-2940.153] (-2944.399) (-2938.693) (-2939.357) -- 0:01:52
      273000 -- (-2939.662) (-2940.368) [-2938.899] (-2943.485) * (-2939.520) (-2939.422) [-2943.923] (-2942.610) -- 0:01:51
      273500 -- [-2948.297] (-2939.178) (-2934.807) (-2939.362) * (-2936.354) (-2946.276) (-2941.005) [-2946.387] -- 0:01:51
      274000 -- (-2946.246) (-2942.893) (-2936.676) [-2936.444] * [-2942.438] (-2936.186) (-2941.868) (-2937.983) -- 0:01:51
      274500 -- (-2937.661) (-2940.957) [-2936.235] (-2945.349) * (-2943.450) (-2940.220) (-2944.187) [-2938.148] -- 0:01:51
      275000 -- (-2936.880) (-2936.976) [-2936.940] (-2948.272) * (-2944.290) (-2938.560) [-2939.064] (-2937.203) -- 0:01:50

      Average standard deviation of split frequencies: 0.017080

      275500 -- [-2938.945] (-2939.119) (-2937.982) (-2941.082) * (-2939.010) (-2938.004) (-2937.934) [-2942.711] -- 0:01:50
      276000 -- (-2941.251) (-2938.165) [-2935.165] (-2937.597) * (-2940.478) (-2942.300) (-2941.555) [-2939.538] -- 0:01:50
      276500 -- (-2943.554) [-2940.815] (-2943.270) (-2945.049) * (-2940.817) (-2939.829) (-2938.821) [-2937.004] -- 0:01:49
      277000 -- (-2950.048) [-2937.516] (-2936.366) (-2939.206) * (-2941.338) (-2944.176) [-2938.553] (-2938.556) -- 0:01:49
      277500 -- (-2951.828) (-2937.486) [-2941.468] (-2933.207) * [-2946.097] (-2945.528) (-2936.915) (-2935.755) -- 0:01:49
      278000 -- (-2941.017) (-2944.466) [-2943.541] (-2938.456) * (-2939.611) (-2937.499) (-2940.962) [-2937.498] -- 0:01:49
      278500 -- (-2936.407) (-2943.258) [-2937.689] (-2949.269) * (-2950.723) (-2942.741) [-2936.927] (-2940.052) -- 0:01:48
      279000 -- (-2942.171) (-2937.655) [-2936.199] (-2940.978) * [-2945.802] (-2943.943) (-2947.772) (-2938.625) -- 0:01:48
      279500 -- (-2939.148) (-2935.894) [-2942.802] (-2938.814) * (-2949.666) [-2946.317] (-2938.670) (-2947.393) -- 0:01:50
      280000 -- [-2934.288] (-2940.475) (-2944.410) (-2937.073) * (-2937.068) (-2949.231) [-2937.217] (-2942.211) -- 0:01:50

      Average standard deviation of split frequencies: 0.011757

      280500 -- (-2950.435) (-2945.463) [-2939.522] (-2939.528) * (-2940.385) (-2936.504) [-2941.905] (-2948.083) -- 0:01:50
      281000 -- (-2938.685) [-2933.656] (-2942.991) (-2946.198) * (-2939.366) [-2943.111] (-2938.137) (-2944.275) -- 0:01:50
      281500 -- (-2939.260) (-2942.118) [-2940.199] (-2937.118) * (-2935.822) (-2947.083) [-2937.177] (-2938.177) -- 0:01:49
      282000 -- [-2939.331] (-2949.773) (-2944.838) (-2936.330) * [-2937.790] (-2941.318) (-2938.377) (-2938.111) -- 0:01:49
      282500 -- (-2940.034) (-2940.149) (-2941.977) [-2942.266] * (-2934.186) (-2946.849) [-2938.415] (-2938.381) -- 0:01:49
      283000 -- (-2945.568) (-2937.570) (-2949.343) [-2940.360] * (-2941.777) (-2939.722) [-2946.066] (-2939.656) -- 0:01:48
      283500 -- (-2944.711) (-2938.897) [-2939.542] (-2939.837) * [-2941.365] (-2944.988) (-2953.235) (-2938.598) -- 0:01:48
      284000 -- (-2954.483) (-2935.656) [-2939.623] (-2945.232) * (-2935.507) (-2942.885) [-2938.902] (-2942.517) -- 0:01:48
      284500 -- (-2945.574) [-2938.890] (-2943.003) (-2940.277) * (-2941.197) (-2945.215) (-2938.305) [-2938.850] -- 0:01:48
      285000 -- (-2949.285) (-2939.011) [-2937.070] (-2951.738) * [-2945.781] (-2938.299) (-2940.197) (-2943.785) -- 0:01:47

      Average standard deviation of split frequencies: 0.009890

      285500 -- (-2938.407) (-2937.412) [-2935.884] (-2951.379) * (-2949.590) (-2941.914) [-2946.764] (-2938.535) -- 0:01:47
      286000 -- [-2941.348] (-2937.109) (-2941.052) (-2941.867) * (-2942.418) [-2938.439] (-2940.130) (-2936.829) -- 0:01:49
      286500 -- (-2942.141) (-2942.621) [-2935.300] (-2948.342) * [-2933.347] (-2937.690) (-2940.114) (-2938.851) -- 0:01:49
      287000 -- (-2947.345) (-2939.465) (-2943.197) [-2938.142] * [-2934.410] (-2941.861) (-2937.884) (-2941.125) -- 0:01:49
      287500 -- (-2936.089) (-2936.335) [-2938.488] (-2945.373) * (-2939.752) (-2935.036) [-2935.159] (-2941.014) -- 0:01:49
      288000 -- (-2937.078) (-2942.023) [-2941.269] (-2938.945) * (-2940.463) [-2938.298] (-2942.458) (-2943.252) -- 0:01:48
      288500 -- [-2938.886] (-2946.730) (-2937.109) (-2941.622) * (-2934.821) (-2942.256) (-2934.712) [-2942.004] -- 0:01:48
      289000 -- [-2939.745] (-2943.546) (-2937.681) (-2942.767) * (-2932.149) (-2936.987) [-2935.725] (-2941.143) -- 0:01:48
      289500 -- [-2938.296] (-2939.234) (-2939.017) (-2942.467) * (-2943.581) (-2939.247) [-2940.791] (-2942.494) -- 0:01:47
      290000 -- [-2935.911] (-2939.863) (-2940.659) (-2946.229) * (-2938.114) (-2944.616) (-2947.571) [-2940.903] -- 0:01:47

      Average standard deviation of split frequencies: 0.008109

      290500 -- (-2936.691) (-2943.855) (-2936.420) [-2938.019] * [-2945.906] (-2944.903) (-2935.675) (-2943.691) -- 0:01:47
      291000 -- (-2940.275) (-2944.936) (-2940.159) [-2942.027] * (-2941.186) (-2942.718) [-2935.286] (-2948.786) -- 0:01:47
      291500 -- [-2937.047] (-2940.964) (-2947.942) (-2938.108) * [-2939.708] (-2943.988) (-2943.326) (-2951.564) -- 0:01:46
      292000 -- [-2937.929] (-2948.002) (-2941.463) (-2940.248) * (-2943.719) (-2936.313) (-2949.348) [-2946.853] -- 0:01:46
      292500 -- [-2936.604] (-2937.844) (-2936.907) (-2936.221) * (-2951.789) (-2941.996) [-2939.290] (-2950.182) -- 0:01:48
      293000 -- (-2939.878) (-2942.633) [-2939.733] (-2942.405) * (-2937.715) [-2938.649] (-2945.089) (-2941.454) -- 0:01:48
      293500 -- [-2940.990] (-2947.117) (-2939.804) (-2937.749) * (-2939.273) [-2934.419] (-2939.440) (-2940.150) -- 0:01:48
      294000 -- [-2934.763] (-2943.532) (-2934.370) (-2935.740) * (-2942.183) [-2942.058] (-2942.800) (-2940.386) -- 0:01:48
      294500 -- (-2938.246) [-2945.439] (-2939.179) (-2936.015) * [-2941.930] (-2935.058) (-2941.328) (-2939.916) -- 0:01:47
      295000 -- (-2937.933) [-2941.887] (-2932.882) (-2946.859) * (-2941.014) (-2941.791) (-2934.662) [-2935.662] -- 0:01:47

      Average standard deviation of split frequencies: 0.007963

      295500 -- (-2939.896) (-2945.931) [-2935.129] (-2942.448) * (-2944.306) [-2938.546] (-2940.274) (-2939.865) -- 0:01:47
      296000 -- (-2942.450) [-2939.498] (-2944.032) (-2940.103) * (-2940.514) [-2935.234] (-2940.991) (-2944.329) -- 0:01:47
      296500 -- (-2937.287) (-2938.378) (-2938.034) [-2935.592] * [-2939.521] (-2940.096) (-2940.754) (-2940.290) -- 0:01:46
      297000 -- [-2936.607] (-2939.893) (-2945.118) (-2949.184) * (-2942.157) (-2943.584) [-2942.555] (-2944.604) -- 0:01:46
      297500 -- [-2936.243] (-2936.735) (-2938.706) (-2945.226) * (-2933.600) (-2939.317) [-2938.843] (-2940.485) -- 0:01:46
      298000 -- (-2934.547) (-2936.353) (-2937.729) [-2938.684] * [-2936.098] (-2935.907) (-2942.379) (-2939.619) -- 0:01:46
      298500 -- (-2940.727) [-2939.897] (-2944.727) (-2938.215) * (-2937.872) [-2941.535] (-2940.852) (-2940.569) -- 0:01:45
      299000 -- [-2939.028] (-2937.408) (-2937.668) (-2936.945) * (-2943.178) (-2939.880) (-2938.445) [-2940.780] -- 0:01:47
      299500 -- [-2936.835] (-2933.937) (-2949.707) (-2941.342) * (-2943.010) (-2941.072) [-2942.317] (-2943.145) -- 0:01:47
      300000 -- (-2942.551) (-2934.711) (-2936.957) [-2942.550] * [-2940.260] (-2939.053) (-2944.060) (-2938.346) -- 0:01:47

      Average standard deviation of split frequencies: 0.007839

      300500 -- [-2941.337] (-2946.877) (-2938.766) (-2943.648) * (-2935.169) (-2941.066) (-2946.177) [-2935.821] -- 0:01:47
      301000 -- (-2943.560) (-2939.707) (-2940.544) [-2943.524] * (-2942.630) (-2936.191) (-2938.187) [-2939.893] -- 0:01:46
      301500 -- (-2944.034) (-2941.446) [-2937.760] (-2936.689) * (-2937.877) [-2934.274] (-2942.917) (-2940.340) -- 0:01:46
      302000 -- (-2939.782) [-2936.903] (-2933.955) (-2941.050) * (-2943.276) (-2937.500) (-2940.526) [-2936.260] -- 0:01:46
      302500 -- [-2936.708] (-2938.651) (-2942.737) (-2938.127) * (-2937.112) [-2939.274] (-2948.093) (-2941.938) -- 0:01:46
      303000 -- (-2939.584) (-2936.530) [-2936.972] (-2937.079) * (-2937.340) (-2936.412) (-2938.152) [-2933.940] -- 0:01:45
      303500 -- [-2940.305] (-2945.598) (-2940.902) (-2939.528) * (-2937.705) (-2934.598) [-2945.302] (-2937.333) -- 0:01:45
      304000 -- [-2938.234] (-2936.140) (-2937.285) (-2940.505) * (-2939.091) [-2941.452] (-2936.047) (-2942.254) -- 0:01:45
      304500 -- (-2936.781) (-2937.824) [-2940.939] (-2941.738) * (-2940.105) (-2938.511) (-2935.567) [-2947.672] -- 0:01:45
      305000 -- (-2939.264) [-2944.690] (-2943.759) (-2941.471) * (-2935.674) (-2938.874) (-2936.332) [-2939.364] -- 0:01:44

      Average standard deviation of split frequencies: 0.007703

      305500 -- (-2936.687) (-2947.648) (-2936.636) [-2937.974] * (-2946.234) [-2943.357] (-2941.791) (-2936.428) -- 0:01:46
      306000 -- (-2935.915) [-2944.427] (-2939.204) (-2942.132) * [-2938.297] (-2944.858) (-2935.943) (-2935.408) -- 0:01:46
      306500 -- (-2948.148) (-2938.201) (-2944.957) [-2937.282] * (-2940.015) (-2943.612) [-2938.552] (-2942.533) -- 0:01:46
      307000 -- (-2944.878) [-2939.516] (-2946.134) (-2933.873) * (-2932.566) [-2937.576] (-2939.684) (-2943.985) -- 0:01:46
      307500 -- (-2937.543) [-2934.142] (-2937.499) (-2933.831) * (-2943.851) (-2936.285) (-2942.723) [-2934.425] -- 0:01:45
      308000 -- (-2938.097) (-2938.699) [-2934.025] (-2947.732) * [-2936.818] (-2936.538) (-2943.133) (-2945.640) -- 0:01:45
      308500 -- (-2943.233) (-2938.179) [-2937.183] (-2940.768) * (-2939.893) (-2935.509) (-2942.536) [-2935.708] -- 0:01:45
      309000 -- (-2943.736) (-2940.497) (-2937.128) [-2935.543] * (-2935.929) (-2940.950) (-2941.332) [-2936.020] -- 0:01:45
      309500 -- (-2945.159) (-2946.242) (-2940.551) [-2937.231] * [-2940.091] (-2942.968) (-2949.013) (-2944.851) -- 0:01:44
      310000 -- (-2939.897) (-2946.584) [-2935.286] (-2937.701) * (-2940.295) (-2942.799) (-2941.878) [-2934.858] -- 0:01:44

      Average standard deviation of split frequencies: 0.006070

      310500 -- (-2943.748) (-2946.033) (-2937.527) [-2937.613] * [-2939.592] (-2943.189) (-2936.714) (-2937.993) -- 0:01:44
      311000 -- [-2943.671] (-2943.942) (-2942.000) (-2939.907) * (-2936.837) (-2939.988) (-2938.054) [-2937.631] -- 0:01:44
      311500 -- (-2944.426) (-2951.592) (-2946.035) [-2942.678] * (-2941.166) (-2947.187) (-2941.896) [-2939.251] -- 0:01:43
      312000 -- (-2940.361) (-2937.905) (-2939.779) [-2942.775] * (-2945.072) (-2942.009) (-2943.722) [-2942.350] -- 0:01:45
      312500 -- (-2949.699) (-2939.584) [-2943.005] (-2942.225) * (-2944.351) [-2938.387] (-2939.664) (-2937.641) -- 0:01:45
      313000 -- (-2946.737) (-2946.687) (-2943.445) [-2939.861] * (-2943.634) [-2940.484] (-2938.990) (-2938.022) -- 0:01:45
      313500 -- (-2943.167) (-2939.704) (-2949.595) [-2940.840] * (-2939.249) [-2935.445] (-2940.882) (-2936.017) -- 0:01:45
      314000 -- [-2945.183] (-2936.999) (-2945.881) (-2937.512) * (-2948.311) (-2936.601) [-2942.319] (-2941.862) -- 0:01:44
      314500 -- (-2956.535) [-2943.327] (-2943.073) (-2939.073) * [-2939.873] (-2943.641) (-2940.279) (-2937.143) -- 0:01:44
      315000 -- [-2942.758] (-2940.714) (-2945.739) (-2937.579) * (-2938.883) (-2944.238) [-2942.178] (-2933.960) -- 0:01:44

      Average standard deviation of split frequencies: 0.007459

      315500 -- (-2940.432) (-2939.314) (-2944.243) [-2937.285] * (-2950.855) (-2946.069) (-2939.795) [-2938.811] -- 0:01:44
      316000 -- (-2949.105) (-2943.471) (-2940.428) [-2942.786] * (-2941.903) (-2951.592) (-2942.621) [-2938.275] -- 0:01:43
      316500 -- [-2938.616] (-2937.593) (-2935.136) (-2938.871) * [-2940.029] (-2943.993) (-2936.446) (-2945.464) -- 0:01:43
      317000 -- (-2944.786) [-2937.005] (-2941.853) (-2938.038) * (-2946.456) [-2944.094] (-2936.907) (-2943.711) -- 0:01:43
      317500 -- (-2939.174) (-2941.035) (-2935.899) [-2940.487] * (-2941.156) (-2945.304) (-2939.330) [-2940.107] -- 0:01:43
      318000 -- [-2938.319] (-2936.715) (-2940.568) (-2939.910) * (-2940.777) (-2942.556) [-2941.151] (-2940.809) -- 0:01:42
      318500 -- (-2942.122) (-2938.660) [-2937.412] (-2936.396) * (-2935.304) (-2943.344) (-2940.687) [-2940.444] -- 0:01:44
      319000 -- (-2946.984) (-2936.409) [-2942.524] (-2947.089) * (-2933.171) [-2947.182] (-2940.294) (-2933.360) -- 0:01:44
      319500 -- (-2937.972) (-2934.398) [-2942.252] (-2937.721) * (-2938.451) [-2944.685] (-2940.499) (-2939.409) -- 0:01:44
      320000 -- (-2940.822) [-2934.537] (-2945.746) (-2938.320) * [-2937.587] (-2946.629) (-2943.288) (-2940.891) -- 0:01:44

      Average standard deviation of split frequencies: 0.004410

      320500 -- (-2941.637) [-2937.646] (-2944.572) (-2946.587) * (-2939.148) (-2937.402) (-2940.486) [-2936.890] -- 0:01:43
      321000 -- (-2937.572) [-2941.148] (-2943.823) (-2942.574) * (-2944.765) (-2940.019) [-2934.086] (-2942.046) -- 0:01:43
      321500 -- (-2938.972) (-2935.141) [-2938.978] (-2938.155) * (-2940.531) [-2941.679] (-2942.657) (-2937.082) -- 0:01:43
      322000 -- (-2933.873) [-2936.293] (-2942.230) (-2942.164) * (-2939.953) [-2943.542] (-2938.454) (-2936.575) -- 0:01:43
      322500 -- (-2943.857) (-2938.110) [-2935.620] (-2944.626) * (-2934.808) [-2944.402] (-2936.065) (-2939.175) -- 0:01:42
      323000 -- [-2937.750] (-2940.249) (-2941.940) (-2940.507) * (-2936.768) (-2944.427) (-2938.370) [-2939.236] -- 0:01:42
      323500 -- (-2939.839) [-2940.333] (-2932.727) (-2943.361) * [-2934.058] (-2945.742) (-2943.677) (-2934.027) -- 0:01:42
      324000 -- [-2941.697] (-2940.053) (-2953.346) (-2945.442) * (-2940.095) (-2943.394) (-2935.123) [-2937.610] -- 0:01:42
      324500 -- (-2937.110) (-2946.528) [-2934.415] (-2938.057) * [-2938.477] (-2945.004) (-2934.282) (-2936.021) -- 0:01:42
      325000 -- (-2936.917) (-2936.789) [-2942.170] (-2941.091) * [-2944.037] (-2939.482) (-2943.428) (-2938.018) -- 0:01:43

      Average standard deviation of split frequencies: 0.004338

      325500 -- (-2940.724) (-2940.822) (-2946.316) [-2938.952] * (-2939.561) (-2938.214) (-2935.420) [-2934.023] -- 0:01:43
      326000 -- (-2947.354) [-2938.691] (-2946.529) (-2934.783) * (-2941.488) (-2936.590) [-2939.247] (-2941.255) -- 0:01:43
      326500 -- (-2937.867) (-2940.609) (-2944.314) [-2934.434] * [-2944.343] (-2939.797) (-2940.903) (-2939.910) -- 0:01:43
      327000 -- (-2939.254) (-2941.752) [-2937.576] (-2944.119) * (-2939.919) (-2943.432) (-2941.113) [-2938.201] -- 0:01:42
      327500 -- (-2937.923) [-2939.350] (-2947.126) (-2941.192) * (-2940.658) (-2942.769) [-2938.007] (-2941.660) -- 0:01:42
      328000 -- (-2935.643) [-2943.203] (-2944.631) (-2944.391) * (-2937.150) (-2948.621) [-2938.979] (-2940.836) -- 0:01:42
      328500 -- (-2940.897) [-2938.630] (-2942.705) (-2945.409) * (-2941.718) [-2939.949] (-2941.346) (-2937.358) -- 0:01:42
      329000 -- (-2938.558) (-2935.926) [-2940.496] (-2936.464) * (-2937.608) (-2940.249) [-2935.556] (-2940.951) -- 0:01:41
      329500 -- (-2941.090) (-2937.934) [-2940.793] (-2944.325) * [-2942.506] (-2941.112) (-2942.715) (-2941.790) -- 0:01:41
      330000 -- [-2937.464] (-2936.981) (-2943.993) (-2934.859) * (-2938.490) (-2937.072) (-2939.797) [-2944.807] -- 0:01:41

      Average standard deviation of split frequencies: 0.005702

      330500 -- (-2937.250) (-2954.539) (-2937.403) [-2946.607] * (-2934.733) (-2936.708) (-2950.940) [-2939.367] -- 0:01:41
      331000 -- (-2942.332) (-2945.268) (-2946.705) [-2936.719] * (-2935.376) (-2936.424) (-2940.665) [-2938.782] -- 0:01:41
      331500 -- (-2942.896) [-2936.393] (-2941.884) (-2936.771) * [-2937.205] (-2945.942) (-2939.332) (-2935.119) -- 0:01:42
      332000 -- [-2937.466] (-2939.959) (-2940.546) (-2941.411) * (-2938.263) (-2941.566) [-2936.259] (-2930.473) -- 0:01:42
      332500 -- [-2941.417] (-2940.699) (-2945.070) (-2939.924) * (-2947.726) (-2944.515) (-2940.894) [-2932.656] -- 0:01:42
      333000 -- (-2939.368) (-2934.456) [-2946.707] (-2934.137) * (-2938.754) [-2938.018] (-2940.794) (-2938.577) -- 0:01:42
      333500 -- (-2942.651) (-2941.708) (-2938.641) [-2937.529] * (-2941.269) (-2942.486) [-2941.872] (-2940.612) -- 0:01:41
      334000 -- (-2948.409) (-2934.615) [-2940.269] (-2937.198) * [-2940.407] (-2940.036) (-2941.677) (-2937.407) -- 0:01:41
      334500 -- (-2940.991) (-2940.043) (-2938.001) [-2939.822] * (-2942.397) (-2940.240) [-2938.835] (-2939.770) -- 0:01:41
      335000 -- [-2942.026] (-2939.299) (-2939.301) (-2935.105) * (-2937.961) (-2943.856) (-2938.807) [-2936.979] -- 0:01:41

      Average standard deviation of split frequencies: 0.007015

      335500 -- [-2944.261] (-2936.603) (-2948.824) (-2939.008) * (-2948.279) (-2940.461) (-2937.019) [-2939.687] -- 0:01:41
      336000 -- (-2938.523) [-2941.406] (-2936.184) (-2940.258) * (-2940.508) (-2946.136) [-2942.306] (-2938.403) -- 0:01:40
      336500 -- (-2945.000) (-2938.517) [-2937.347] (-2939.834) * [-2936.698] (-2941.456) (-2938.975) (-2935.042) -- 0:01:40
      337000 -- (-2940.349) [-2942.887] (-2940.459) (-2940.295) * (-2947.002) (-2940.682) (-2938.700) [-2937.577] -- 0:01:40
      337500 -- (-2937.730) (-2934.399) [-2941.610] (-2943.355) * (-2943.855) (-2938.399) (-2939.156) [-2936.275] -- 0:01:40
      338000 -- (-2939.663) [-2935.312] (-2941.581) (-2941.467) * (-2941.424) (-2937.910) (-2941.330) [-2936.313] -- 0:01:41
      338500 -- (-2943.792) (-2939.258) (-2936.911) [-2938.905] * (-2937.899) (-2941.346) (-2947.324) [-2938.927] -- 0:01:41
      339000 -- [-2935.919] (-2941.124) (-2936.502) (-2941.318) * [-2939.223] (-2937.656) (-2945.226) (-2940.016) -- 0:01:41
      339500 -- (-2935.659) (-2938.585) [-2937.037] (-2941.592) * (-2937.321) (-2934.178) (-2946.988) [-2941.309] -- 0:01:41
      340000 -- (-2935.884) (-2934.645) [-2946.933] (-2935.988) * (-2937.067) (-2935.511) (-2941.808) [-2941.884] -- 0:01:40

      Average standard deviation of split frequencies: 0.005535

      340500 -- (-2937.809) (-2935.919) (-2942.625) [-2933.466] * (-2938.051) (-2936.650) [-2950.819] (-2939.463) -- 0:01:40
      341000 -- (-2938.243) (-2934.484) (-2936.569) [-2937.572] * (-2942.260) (-2942.765) (-2938.885) [-2935.791] -- 0:01:40
      341500 -- [-2936.887] (-2936.061) (-2937.245) (-2936.197) * (-2948.955) [-2945.409] (-2943.457) (-2943.167) -- 0:01:40
      342000 -- (-2939.806) (-2953.664) [-2945.199] (-2942.489) * (-2943.488) (-2941.902) (-2942.214) [-2937.738] -- 0:01:40
      342500 -- [-2938.397] (-2944.511) (-2941.497) (-2941.170) * (-2942.275) (-2949.698) [-2942.890] (-2936.264) -- 0:01:39
      343000 -- [-2938.436] (-2941.103) (-2945.101) (-2942.609) * (-2940.755) (-2947.497) [-2942.694] (-2942.752) -- 0:01:39
      343500 -- [-2938.603] (-2937.877) (-2945.293) (-2935.763) * (-2935.025) (-2943.669) (-2940.423) [-2946.047] -- 0:01:39
      344000 -- (-2939.665) [-2937.506] (-2937.417) (-2941.116) * (-2943.227) (-2946.866) [-2942.562] (-2947.816) -- 0:01:39
      344500 -- [-2936.621] (-2946.065) (-2937.051) (-2940.566) * [-2938.725] (-2942.829) (-2946.128) (-2942.814) -- 0:01:40
      345000 -- [-2940.336] (-2939.787) (-2940.771) (-2941.931) * (-2940.616) (-2935.574) (-2937.484) [-2945.933] -- 0:01:40

      Average standard deviation of split frequencies: 0.005450

      345500 -- (-2941.461) [-2942.900] (-2941.294) (-2937.479) * (-2938.369) [-2939.922] (-2935.767) (-2946.149) -- 0:01:40
      346000 -- (-2937.965) (-2941.094) (-2943.689) [-2937.468] * (-2942.059) (-2941.431) (-2936.972) [-2940.456] -- 0:01:40
      346500 -- [-2938.623] (-2936.926) (-2939.861) (-2942.558) * (-2938.780) [-2941.365] (-2941.172) (-2943.236) -- 0:01:39
      347000 -- (-2937.951) (-2937.988) (-2942.978) [-2934.487] * (-2938.077) [-2937.625] (-2944.629) (-2941.599) -- 0:01:39
      347500 -- [-2940.130] (-2936.905) (-2938.362) (-2937.521) * (-2937.556) [-2937.143] (-2945.599) (-2942.194) -- 0:01:39
      348000 -- (-2938.441) (-2939.322) [-2936.821] (-2935.064) * (-2943.281) [-2942.357] (-2940.812) (-2948.593) -- 0:01:39
      348500 -- (-2940.067) [-2945.293] (-2935.624) (-2940.301) * (-2944.394) [-2938.360] (-2942.977) (-2946.739) -- 0:01:39
      349000 -- (-2936.614) (-2942.057) [-2938.698] (-2942.098) * [-2938.756] (-2944.148) (-2937.780) (-2943.483) -- 0:01:38
      349500 -- [-2936.139] (-2938.992) (-2942.268) (-2943.109) * (-2936.578) (-2944.155) [-2939.739] (-2946.254) -- 0:01:38
      350000 -- (-2944.219) [-2940.383] (-2937.390) (-2938.350) * (-2936.798) (-2939.143) [-2936.793] (-2939.264) -- 0:01:38

      Average standard deviation of split frequencies: 0.005377

      350500 -- [-2941.173] (-2944.119) (-2935.792) (-2945.197) * (-2939.379) [-2934.766] (-2940.796) (-2942.197) -- 0:01:38
      351000 -- (-2937.174) (-2945.603) (-2938.199) [-2941.073] * (-2938.577) (-2945.770) (-2941.978) [-2942.558] -- 0:01:39
      351500 -- (-2941.273) (-2940.903) (-2937.491) [-2938.198] * [-2936.271] (-2941.259) (-2939.742) (-2941.660) -- 0:01:39
      352000 -- [-2941.133] (-2942.362) (-2946.315) (-2936.871) * (-2938.847) [-2939.174] (-2939.150) (-2935.365) -- 0:01:39
      352500 -- (-2944.936) (-2933.276) (-2943.415) [-2941.359] * (-2938.956) (-2947.280) (-2942.140) [-2943.857] -- 0:01:39
      353000 -- (-2944.338) [-2943.556] (-2942.832) (-2938.115) * (-2941.984) [-2935.581] (-2942.923) (-2948.403) -- 0:01:38
      353500 -- (-2940.388) [-2934.377] (-2937.843) (-2936.542) * (-2937.703) [-2942.409] (-2943.403) (-2949.487) -- 0:01:38
      354000 -- (-2949.358) [-2936.190] (-2942.010) (-2936.421) * (-2943.672) (-2943.657) (-2945.257) [-2939.531] -- 0:01:38
      354500 -- (-2944.737) [-2938.395] (-2938.991) (-2937.311) * (-2940.614) (-2945.222) [-2943.598] (-2941.539) -- 0:01:38
      355000 -- (-2936.890) (-2943.463) (-2937.540) [-2942.198] * (-2941.652) [-2940.082] (-2946.485) (-2946.670) -- 0:01:38

      Average standard deviation of split frequencies: 0.005297

      355500 -- [-2935.250] (-2947.678) (-2940.972) (-2936.206) * (-2942.199) [-2933.345] (-2938.049) (-2942.650) -- 0:01:37
      356000 -- (-2934.593) [-2942.645] (-2942.396) (-2940.446) * (-2934.874) [-2939.067] (-2934.698) (-2947.119) -- 0:01:37
      356500 -- (-2937.689) (-2942.424) [-2941.046] (-2938.756) * (-2946.556) (-2942.990) [-2937.693] (-2948.018) -- 0:01:37
      357000 -- (-2933.605) (-2946.079) [-2933.992] (-2937.595) * (-2941.135) [-2936.312] (-2937.953) (-2938.320) -- 0:01:37
      357500 -- (-2935.102) (-2941.134) [-2939.970] (-2942.938) * (-2944.144) [-2934.465] (-2934.645) (-2937.101) -- 0:01:38
      358000 -- (-2938.328) [-2938.204] (-2943.347) (-2938.852) * (-2945.470) [-2939.501] (-2944.956) (-2943.625) -- 0:01:38
      358500 -- (-2947.196) [-2933.215] (-2937.354) (-2939.490) * (-2938.503) [-2940.613] (-2938.367) (-2942.290) -- 0:01:38
      359000 -- [-2940.685] (-2953.512) (-2945.040) (-2936.116) * [-2933.658] (-2934.123) (-2939.487) (-2940.157) -- 0:01:38
      359500 -- (-2937.473) (-2940.157) (-2941.042) [-2937.591] * (-2936.636) [-2938.816] (-2937.243) (-2938.101) -- 0:01:37
      360000 -- (-2942.251) (-2943.202) [-2945.068] (-2940.785) * (-2939.922) [-2938.179] (-2936.846) (-2935.413) -- 0:01:37

      Average standard deviation of split frequencies: 0.006535

      360500 -- (-2939.122) (-2936.678) [-2937.350] (-2947.912) * [-2936.212] (-2953.085) (-2941.786) (-2935.239) -- 0:01:37
      361000 -- (-2935.401) (-2936.438) (-2941.574) [-2941.270] * (-2940.328) (-2941.465) (-2940.371) [-2934.909] -- 0:01:37
      361500 -- (-2942.318) [-2938.100] (-2942.184) (-2941.621) * [-2939.051] (-2946.615) (-2939.336) (-2937.610) -- 0:01:37
      362000 -- (-2932.402) [-2937.856] (-2943.585) (-2945.895) * [-2938.038] (-2951.411) (-2938.192) (-2938.791) -- 0:01:36
      362500 -- [-2937.014] (-2940.272) (-2938.865) (-2942.049) * (-2937.267) (-2943.487) [-2935.504] (-2940.065) -- 0:01:36
      363000 -- (-2938.483) (-2938.195) [-2940.524] (-2941.080) * (-2941.020) (-2938.636) [-2939.676] (-2939.408) -- 0:01:36
      363500 -- [-2939.707] (-2947.902) (-2942.533) (-2936.279) * [-2936.271] (-2937.809) (-2938.334) (-2940.183) -- 0:01:36
      364000 -- [-2942.471] (-2944.332) (-2945.031) (-2935.321) * (-2943.689) [-2938.581] (-2942.836) (-2942.769) -- 0:01:37
      364500 -- (-2934.209) (-2945.782) [-2944.025] (-2941.851) * [-2936.566] (-2938.171) (-2939.779) (-2941.851) -- 0:01:37
      365000 -- (-2947.339) [-2937.348] (-2938.576) (-2936.225) * [-2936.872] (-2941.045) (-2936.481) (-2938.279) -- 0:01:37

      Average standard deviation of split frequencies: 0.005152

      365500 -- (-2938.966) (-2943.811) (-2942.697) [-2940.958] * (-2949.143) (-2942.962) [-2934.425] (-2939.074) -- 0:01:37
      366000 -- (-2941.485) [-2938.739] (-2938.176) (-2946.391) * (-2941.445) (-2941.308) [-2938.234] (-2937.552) -- 0:01:37
      366500 -- (-2948.757) [-2939.364] (-2937.874) (-2941.119) * [-2943.758] (-2938.452) (-2942.453) (-2945.646) -- 0:01:36
      367000 -- [-2937.608] (-2939.856) (-2941.378) (-2941.426) * (-2945.149) (-2942.975) (-2935.195) [-2937.428] -- 0:01:36
      367500 -- (-2937.330) (-2943.259) [-2939.253] (-2937.415) * (-2939.755) (-2938.923) [-2940.693] (-2940.674) -- 0:01:36
      368000 -- [-2938.964] (-2936.388) (-2948.179) (-2938.103) * (-2936.814) (-2948.434) (-2949.020) [-2938.555] -- 0:01:36
      368500 -- [-2938.303] (-2938.888) (-2940.395) (-2936.733) * (-2946.699) [-2942.586] (-2939.762) (-2940.067) -- 0:01:35
      369000 -- (-2940.187) (-2938.301) [-2938.570] (-2939.800) * (-2936.486) [-2938.531] (-2945.927) (-2942.153) -- 0:01:35
      369500 -- (-2940.353) [-2939.690] (-2939.650) (-2939.619) * (-2935.744) (-2942.510) (-2947.657) [-2940.893] -- 0:01:35
      370000 -- (-2947.628) [-2933.453] (-2944.145) (-2939.335) * (-2934.725) (-2937.073) (-2947.846) [-2940.859] -- 0:01:35

      Average standard deviation of split frequencies: 0.005087

      370500 -- (-2944.771) [-2934.742] (-2939.191) (-2940.796) * [-2939.605] (-2938.292) (-2943.030) (-2942.045) -- 0:01:36
      371000 -- [-2935.106] (-2940.585) (-2952.642) (-2945.671) * (-2947.081) [-2943.849] (-2941.427) (-2939.645) -- 0:01:36
      371500 -- [-2943.843] (-2938.592) (-2940.361) (-2949.379) * (-2937.814) [-2943.317] (-2936.460) (-2941.478) -- 0:01:36
      372000 -- [-2938.915] (-2944.601) (-2938.613) (-2941.523) * (-2940.780) (-2940.371) (-2943.260) [-2939.250] -- 0:01:36
      372500 -- [-2938.614] (-2941.270) (-2939.972) (-2941.168) * (-2948.232) [-2943.110] (-2941.600) (-2942.015) -- 0:01:36
      373000 -- (-2936.273) (-2945.549) [-2937.611] (-2934.652) * (-2940.431) (-2936.102) [-2935.373] (-2937.041) -- 0:01:35
      373500 -- (-2940.242) [-2939.640] (-2941.470) (-2939.341) * (-2940.996) (-2944.664) (-2940.467) [-2941.761] -- 0:01:35
      374000 -- (-2941.526) (-2941.915) [-2938.694] (-2934.868) * (-2936.280) (-2938.944) [-2939.033] (-2938.519) -- 0:01:35
      374500 -- (-2948.521) (-2936.473) (-2934.316) [-2946.192] * [-2940.770] (-2934.734) (-2937.811) (-2938.421) -- 0:01:35
      375000 -- (-2949.911) (-2938.681) [-2941.222] (-2942.089) * (-2943.482) (-2938.285) (-2937.724) [-2938.930] -- 0:01:35

      Average standard deviation of split frequencies: 0.005015

      375500 -- (-2938.314) [-2942.500] (-2935.035) (-2941.571) * [-2938.884] (-2943.335) (-2949.420) (-2943.667) -- 0:01:34
      376000 -- (-2941.751) [-2940.155] (-2936.207) (-2937.011) * (-2941.971) [-2943.034] (-2939.969) (-2938.389) -- 0:01:34
      376500 -- (-2939.786) [-2939.704] (-2938.794) (-2936.274) * (-2941.587) (-2944.135) [-2941.322] (-2938.618) -- 0:01:34
      377000 -- (-2940.321) (-2943.502) [-2935.438] (-2944.508) * (-2945.893) (-2940.186) [-2937.554] (-2945.522) -- 0:01:35
      377500 -- (-2943.663) [-2938.352] (-2936.680) (-2941.810) * (-2943.683) [-2934.971] (-2940.729) (-2947.350) -- 0:01:35
      378000 -- (-2944.424) [-2938.129] (-2943.473) (-2944.701) * (-2937.977) [-2945.651] (-2939.345) (-2939.489) -- 0:01:35
      378500 -- (-2936.574) (-2940.340) [-2940.788] (-2938.098) * (-2942.452) (-2940.292) [-2938.342] (-2937.634) -- 0:01:35
      379000 -- (-2938.055) (-2936.874) [-2940.152] (-2942.270) * (-2939.479) (-2941.356) (-2937.397) [-2940.035] -- 0:01:35
      379500 -- (-2940.476) (-2939.282) (-2936.943) [-2937.299] * (-2945.070) (-2937.275) [-2939.697] (-2942.594) -- 0:01:34
      380000 -- (-2936.812) (-2943.163) (-2941.385) [-2939.209] * (-2938.894) (-2935.026) (-2939.153) [-2936.435] -- 0:01:34

      Average standard deviation of split frequencies: 0.004953

      380500 -- (-2942.096) (-2941.231) [-2936.507] (-2947.574) * (-2935.164) (-2938.862) (-2944.625) [-2944.447] -- 0:01:34
      381000 -- [-2943.443] (-2939.724) (-2945.891) (-2942.872) * [-2938.612] (-2939.470) (-2943.224) (-2936.707) -- 0:01:34
      381500 -- (-2940.319) [-2938.697] (-2935.530) (-2942.230) * [-2931.638] (-2936.504) (-2942.559) (-2945.787) -- 0:01:34
      382000 -- (-2935.305) (-2939.300) (-2945.952) [-2937.101] * [-2934.125] (-2945.512) (-2937.390) (-2938.412) -- 0:01:33
      382500 -- (-2938.262) [-2943.843] (-2941.417) (-2940.920) * [-2936.991] (-2939.367) (-2949.009) (-2938.051) -- 0:01:33
      383000 -- (-2941.997) [-2940.417] (-2945.361) (-2941.494) * [-2947.035] (-2937.902) (-2943.492) (-2940.334) -- 0:01:33
      383500 -- (-2937.539) (-2947.075) (-2942.835) [-2938.243] * (-2947.060) [-2940.317] (-2937.880) (-2943.046) -- 0:01:34
      384000 -- (-2941.282) [-2937.257] (-2945.703) (-2939.019) * (-2945.721) (-2951.184) [-2940.343] (-2939.182) -- 0:01:34
      384500 -- (-2943.631) (-2938.893) [-2935.037] (-2939.865) * (-2940.828) (-2943.905) [-2936.023] (-2940.287) -- 0:01:34
      385000 -- (-2948.665) [-2936.375] (-2947.916) (-2939.256) * (-2941.374) (-2945.889) (-2938.832) [-2943.971] -- 0:01:34

      Average standard deviation of split frequencies: 0.003664

      385500 -- [-2935.955] (-2940.544) (-2945.129) (-2936.666) * (-2945.319) (-2945.651) [-2938.697] (-2943.825) -- 0:01:34
      386000 -- (-2943.993) [-2936.817] (-2939.915) (-2942.966) * [-2942.622] (-2940.760) (-2944.571) (-2943.155) -- 0:01:33
      386500 -- (-2940.915) [-2936.848] (-2947.718) (-2939.460) * (-2940.493) (-2939.880) [-2938.710] (-2951.108) -- 0:01:33
      387000 -- [-2938.663] (-2940.806) (-2936.304) (-2940.835) * (-2947.190) (-2941.563) [-2936.518] (-2943.950) -- 0:01:33
      387500 -- (-2942.827) (-2943.139) (-2939.962) [-2937.165] * [-2933.693] (-2943.607) (-2940.674) (-2944.616) -- 0:01:33
      388000 -- (-2943.919) (-2939.337) (-2935.395) [-2938.122] * [-2940.974] (-2935.480) (-2944.814) (-2944.675) -- 0:01:33
      388500 -- (-2945.121) [-2940.192] (-2936.059) (-2937.171) * [-2942.845] (-2940.244) (-2935.525) (-2941.821) -- 0:01:32
      389000 -- (-2942.596) (-2939.721) [-2940.357] (-2937.075) * (-2937.143) [-2944.853] (-2940.162) (-2939.756) -- 0:01:32
      389500 -- (-2940.450) [-2938.723] (-2940.828) (-2942.384) * (-2940.723) (-2942.243) (-2946.667) [-2945.099] -- 0:01:32
      390000 -- [-2939.449] (-2940.444) (-2946.308) (-2941.278) * [-2940.934] (-2943.984) (-2938.587) (-2940.678) -- 0:01:33

      Average standard deviation of split frequencies: 0.003620

      390500 -- (-2941.985) (-2938.233) [-2937.515] (-2938.362) * (-2943.228) (-2939.958) [-2936.665] (-2935.573) -- 0:01:33
      391000 -- [-2938.288] (-2936.883) (-2935.597) (-2944.788) * (-2947.495) (-2940.913) [-2937.272] (-2936.298) -- 0:01:33
      391500 -- (-2940.401) (-2937.669) [-2939.512] (-2937.619) * (-2949.375) [-2935.031] (-2946.551) (-2946.334) -- 0:01:33
      392000 -- (-2939.251) (-2940.844) [-2939.717] (-2939.652) * (-2944.645) [-2937.166] (-2947.601) (-2936.162) -- 0:01:33
      392500 -- (-2939.880) (-2937.680) (-2943.398) [-2945.380] * (-2942.777) [-2945.579] (-2943.957) (-2936.012) -- 0:01:32
      393000 -- (-2942.409) (-2937.544) [-2936.850] (-2942.846) * [-2937.932] (-2945.844) (-2942.752) (-2935.975) -- 0:01:32
      393500 -- (-2937.950) [-2941.404] (-2935.903) (-2944.157) * [-2944.065] (-2941.284) (-2956.927) (-2941.435) -- 0:01:32
      394000 -- [-2937.806] (-2947.574) (-2941.807) (-2940.512) * (-2936.078) (-2941.210) (-2943.100) [-2938.603] -- 0:01:32
      394500 -- [-2935.542] (-2933.524) (-2936.499) (-2946.783) * (-2940.621) (-2939.435) (-2942.254) [-2938.143] -- 0:01:32
      395000 -- (-2941.163) [-2935.050] (-2942.590) (-2943.746) * (-2941.718) (-2937.576) [-2936.772] (-2938.777) -- 0:01:31

      Average standard deviation of split frequencies: 0.002381

      395500 -- (-2947.270) (-2936.466) [-2936.853] (-2943.280) * (-2947.463) (-2944.402) [-2936.573] (-2936.243) -- 0:01:31
      396000 -- [-2944.169] (-2935.855) (-2938.112) (-2935.158) * (-2939.099) (-2938.756) [-2940.019] (-2948.732) -- 0:01:31
      396500 -- (-2937.301) (-2940.898) [-2938.290] (-2948.046) * (-2934.260) (-2947.249) (-2939.668) [-2937.774] -- 0:01:32
      397000 -- (-2935.609) (-2937.294) [-2945.367] (-2940.956) * (-2942.969) (-2936.339) (-2939.472) [-2945.254] -- 0:01:32
      397500 -- (-2938.129) (-2943.548) (-2943.909) [-2945.066] * (-2942.971) (-2938.180) [-2941.961] (-2946.486) -- 0:01:32
      398000 -- (-2937.051) [-2940.448] (-2938.842) (-2948.180) * (-2945.929) (-2938.195) (-2941.266) [-2946.683] -- 0:01:32
      398500 -- (-2933.798) (-2940.189) (-2943.280) [-2936.278] * (-2935.264) [-2935.410] (-2940.851) (-2947.880) -- 0:01:32
      399000 -- (-2946.319) (-2937.004) (-2950.984) [-2933.798] * (-2935.990) (-2940.026) (-2938.367) [-2945.551] -- 0:01:31
      399500 -- (-2941.170) [-2937.917] (-2940.783) (-2936.850) * (-2942.951) [-2935.946] (-2946.947) (-2936.843) -- 0:01:31
      400000 -- (-2934.862) (-2944.640) (-2942.427) [-2944.185] * (-2939.508) [-2944.440] (-2939.905) (-2939.803) -- 0:01:31

      Average standard deviation of split frequencies: 0.002353

      400500 -- (-2938.284) (-2940.904) (-2935.671) [-2944.757] * [-2943.658] (-2942.165) (-2934.853) (-2939.881) -- 0:01:31
      401000 -- (-2940.657) [-2940.020] (-2939.904) (-2940.143) * (-2942.715) [-2935.950] (-2942.699) (-2943.170) -- 0:01:31
      401500 -- (-2942.899) (-2944.759) [-2938.131] (-2938.316) * (-2932.544) (-2935.178) (-2942.766) [-2941.516] -- 0:01:30
      402000 -- (-2944.772) (-2935.354) [-2937.824] (-2945.910) * (-2936.762) (-2942.630) [-2934.759] (-2936.408) -- 0:01:30
      402500 -- (-2934.728) (-2938.261) [-2937.158] (-2944.203) * (-2940.275) [-2935.148] (-2935.709) (-2936.032) -- 0:01:30
      403000 -- [-2939.015] (-2936.930) (-2939.624) (-2950.395) * (-2940.560) [-2935.043] (-2938.745) (-2937.660) -- 0:01:31
      403500 -- [-2939.354] (-2940.262) (-2939.574) (-2937.840) * (-2934.826) (-2941.859) (-2941.186) [-2939.110] -- 0:01:31
      404000 -- (-2943.996) (-2941.110) (-2935.825) [-2937.536] * (-2938.794) (-2938.065) (-2943.143) [-2942.933] -- 0:01:31
      404500 -- (-2939.023) (-2942.628) [-2946.741] (-2937.088) * [-2934.816] (-2938.776) (-2945.428) (-2941.164) -- 0:01:31
      405000 -- (-2940.927) [-2941.729] (-2942.620) (-2940.790) * [-2939.794] (-2944.645) (-2941.041) (-2940.424) -- 0:01:31

      Average standard deviation of split frequencies: 0.003483

      405500 -- [-2938.563] (-2938.738) (-2935.731) (-2945.095) * (-2937.802) (-2935.955) [-2938.992] (-2942.916) -- 0:01:30
      406000 -- (-2934.485) [-2936.669] (-2938.587) (-2939.187) * (-2940.331) [-2937.843] (-2938.771) (-2943.179) -- 0:01:30
      406500 -- [-2935.530] (-2941.820) (-2936.938) (-2942.618) * [-2940.131] (-2938.968) (-2945.868) (-2936.343) -- 0:01:30
      407000 -- (-2940.706) (-2938.333) [-2940.333] (-2940.411) * (-2939.368) (-2939.706) [-2942.401] (-2936.897) -- 0:01:30
      407500 -- [-2941.152] (-2938.928) (-2940.597) (-2939.956) * [-2939.787] (-2940.941) (-2942.547) (-2949.815) -- 0:01:30
      408000 -- [-2946.065] (-2940.299) (-2943.390) (-2946.924) * (-2936.584) (-2938.944) [-2936.345] (-2941.104) -- 0:01:29
      408500 -- [-2943.435] (-2939.760) (-2943.583) (-2940.927) * (-2945.702) (-2933.845) [-2938.682] (-2935.896) -- 0:01:29
      409000 -- (-2942.556) (-2939.025) [-2945.609] (-2939.174) * (-2942.715) (-2938.654) (-2933.467) [-2940.241] -- 0:01:29
      409500 -- (-2936.725) (-2938.564) (-2942.069) [-2934.391] * (-2941.439) (-2939.031) [-2939.171] (-2946.061) -- 0:01:30
      410000 -- (-2941.474) [-2939.734] (-2938.094) (-2937.237) * (-2941.170) (-2940.069) [-2939.608] (-2941.693) -- 0:01:30

      Average standard deviation of split frequencies: 0.003444

      410500 -- (-2945.467) (-2937.744) (-2935.962) [-2937.471] * (-2937.778) [-2936.774] (-2942.451) (-2946.372) -- 0:01:30
      411000 -- (-2938.313) (-2939.347) (-2938.459) [-2940.239] * (-2941.701) [-2940.973] (-2940.918) (-2941.599) -- 0:01:30
      411500 -- (-2940.263) [-2937.500] (-2938.607) (-2941.163) * [-2938.791] (-2941.085) (-2940.894) (-2939.211) -- 0:01:30
      412000 -- (-2937.267) [-2943.153] (-2949.664) (-2942.749) * (-2938.160) (-2937.155) (-2936.546) [-2940.670] -- 0:01:29
      412500 -- (-2936.688) (-2941.427) (-2941.148) [-2936.684] * (-2934.816) [-2935.738] (-2945.780) (-2943.145) -- 0:01:29
      413000 -- (-2942.554) (-2936.913) [-2941.206] (-2934.583) * [-2944.745] (-2935.267) (-2934.344) (-2938.695) -- 0:01:29
      413500 -- [-2934.779] (-2938.814) (-2939.930) (-2937.459) * (-2944.374) (-2943.538) (-2942.658) [-2946.880] -- 0:01:29
      414000 -- (-2939.424) (-2939.513) (-2943.340) [-2938.785] * (-2942.942) [-2933.903] (-2941.128) (-2948.969) -- 0:01:29
      414500 -- (-2940.676) [-2934.978] (-2940.825) (-2943.390) * (-2939.407) [-2936.531] (-2939.026) (-2939.683) -- 0:01:28
      415000 -- (-2949.391) [-2938.226] (-2940.888) (-2938.104) * (-2941.144) (-2938.834) (-2939.559) [-2941.038] -- 0:01:28

      Average standard deviation of split frequencies: 0.001133

      415500 -- (-2941.957) (-2938.416) [-2935.788] (-2944.525) * (-2943.635) (-2941.469) (-2949.630) [-2937.896] -- 0:01:28
      416000 -- (-2940.195) [-2941.148] (-2936.415) (-2942.049) * [-2941.086] (-2938.558) (-2944.230) (-2939.857) -- 0:01:29
      416500 -- (-2938.435) (-2943.840) [-2935.961] (-2934.697) * (-2941.523) [-2935.389] (-2938.257) (-2937.862) -- 0:01:29
      417000 -- (-2936.001) (-2940.411) [-2939.510] (-2941.816) * [-2942.323] (-2933.137) (-2940.453) (-2935.602) -- 0:01:29
      417500 -- (-2946.006) (-2939.840) (-2943.473) [-2941.040] * (-2943.718) [-2934.119] (-2945.614) (-2946.116) -- 0:01:29
      418000 -- (-2941.640) (-2944.014) (-2939.232) [-2935.552] * (-2938.782) [-2936.919] (-2934.797) (-2944.168) -- 0:01:29
      418500 -- [-2941.016] (-2938.509) (-2940.061) (-2946.818) * (-2940.945) (-2941.304) (-2935.492) [-2945.005] -- 0:01:28
      419000 -- (-2936.769) (-2937.171) [-2934.979] (-2941.862) * (-2938.229) [-2936.666] (-2944.559) (-2943.772) -- 0:01:28
      419500 -- (-2944.202) (-2939.287) (-2936.549) [-2937.047] * (-2939.714) (-2942.002) [-2938.437] (-2935.776) -- 0:01:28
      420000 -- [-2940.977] (-2938.486) (-2940.275) (-2942.295) * [-2937.974] (-2941.915) (-2937.563) (-2939.927) -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-2941.214) [-2936.972] (-2936.296) (-2944.443) * (-2946.868) [-2939.318] (-2934.823) (-2944.502) -- 0:01:28
      421000 -- (-2940.212) [-2938.773] (-2939.932) (-2947.395) * (-2936.539) (-2935.916) [-2939.716] (-2939.136) -- 0:01:28
      421500 -- (-2936.261) [-2941.258] (-2937.723) (-2941.723) * [-2942.697] (-2939.948) (-2937.897) (-2940.710) -- 0:01:27
      422000 -- (-2937.147) (-2938.364) [-2948.584] (-2945.244) * (-2939.839) (-2952.602) [-2940.924] (-2940.417) -- 0:01:27
      422500 -- (-2938.405) (-2937.626) (-2941.736) [-2945.283] * (-2949.292) (-2942.169) (-2939.879) [-2934.731] -- 0:01:28
      423000 -- [-2944.390] (-2940.590) (-2941.037) (-2943.652) * (-2945.465) (-2937.343) [-2944.445] (-2935.073) -- 0:01:28
      423500 -- (-2936.679) (-2938.906) (-2946.414) [-2938.775] * (-2939.003) (-2945.324) [-2947.411] (-2938.770) -- 0:01:28
      424000 -- (-2936.670) [-2938.545] (-2943.744) (-2936.210) * (-2941.274) [-2936.618] (-2945.473) (-2939.586) -- 0:01:28
      424500 -- [-2938.792] (-2940.294) (-2947.007) (-2942.432) * (-2941.575) [-2939.339] (-2944.663) (-2941.307) -- 0:01:28
      425000 -- (-2948.672) (-2935.839) (-2943.905) [-2938.238] * (-2949.771) [-2935.693] (-2943.484) (-2932.988) -- 0:01:27

      Average standard deviation of split frequencies: 0.001107

      425500 -- (-2946.151) [-2935.351] (-2939.359) (-2939.124) * (-2938.908) [-2939.039] (-2942.482) (-2942.045) -- 0:01:27
      426000 -- (-2940.718) (-2942.246) (-2939.518) [-2943.834] * (-2940.595) [-2937.640] (-2946.749) (-2944.311) -- 0:01:27
      426500 -- (-2943.794) (-2940.586) (-2940.076) [-2939.627] * (-2941.163) (-2936.901) [-2942.401] (-2940.189) -- 0:01:27
      427000 -- (-2940.181) [-2937.457] (-2941.104) (-2938.248) * (-2942.724) (-2935.134) [-2940.027] (-2939.952) -- 0:01:27
      427500 -- (-2945.630) (-2943.555) [-2940.261] (-2941.834) * [-2942.182] (-2938.493) (-2938.160) (-2939.533) -- 0:01:27
      428000 -- (-2942.171) (-2941.214) [-2940.745] (-2937.743) * (-2933.717) [-2939.426] (-2950.939) (-2939.268) -- 0:01:26
      428500 -- (-2937.591) (-2945.287) (-2942.562) [-2937.517] * (-2936.640) [-2937.985] (-2943.480) (-2934.525) -- 0:01:26
      429000 -- (-2943.014) (-2936.663) (-2941.451) [-2945.000] * (-2939.559) [-2940.110] (-2946.035) (-2942.605) -- 0:01:26
      429500 -- [-2933.935] (-2937.491) (-2946.006) (-2936.873) * [-2938.369] (-2943.152) (-2946.736) (-2934.839) -- 0:01:27
      430000 -- (-2934.966) (-2940.525) (-2945.951) [-2939.116] * [-2941.824] (-2951.281) (-2940.986) (-2939.555) -- 0:01:27

      Average standard deviation of split frequencies: 0.001095

      430500 -- (-2940.549) (-2938.662) [-2934.244] (-2938.170) * (-2939.221) [-2941.610] (-2939.022) (-2937.246) -- 0:01:27
      431000 -- [-2939.641] (-2938.974) (-2935.007) (-2938.604) * (-2940.449) (-2944.659) (-2937.512) [-2937.108] -- 0:01:27
      431500 -- (-2944.903) (-2936.806) [-2936.311] (-2935.089) * (-2947.538) (-2935.144) [-2945.090] (-2940.453) -- 0:01:26
      432000 -- (-2940.498) (-2933.652) (-2938.961) [-2938.589] * (-2940.022) (-2938.346) (-2934.922) [-2937.375] -- 0:01:26
      432500 -- (-2942.018) (-2937.267) (-2936.526) [-2941.606] * [-2940.679] (-2935.460) (-2934.917) (-2935.966) -- 0:01:26
      433000 -- (-2937.156) (-2946.632) (-2938.076) [-2940.829] * (-2942.253) [-2937.437] (-2937.652) (-2947.327) -- 0:01:26
      433500 -- (-2935.736) (-2943.164) [-2938.727] (-2937.627) * (-2935.853) [-2938.925] (-2936.675) (-2938.498) -- 0:01:26
      434000 -- (-2937.656) [-2939.413] (-2936.866) (-2940.521) * (-2940.508) (-2940.866) [-2937.811] (-2938.823) -- 0:01:26
      434500 -- (-2941.087) (-2941.975) [-2938.538] (-2941.523) * (-2938.806) (-2948.032) [-2935.801] (-2937.607) -- 0:01:25
      435000 -- (-2935.043) [-2938.882] (-2940.188) (-2939.831) * [-2945.464] (-2943.604) (-2935.644) (-2936.798) -- 0:01:25

      Average standard deviation of split frequencies: 0.001081

      435500 -- (-2944.354) (-2942.969) [-2939.599] (-2944.238) * (-2937.129) [-2938.064] (-2947.251) (-2936.849) -- 0:01:25
      436000 -- (-2937.140) (-2940.932) [-2938.992] (-2942.043) * (-2949.757) [-2939.651] (-2941.536) (-2944.483) -- 0:01:26
      436500 -- (-2939.502) (-2939.189) [-2936.919] (-2951.163) * (-2940.169) (-2937.954) (-2943.547) [-2938.199] -- 0:01:26
      437000 -- (-2938.799) (-2946.012) (-2934.608) [-2946.574] * (-2948.211) (-2940.944) [-2938.996] (-2934.397) -- 0:01:26
      437500 -- [-2942.559] (-2937.008) (-2942.851) (-2942.059) * (-2945.779) (-2947.593) [-2938.505] (-2940.463) -- 0:01:26
      438000 -- (-2936.213) [-2941.856] (-2944.485) (-2939.909) * [-2946.919] (-2940.793) (-2936.291) (-2943.050) -- 0:01:25
      438500 -- (-2938.832) [-2934.923] (-2945.831) (-2937.057) * (-2939.975) [-2936.282] (-2944.276) (-2938.746) -- 0:01:25
      439000 -- [-2934.886] (-2941.042) (-2941.291) (-2940.190) * (-2945.488) [-2937.917] (-2942.853) (-2934.938) -- 0:01:25
      439500 -- (-2943.235) [-2939.578] (-2941.456) (-2941.261) * [-2941.629] (-2946.290) (-2942.867) (-2936.507) -- 0:01:25
      440000 -- (-2939.248) (-2940.641) (-2939.145) [-2934.221] * [-2946.642] (-2946.078) (-2942.031) (-2938.224) -- 0:01:25

      Average standard deviation of split frequencies: 0.003209

      440500 -- (-2943.609) (-2944.243) (-2939.880) [-2938.468] * (-2943.126) (-2943.352) [-2936.595] (-2937.993) -- 0:01:25
      441000 -- (-2942.161) (-2941.625) [-2939.627] (-2939.416) * (-2950.548) (-2941.945) (-2941.170) [-2937.137] -- 0:01:24
      441500 -- (-2940.513) (-2942.440) [-2935.256] (-2935.973) * (-2941.308) (-2935.133) [-2938.561] (-2940.212) -- 0:01:24
      442000 -- (-2943.725) (-2939.400) (-2936.408) [-2935.039] * (-2939.760) (-2938.387) (-2935.583) [-2935.484] -- 0:01:24
      442500 -- (-2942.045) (-2938.425) [-2936.381] (-2940.963) * (-2935.805) [-2934.982] (-2946.251) (-2943.052) -- 0:01:25
      443000 -- (-2935.074) (-2940.746) (-2942.285) [-2941.359] * (-2943.639) (-2937.735) (-2938.313) [-2944.598] -- 0:01:25
      443500 -- [-2936.937] (-2943.288) (-2938.368) (-2936.824) * (-2944.223) (-2936.454) [-2938.274] (-2940.193) -- 0:01:25
      444000 -- (-2938.024) (-2941.394) [-2947.439] (-2939.643) * (-2944.415) (-2940.614) (-2943.915) [-2936.715] -- 0:01:25
      444500 -- [-2941.203] (-2940.482) (-2936.698) (-2950.611) * [-2948.002] (-2938.279) (-2939.248) (-2936.453) -- 0:01:24
      445000 -- (-2938.632) [-2936.871] (-2943.144) (-2942.583) * (-2941.960) [-2937.549] (-2938.520) (-2941.846) -- 0:01:24

      Average standard deviation of split frequencies: 0.004228

      445500 -- [-2934.766] (-2947.501) (-2940.952) (-2943.387) * (-2942.540) (-2939.326) [-2942.250] (-2937.436) -- 0:01:24
      446000 -- (-2937.600) [-2936.236] (-2949.238) (-2942.367) * (-2946.755) (-2937.773) (-2942.066) [-2941.703] -- 0:01:24
      446500 -- (-2935.615) (-2937.501) [-2937.833] (-2937.226) * (-2943.791) (-2944.076) (-2938.650) [-2937.142] -- 0:01:24
      447000 -- [-2939.522] (-2940.529) (-2940.172) (-2939.407) * (-2942.439) (-2940.209) (-2939.278) [-2941.349] -- 0:01:24
      447500 -- (-2934.244) (-2948.416) [-2944.151] (-2942.475) * (-2945.135) (-2938.154) (-2938.246) [-2935.277] -- 0:01:23
      448000 -- (-2941.041) (-2941.626) [-2938.153] (-2941.996) * (-2941.105) [-2940.512] (-2940.321) (-2938.751) -- 0:01:23
      448500 -- (-2938.781) (-2940.881) [-2941.761] (-2942.574) * (-2940.763) [-2939.675] (-2941.993) (-2937.568) -- 0:01:23
      449000 -- (-2935.779) (-2940.286) [-2938.263] (-2941.170) * [-2945.163] (-2939.550) (-2941.597) (-2940.698) -- 0:01:24
      449500 -- [-2938.085] (-2940.146) (-2936.917) (-2942.705) * (-2933.481) (-2938.406) (-2936.516) [-2938.786] -- 0:01:24
      450000 -- [-2933.595] (-2935.845) (-2938.977) (-2940.376) * [-2934.198] (-2940.803) (-2939.080) (-2936.018) -- 0:01:24

      Average standard deviation of split frequencies: 0.004184

      450500 -- [-2937.495] (-2939.528) (-2934.717) (-2944.355) * (-2942.226) (-2939.777) [-2936.743] (-2938.526) -- 0:01:24
      451000 -- (-2937.458) (-2941.573) [-2935.540] (-2935.234) * (-2946.471) (-2944.863) [-2942.986] (-2939.817) -- 0:01:23
      451500 -- (-2934.707) (-2938.003) [-2938.724] (-2937.611) * [-2935.797] (-2939.798) (-2944.886) (-2946.373) -- 0:01:23
      452000 -- (-2947.751) (-2934.417) [-2939.170] (-2937.892) * [-2938.529] (-2939.542) (-2940.778) (-2935.908) -- 0:01:23
      452500 -- (-2942.612) [-2948.172] (-2938.527) (-2942.847) * (-2939.756) (-2944.239) (-2937.909) [-2938.775] -- 0:01:23
      453000 -- [-2935.485] (-2938.054) (-2936.336) (-2946.843) * (-2939.766) [-2937.696] (-2941.079) (-2939.589) -- 0:01:23
      453500 -- (-2941.656) (-2942.121) (-2946.088) [-2938.393] * (-2937.324) (-2941.774) [-2939.339] (-2939.348) -- 0:01:23
      454000 -- (-2943.145) (-2938.090) [-2937.528] (-2942.736) * (-2938.181) [-2938.066] (-2936.322) (-2937.430) -- 0:01:22
      454500 -- (-2946.468) [-2938.596] (-2944.308) (-2941.659) * (-2939.799) (-2938.205) [-2934.574] (-2943.995) -- 0:01:22
      455000 -- (-2947.975) [-2934.231] (-2944.886) (-2940.628) * (-2937.767) (-2938.759) [-2937.846] (-2945.354) -- 0:01:22

      Average standard deviation of split frequencies: 0.003101

      455500 -- (-2952.737) (-2937.281) [-2943.777] (-2932.199) * (-2935.241) (-2938.881) [-2941.825] (-2936.614) -- 0:01:23
      456000 -- (-2936.539) (-2940.695) [-2939.401] (-2943.242) * (-2941.171) (-2946.787) (-2935.335) [-2934.078] -- 0:01:23
      456500 -- (-2932.823) [-2943.151] (-2937.807) (-2938.784) * (-2944.811) [-2936.758] (-2938.402) (-2938.387) -- 0:01:23
      457000 -- (-2936.716) (-2936.793) (-2939.271) [-2934.545] * (-2936.171) (-2940.190) [-2936.997] (-2945.266) -- 0:01:23
      457500 -- [-2933.565] (-2940.472) (-2935.666) (-2936.268) * (-2944.561) [-2940.790] (-2936.665) (-2940.359) -- 0:01:23
      458000 -- (-2944.505) [-2937.022] (-2945.613) (-2942.479) * [-2946.825] (-2936.783) (-2939.299) (-2937.446) -- 0:01:22
      458500 -- [-2934.184] (-2939.204) (-2938.037) (-2952.873) * (-2939.946) (-2941.985) [-2938.200] (-2940.676) -- 0:01:22
      459000 -- [-2935.740] (-2948.559) (-2938.323) (-2940.390) * (-2945.658) (-2942.847) (-2941.442) [-2938.072] -- 0:01:22
      459500 -- (-2939.778) (-2944.181) (-2939.864) [-2938.721] * (-2941.716) [-2943.551] (-2938.539) (-2941.258) -- 0:01:22
      460000 -- (-2946.867) [-2940.928] (-2941.765) (-2935.328) * (-2952.963) (-2942.925) (-2944.253) [-2934.732] -- 0:01:22

      Average standard deviation of split frequencies: 0.004093

      460500 -- (-2942.488) (-2939.861) (-2937.579) [-2937.080] * (-2945.165) (-2940.245) (-2944.103) [-2935.530] -- 0:01:22
      461000 -- (-2946.349) [-2938.814] (-2942.378) (-2941.644) * (-2935.740) [-2937.004] (-2941.669) (-2938.790) -- 0:01:21
      461500 -- (-2949.208) [-2938.314] (-2938.702) (-2940.542) * (-2937.168) (-2941.224) [-2935.879] (-2947.561) -- 0:01:21
      462000 -- (-2946.423) [-2937.742] (-2943.109) (-2943.222) * [-2939.138] (-2951.722) (-2936.783) (-2938.054) -- 0:01:22
      462500 -- (-2937.793) [-2939.174] (-2941.508) (-2939.079) * (-2945.468) (-2948.801) (-2938.379) [-2939.903] -- 0:01:22
      463000 -- (-2948.220) [-2941.472] (-2945.440) (-2941.818) * (-2941.632) (-2935.522) [-2938.359] (-2944.317) -- 0:01:22
      463500 -- (-2944.695) (-2935.543) (-2943.595) [-2940.791] * (-2939.492) (-2936.955) (-2937.746) [-2937.307] -- 0:01:22
      464000 -- (-2938.799) (-2940.587) (-2937.574) [-2937.571] * [-2936.193] (-2939.576) (-2936.908) (-2941.018) -- 0:01:22
      464500 -- (-2944.221) (-2943.577) (-2938.525) [-2940.470] * (-2939.646) (-2944.422) [-2938.897] (-2942.610) -- 0:01:21
      465000 -- [-2938.765] (-2940.428) (-2941.358) (-2950.394) * (-2935.171) [-2941.259] (-2934.605) (-2939.495) -- 0:01:21

      Average standard deviation of split frequencies: 0.004046

      465500 -- (-2939.617) [-2942.032] (-2935.807) (-2937.850) * [-2941.297] (-2937.143) (-2939.352) (-2935.713) -- 0:01:21
      466000 -- [-2940.450] (-2937.082) (-2937.856) (-2943.320) * (-2947.561) (-2939.514) [-2938.856] (-2938.930) -- 0:01:21
      466500 -- [-2941.760] (-2943.371) (-2944.313) (-2938.456) * (-2945.927) (-2941.603) [-2944.322] (-2940.597) -- 0:01:21
      467000 -- (-2943.287) [-2938.521] (-2938.290) (-2936.403) * (-2941.981) (-2939.891) (-2939.258) [-2940.871] -- 0:01:21
      467500 -- (-2943.350) (-2938.336) (-2940.486) [-2943.159] * (-2942.659) (-2936.549) (-2941.927) [-2943.779] -- 0:01:20
      468000 -- (-2954.374) (-2936.927) (-2941.335) [-2941.533] * [-2939.417] (-2938.380) (-2936.830) (-2940.493) -- 0:01:20
      468500 -- (-2945.018) (-2942.184) (-2939.139) [-2933.831] * (-2941.496) (-2938.737) (-2941.893) [-2935.278] -- 0:01:21
      469000 -- (-2943.781) (-2941.334) [-2937.287] (-2941.163) * (-2943.620) (-2948.492) (-2937.104) [-2939.036] -- 0:01:21
      469500 -- [-2936.565] (-2941.597) (-2934.909) (-2936.824) * [-2943.652] (-2936.094) (-2939.766) (-2943.506) -- 0:01:21
      470000 -- (-2941.731) (-2940.887) (-2947.384) [-2934.511] * [-2937.580] (-2936.234) (-2942.864) (-2941.270) -- 0:01:21

      Average standard deviation of split frequencies: 0.002003

      470500 -- (-2944.075) (-2951.375) (-2938.139) [-2940.378] * (-2940.998) [-2941.465] (-2937.783) (-2939.335) -- 0:01:21
      471000 -- (-2937.744) (-2940.574) (-2941.107) [-2938.849] * (-2945.976) [-2943.451] (-2943.982) (-2945.370) -- 0:01:20
      471500 -- (-2934.202) [-2939.617] (-2936.679) (-2940.235) * (-2944.671) [-2936.024] (-2940.253) (-2939.406) -- 0:01:20
      472000 -- [-2939.882] (-2945.306) (-2945.411) (-2941.689) * (-2939.637) (-2938.568) (-2948.894) [-2938.119] -- 0:01:20
      472500 -- (-2938.255) (-2944.688) (-2944.170) [-2941.007] * [-2943.563] (-2941.428) (-2941.552) (-2939.051) -- 0:01:20
      473000 -- (-2936.433) [-2940.088] (-2934.682) (-2945.185) * (-2945.406) [-2940.155] (-2941.095) (-2944.823) -- 0:01:20
      473500 -- [-2937.445] (-2939.046) (-2934.320) (-2943.045) * (-2949.777) [-2938.053] (-2944.483) (-2948.372) -- 0:01:20
      474000 -- (-2939.641) (-2942.292) (-2944.042) [-2934.168] * (-2937.240) [-2942.760] (-2946.529) (-2939.382) -- 0:01:19
      474500 -- [-2935.854] (-2938.723) (-2936.844) (-2937.202) * [-2934.681] (-2942.076) (-2950.616) (-2945.068) -- 0:01:19
      475000 -- (-2938.905) (-2938.547) [-2938.494] (-2937.358) * (-2938.147) (-2942.287) [-2944.350] (-2943.114) -- 0:01:20

      Average standard deviation of split frequencies: 0.001981

      475500 -- (-2938.526) [-2940.213] (-2938.662) (-2940.824) * (-2938.279) (-2939.599) (-2938.871) [-2940.059] -- 0:01:20
      476000 -- [-2939.967] (-2935.581) (-2937.920) (-2952.915) * [-2941.632] (-2941.088) (-2936.737) (-2941.520) -- 0:01:20
      476500 -- [-2937.377] (-2943.703) (-2940.491) (-2937.884) * [-2944.344] (-2936.817) (-2941.735) (-2945.246) -- 0:01:20
      477000 -- [-2934.417] (-2941.652) (-2939.981) (-2952.429) * (-2940.801) [-2944.820] (-2938.404) (-2941.981) -- 0:01:20
      477500 -- (-2941.053) [-2938.951] (-2938.507) (-2945.807) * [-2936.941] (-2945.722) (-2937.779) (-2937.917) -- 0:01:19
      478000 -- [-2935.284] (-2938.495) (-2936.019) (-2943.410) * (-2936.662) (-2946.700) (-2939.112) [-2935.617] -- 0:01:19
      478500 -- [-2940.040] (-2939.731) (-2939.089) (-2940.198) * (-2942.153) (-2946.510) (-2943.612) [-2937.055] -- 0:01:19
      479000 -- [-2938.312] (-2943.476) (-2939.902) (-2942.077) * (-2939.102) (-2938.045) (-2940.455) [-2939.016] -- 0:01:19
      479500 -- (-2941.808) (-2937.551) (-2946.283) [-2936.719] * (-2939.792) (-2938.818) [-2942.205] (-2939.531) -- 0:01:19
      480000 -- [-2942.813] (-2942.290) (-2939.680) (-2940.080) * (-2937.134) [-2941.627] (-2939.322) (-2950.416) -- 0:01:19

      Average standard deviation of split frequencies: 0.002942

      480500 -- (-2941.358) (-2940.261) (-2941.660) [-2935.444] * (-2935.039) (-2941.961) (-2934.154) [-2938.163] -- 0:01:18
      481000 -- [-2945.329] (-2943.926) (-2938.938) (-2941.919) * (-2943.764) (-2950.845) [-2936.418] (-2938.076) -- 0:01:18
      481500 -- [-2943.361] (-2940.214) (-2938.194) (-2940.513) * [-2943.845] (-2949.150) (-2938.950) (-2941.755) -- 0:01:19
      482000 -- (-2932.428) [-2941.728] (-2941.448) (-2936.941) * (-2933.576) (-2946.336) (-2932.616) [-2934.982] -- 0:01:19
      482500 -- (-2936.152) (-2946.184) (-2937.379) [-2940.961] * [-2935.788] (-2938.492) (-2939.453) (-2947.621) -- 0:01:19
      483000 -- (-2953.487) [-2940.186] (-2947.746) (-2944.633) * [-2937.586] (-2935.994) (-2943.469) (-2937.838) -- 0:01:19
      483500 -- [-2945.064] (-2939.901) (-2943.969) (-2935.736) * (-2941.015) (-2937.709) (-2942.106) [-2937.455] -- 0:01:19
      484000 -- (-2941.858) (-2947.239) (-2938.094) [-2938.396] * (-2944.955) [-2938.438] (-2946.130) (-2944.240) -- 0:01:18
      484500 -- [-2937.175] (-2941.558) (-2941.875) (-2936.018) * [-2937.950] (-2940.741) (-2950.555) (-2941.800) -- 0:01:18
      485000 -- (-2938.225) (-2942.907) (-2936.454) [-2935.312] * (-2939.645) (-2940.709) (-2944.601) [-2938.742] -- 0:01:18

      Average standard deviation of split frequencies: 0.002910

      485500 -- (-2939.138) (-2941.622) [-2938.273] (-2942.615) * (-2940.978) (-2943.440) [-2941.972] (-2934.850) -- 0:01:18
      486000 -- (-2936.248) [-2943.924] (-2939.481) (-2937.670) * (-2945.059) [-2937.020] (-2944.167) (-2936.160) -- 0:01:18
      486500 -- [-2946.372] (-2943.123) (-2937.374) (-2946.104) * (-2936.782) (-2936.852) (-2940.384) [-2936.020] -- 0:01:18
      487000 -- [-2933.103] (-2950.768) (-2941.091) (-2934.973) * (-2939.250) [-2938.021] (-2936.173) (-2938.601) -- 0:01:17
      487500 -- (-2939.480) (-2944.644) (-2942.562) [-2938.132] * (-2940.751) (-2938.906) [-2934.181] (-2940.718) -- 0:01:17
      488000 -- (-2936.014) [-2945.657] (-2937.044) (-2938.833) * (-2941.446) [-2938.266] (-2938.596) (-2943.561) -- 0:01:18
      488500 -- (-2939.680) (-2942.095) (-2938.507) [-2941.731] * (-2941.791) (-2944.968) (-2942.521) [-2939.753] -- 0:01:18
      489000 -- [-2937.835] (-2939.954) (-2940.504) (-2942.618) * (-2931.960) (-2944.476) [-2943.004] (-2941.864) -- 0:01:18
      489500 -- [-2938.367] (-2938.679) (-2935.485) (-2938.474) * [-2936.790] (-2941.013) (-2943.241) (-2941.260) -- 0:01:18
      490000 -- (-2935.949) [-2940.622] (-2942.217) (-2933.994) * (-2942.734) (-2937.046) (-2937.486) [-2945.296] -- 0:01:18

      Average standard deviation of split frequencies: 0.002882

      490500 -- (-2939.074) (-2938.226) (-2952.529) [-2938.987] * (-2938.765) [-2936.783] (-2937.032) (-2939.176) -- 0:01:17
      491000 -- [-2939.959] (-2945.543) (-2937.599) (-2937.577) * [-2937.461] (-2937.885) (-2946.771) (-2939.102) -- 0:01:17
      491500 -- (-2940.939) (-2940.342) [-2941.259] (-2938.674) * [-2943.795] (-2937.497) (-2944.800) (-2939.750) -- 0:01:17
      492000 -- (-2938.008) (-2942.554) (-2937.437) [-2938.777] * (-2943.666) [-2939.052] (-2937.778) (-2941.479) -- 0:01:17
      492500 -- [-2938.058] (-2935.185) (-2944.898) (-2939.831) * (-2944.435) (-2941.614) (-2944.890) [-2936.101] -- 0:01:17
      493000 -- [-2937.150] (-2936.530) (-2945.839) (-2941.151) * (-2938.486) (-2943.040) (-2941.452) [-2939.607] -- 0:01:17
      493500 -- (-2939.970) (-2943.745) (-2938.461) [-2941.760] * (-2945.765) (-2947.609) (-2945.094) [-2938.021] -- 0:01:16
      494000 -- (-2944.456) (-2940.413) [-2939.540] (-2937.584) * [-2944.833] (-2943.143) (-2941.693) (-2940.931) -- 0:01:16
      494500 -- (-2941.570) [-2937.073] (-2941.631) (-2944.722) * (-2935.394) (-2939.391) [-2939.196] (-2939.784) -- 0:01:17
      495000 -- (-2938.687) (-2938.638) (-2936.621) [-2941.302] * (-2942.952) (-2944.753) (-2939.594) [-2935.366] -- 0:01:17

      Average standard deviation of split frequencies: 0.002851

      495500 -- (-2941.647) (-2945.014) [-2942.481] (-2941.285) * (-2952.732) [-2941.424] (-2938.851) (-2939.733) -- 0:01:17
      496000 -- [-2942.128] (-2939.542) (-2944.029) (-2950.117) * (-2947.999) [-2937.943] (-2943.849) (-2943.988) -- 0:01:17
      496500 -- (-2937.905) [-2938.606] (-2941.195) (-2937.657) * (-2942.454) (-2936.185) (-2944.012) [-2937.115] -- 0:01:17
      497000 -- (-2938.814) (-2936.417) [-2938.984] (-2940.536) * (-2943.771) [-2943.755] (-2945.174) (-2942.007) -- 0:01:16
      497500 -- (-2936.523) [-2934.259] (-2940.835) (-2944.577) * (-2949.037) [-2939.006] (-2942.458) (-2942.758) -- 0:01:16
      498000 -- [-2934.848] (-2937.827) (-2944.228) (-2945.422) * (-2938.875) (-2943.363) [-2943.055] (-2936.945) -- 0:01:16
      498500 -- (-2936.200) [-2941.147] (-2945.244) (-2936.462) * (-2944.270) (-2943.027) (-2936.303) [-2936.369] -- 0:01:16
      499000 -- (-2939.014) (-2951.102) [-2944.105] (-2939.153) * (-2936.408) (-2947.269) (-2934.895) [-2933.717] -- 0:01:16
      499500 -- (-2941.079) (-2934.204) (-2940.574) [-2936.097] * (-2940.241) (-2949.806) (-2944.389) [-2942.972] -- 0:01:16
      500000 -- (-2936.084) [-2937.594] (-2942.732) (-2937.213) * (-2935.840) (-2942.591) [-2939.135] (-2943.250) -- 0:01:16

      Average standard deviation of split frequencies: 0.003766

      500500 -- (-2943.442) (-2939.231) [-2945.444] (-2936.713) * (-2943.325) (-2940.213) (-2941.655) [-2940.602] -- 0:01:15
      501000 -- (-2939.099) [-2940.451] (-2945.164) (-2942.643) * (-2937.317) (-2936.994) (-2945.520) [-2946.917] -- 0:01:16
      501500 -- [-2942.112] (-2938.498) (-2941.290) (-2941.522) * (-2945.719) [-2937.061] (-2943.142) (-2941.629) -- 0:01:16
      502000 -- (-2945.235) (-2937.976) (-2943.783) [-2937.007] * (-2939.057) [-2946.055] (-2938.096) (-2941.880) -- 0:01:16
      502500 -- (-2935.943) (-2935.907) (-2940.820) [-2935.704] * (-2939.893) (-2938.720) (-2939.254) [-2936.890] -- 0:01:16
      503000 -- (-2939.048) (-2942.623) (-2937.992) [-2938.302] * (-2941.663) (-2937.444) (-2935.235) [-2940.381] -- 0:01:16
      503500 -- (-2937.307) [-2937.847] (-2937.829) (-2942.114) * (-2940.353) (-2939.225) [-2939.629] (-2941.407) -- 0:01:15
      504000 -- (-2937.657) [-2938.097] (-2947.638) (-2950.652) * (-2945.488) (-2944.275) [-2937.224] (-2939.782) -- 0:01:15
      504500 -- (-2941.621) [-2934.309] (-2938.610) (-2937.947) * (-2942.274) [-2935.540] (-2943.903) (-2933.100) -- 0:01:15
      505000 -- (-2939.764) (-2935.582) (-2941.977) [-2939.583] * (-2941.946) (-2941.831) (-2937.719) [-2938.188] -- 0:01:15

      Average standard deviation of split frequencies: 0.003727

      505500 -- [-2942.554] (-2932.712) (-2945.635) (-2939.744) * [-2935.627] (-2943.152) (-2939.287) (-2940.834) -- 0:01:15
      506000 -- [-2939.712] (-2941.305) (-2939.648) (-2948.901) * (-2946.583) [-2940.438] (-2935.632) (-2934.077) -- 0:01:15
      506500 -- (-2947.353) (-2936.949) (-2944.791) [-2943.536] * (-2937.827) (-2943.422) [-2934.600] (-2939.316) -- 0:01:15
      507000 -- [-2940.778] (-2936.701) (-2940.060) (-2936.018) * [-2940.904] (-2948.547) (-2940.817) (-2939.770) -- 0:01:14
      507500 -- (-2940.303) (-2938.653) [-2936.431] (-2938.773) * (-2941.110) (-2940.416) (-2940.016) [-2937.029] -- 0:01:15
      508000 -- (-2940.043) (-2941.745) (-2936.311) [-2942.809] * (-2936.828) [-2942.536] (-2934.911) (-2947.512) -- 0:01:15
      508500 -- (-2939.526) (-2936.811) (-2934.177) [-2942.567] * (-2942.834) (-2936.254) (-2942.372) [-2945.940] -- 0:01:15
      509000 -- [-2937.935] (-2942.561) (-2944.517) (-2941.335) * (-2942.167) (-2940.149) [-2938.929] (-2940.219) -- 0:01:15
      509500 -- (-2937.494) [-2942.049] (-2935.713) (-2939.691) * (-2935.641) (-2944.736) (-2939.955) [-2937.250] -- 0:01:15
      510000 -- (-2940.975) (-2937.028) [-2935.380] (-2935.948) * (-2939.261) (-2936.611) [-2935.783] (-2933.946) -- 0:01:14

      Average standard deviation of split frequencies: 0.003692

      510500 -- (-2933.110) (-2943.839) [-2937.573] (-2942.285) * [-2936.024] (-2937.751) (-2938.607) (-2942.201) -- 0:01:14
      511000 -- (-2938.652) (-2945.302) [-2938.830] (-2940.145) * (-2940.227) (-2939.903) [-2938.449] (-2941.285) -- 0:01:14
      511500 -- (-2940.819) (-2945.612) (-2951.059) [-2937.576] * (-2940.525) (-2937.313) [-2941.724] (-2938.207) -- 0:01:14
      512000 -- (-2943.265) (-2943.187) [-2941.120] (-2936.691) * [-2935.071] (-2938.420) (-2940.167) (-2934.049) -- 0:01:14
      512500 -- [-2936.782] (-2946.745) (-2936.972) (-2935.625) * [-2935.471] (-2939.031) (-2935.289) (-2940.423) -- 0:01:14
      513000 -- (-2937.121) [-2939.076] (-2942.917) (-2945.353) * [-2936.208] (-2935.597) (-2936.448) (-2941.673) -- 0:01:14
      513500 -- (-2940.386) (-2938.995) [-2940.845] (-2941.446) * (-2950.610) (-2936.433) [-2936.912] (-2938.307) -- 0:01:13
      514000 -- (-2945.494) (-2946.853) [-2940.984] (-2941.083) * [-2936.155] (-2937.073) (-2938.523) (-2938.271) -- 0:01:14
      514500 -- [-2942.892] (-2940.803) (-2940.529) (-2934.210) * (-2937.009) [-2936.284] (-2941.768) (-2936.659) -- 0:01:14
      515000 -- (-2938.239) (-2935.280) [-2934.912] (-2942.676) * [-2943.489] (-2944.615) (-2940.366) (-2940.393) -- 0:01:14

      Average standard deviation of split frequencies: 0.003654

      515500 -- [-2941.905] (-2942.369) (-2940.875) (-2945.038) * (-2942.709) [-2937.279] (-2937.220) (-2943.553) -- 0:01:14
      516000 -- (-2945.852) [-2939.087] (-2939.623) (-2944.074) * (-2936.475) [-2941.627] (-2938.471) (-2934.777) -- 0:01:14
      516500 -- (-2941.262) (-2937.777) [-2945.202] (-2941.230) * [-2938.547] (-2943.238) (-2941.302) (-2941.658) -- 0:01:13
      517000 -- (-2944.511) (-2938.377) (-2942.711) [-2932.386] * [-2936.611] (-2937.956) (-2940.947) (-2943.605) -- 0:01:13
      517500 -- (-2938.903) [-2938.640] (-2936.428) (-2935.041) * (-2944.805) (-2939.746) [-2937.955] (-2940.138) -- 0:01:13
      518000 -- (-2941.049) (-2948.276) [-2938.168] (-2936.765) * (-2941.887) [-2945.654] (-2938.875) (-2945.380) -- 0:01:13
      518500 -- (-2939.022) (-2939.092) (-2937.795) [-2942.541] * (-2937.493) (-2944.086) [-2933.163] (-2942.531) -- 0:01:13
      519000 -- (-2936.257) (-2944.425) [-2938.890] (-2941.917) * [-2942.929] (-2945.459) (-2937.314) (-2941.860) -- 0:01:13
      519500 -- (-2935.651) [-2946.610] (-2940.646) (-2937.008) * (-2944.647) (-2937.539) (-2938.353) [-2938.971] -- 0:01:13
      520000 -- [-2937.821] (-2944.438) (-2938.814) (-2940.753) * (-2945.273) (-2937.274) (-2938.641) [-2935.863] -- 0:01:12

      Average standard deviation of split frequencies: 0.003622

      520500 -- (-2941.642) (-2935.469) [-2938.650] (-2945.251) * [-2941.217] (-2948.902) (-2939.938) (-2938.085) -- 0:01:13
      521000 -- (-2938.614) (-2943.412) [-2933.193] (-2942.017) * (-2942.960) (-2940.326) (-2942.851) [-2941.308] -- 0:01:13
      521500 -- (-2934.152) (-2940.124) (-2937.816) [-2946.235] * (-2940.484) (-2937.997) [-2946.256] (-2937.983) -- 0:01:13
      522000 -- [-2939.475] (-2940.794) (-2936.866) (-2943.430) * (-2936.071) (-2934.680) (-2940.260) [-2942.010] -- 0:01:13
      522500 -- [-2937.702] (-2938.073) (-2938.038) (-2941.113) * (-2939.453) (-2935.154) (-2943.662) [-2935.677] -- 0:01:13
      523000 -- [-2936.631] (-2937.827) (-2941.763) (-2949.856) * (-2946.308) [-2938.634] (-2951.838) (-2938.700) -- 0:01:12
      523500 -- (-2938.337) (-2936.905) [-2938.949] (-2944.530) * [-2935.359] (-2938.134) (-2945.515) (-2940.043) -- 0:01:12
      524000 -- (-2942.921) [-2944.331] (-2945.276) (-2951.978) * (-2934.484) (-2941.218) (-2939.493) [-2934.363] -- 0:01:12
      524500 -- [-2947.062] (-2937.784) (-2936.414) (-2940.637) * (-2943.018) (-2935.181) (-2940.645) [-2936.206] -- 0:01:12
      525000 -- (-2943.452) (-2937.457) [-2940.355] (-2943.325) * (-2943.030) (-2946.097) [-2934.595] (-2938.598) -- 0:01:12

      Average standard deviation of split frequencies: 0.001792

      525500 -- (-2938.371) (-2940.228) (-2936.785) [-2937.774] * (-2940.297) (-2939.550) (-2937.897) [-2944.230] -- 0:01:12
      526000 -- (-2939.473) [-2938.866] (-2939.615) (-2940.904) * (-2944.743) (-2936.844) (-2939.324) [-2937.266] -- 0:01:12
      526500 -- [-2939.700] (-2946.760) (-2944.457) (-2944.420) * (-2942.089) (-2940.653) (-2939.156) [-2942.623] -- 0:01:11
      527000 -- [-2940.542] (-2939.046) (-2946.014) (-2945.334) * (-2944.473) [-2936.874] (-2938.052) (-2936.763) -- 0:01:12
      527500 -- (-2938.463) (-2946.148) (-2952.393) [-2939.236] * [-2941.546] (-2945.834) (-2938.481) (-2941.722) -- 0:01:12
      528000 -- [-2941.108] (-2938.644) (-2952.003) (-2946.244) * (-2943.359) [-2936.212] (-2941.924) (-2940.158) -- 0:01:12
      528500 -- (-2940.203) (-2939.699) (-2942.435) [-2936.969] * [-2940.918] (-2945.192) (-2944.611) (-2938.454) -- 0:01:12
      529000 -- (-2941.280) [-2940.881] (-2940.190) (-2943.783) * (-2936.564) (-2949.901) (-2949.447) [-2939.640] -- 0:01:12
      529500 -- [-2938.555] (-2950.353) (-2942.808) (-2934.481) * (-2940.130) (-2948.033) [-2941.045] (-2943.041) -- 0:01:11
      530000 -- [-2939.443] (-2961.248) (-2940.891) (-2937.059) * (-2936.953) (-2939.324) [-2938.555] (-2938.012) -- 0:01:11

      Average standard deviation of split frequencies: 0.001777

      530500 -- [-2937.993] (-2946.991) (-2935.606) (-2936.450) * [-2938.367] (-2935.935) (-2944.566) (-2947.043) -- 0:01:11
      531000 -- (-2935.150) (-2947.392) [-2941.408] (-2939.789) * (-2938.760) [-2938.747] (-2948.664) (-2939.514) -- 0:01:11
      531500 -- (-2936.669) (-2938.273) [-2943.553] (-2936.310) * (-2943.710) (-2937.989) (-2943.212) [-2937.175] -- 0:01:11
      532000 -- (-2941.271) (-2947.762) [-2940.751] (-2938.195) * (-2946.793) (-2943.668) [-2938.781] (-2937.383) -- 0:01:11
      532500 -- (-2941.318) [-2940.982] (-2941.160) (-2936.636) * (-2947.223) (-2945.822) (-2934.620) [-2936.630] -- 0:01:11
      533000 -- [-2939.217] (-2937.016) (-2934.550) (-2941.614) * (-2948.102) [-2934.722] (-2939.644) (-2937.624) -- 0:01:10
      533500 -- (-2937.616) [-2937.737] (-2944.487) (-2938.624) * [-2938.744] (-2942.225) (-2939.277) (-2943.498) -- 0:01:11
      534000 -- (-2938.847) (-2941.285) [-2941.090] (-2936.568) * [-2938.456] (-2940.050) (-2943.302) (-2941.566) -- 0:01:11
      534500 -- (-2931.550) (-2939.050) (-2940.188) [-2940.818] * [-2939.370] (-2942.518) (-2942.229) (-2940.418) -- 0:01:11
      535000 -- [-2942.315] (-2936.271) (-2950.469) (-2943.357) * [-2936.556] (-2938.367) (-2938.025) (-2936.280) -- 0:01:11

      Average standard deviation of split frequencies: 0.000879

      535500 -- (-2935.201) [-2940.416] (-2940.695) (-2944.231) * (-2939.470) (-2940.067) (-2941.227) [-2935.533] -- 0:01:11
      536000 -- (-2935.222) [-2938.897] (-2946.580) (-2942.628) * (-2936.350) [-2942.697] (-2937.565) (-2936.256) -- 0:01:10
      536500 -- (-2934.108) (-2942.057) (-2941.671) [-2942.170] * (-2942.246) [-2939.387] (-2936.278) (-2943.695) -- 0:01:10
      537000 -- (-2935.969) (-2939.213) [-2940.147] (-2937.389) * (-2936.176) [-2936.096] (-2941.675) (-2940.361) -- 0:01:10
      537500 -- (-2941.050) (-2939.873) [-2940.586] (-2939.405) * (-2937.536) (-2938.670) (-2935.489) [-2934.434] -- 0:01:10
      538000 -- (-2942.428) [-2934.046] (-2934.201) (-2940.199) * (-2937.072) [-2938.933] (-2940.155) (-2942.916) -- 0:01:10
      538500 -- (-2936.981) (-2947.116) [-2940.125] (-2937.965) * [-2939.499] (-2939.360) (-2936.982) (-2941.316) -- 0:01:10
      539000 -- (-2943.631) (-2939.732) [-2940.816] (-2938.487) * (-2943.987) [-2947.086] (-2941.023) (-2942.700) -- 0:01:10
      539500 -- [-2935.347] (-2940.285) (-2945.359) (-2937.588) * (-2939.142) (-2947.876) [-2939.921] (-2936.423) -- 0:01:09
      540000 -- (-2941.708) [-2942.639] (-2941.651) (-2936.949) * (-2944.236) (-2939.487) [-2938.574] (-2940.547) -- 0:01:10

      Average standard deviation of split frequencies: 0.001744

      540500 -- (-2941.036) [-2939.257] (-2935.273) (-2943.393) * (-2950.656) (-2944.223) (-2940.802) [-2938.252] -- 0:01:10
      541000 -- (-2937.291) (-2938.769) [-2936.898] (-2943.206) * [-2938.373] (-2938.437) (-2939.955) (-2939.523) -- 0:01:10
      541500 -- (-2939.264) [-2933.139] (-2938.153) (-2933.239) * [-2939.941] (-2939.102) (-2939.153) (-2941.545) -- 0:01:10
      542000 -- (-2946.620) (-2942.741) (-2936.311) [-2941.959] * (-2940.358) [-2935.177] (-2939.869) (-2937.644) -- 0:01:10
      542500 -- (-2940.837) (-2931.964) [-2935.850] (-2940.150) * (-2938.014) [-2936.097] (-2947.139) (-2938.775) -- 0:01:09
      543000 -- (-2936.957) (-2937.276) [-2938.942] (-2935.845) * [-2938.057] (-2940.180) (-2942.986) (-2945.420) -- 0:01:09
      543500 -- (-2942.977) [-2933.623] (-2941.765) (-2937.040) * [-2942.411] (-2936.426) (-2939.851) (-2942.356) -- 0:01:09
      544000 -- (-2937.662) (-2935.587) [-2945.291] (-2939.742) * (-2938.066) (-2935.495) (-2943.541) [-2950.869] -- 0:01:09
      544500 -- [-2935.922] (-2937.875) (-2942.047) (-2938.770) * [-2937.746] (-2943.394) (-2940.949) (-2938.560) -- 0:01:09
      545000 -- (-2938.300) (-2948.511) [-2935.418] (-2941.255) * (-2946.843) [-2943.373] (-2941.903) (-2939.042) -- 0:01:09

      Average standard deviation of split frequencies: 0.001727

      545500 -- (-2946.422) (-2936.320) (-2939.281) [-2941.305] * (-2937.297) [-2939.779] (-2943.891) (-2942.715) -- 0:01:09
      546000 -- (-2940.905) [-2933.970] (-2943.817) (-2938.715) * (-2942.763) (-2939.022) (-2940.282) [-2941.046] -- 0:01:09
      546500 -- (-2937.743) [-2941.039] (-2935.761) (-2939.209) * [-2939.611] (-2939.943) (-2938.135) (-2936.998) -- 0:01:09
      547000 -- (-2941.306) [-2937.258] (-2942.618) (-2943.578) * (-2937.707) (-2941.610) (-2936.771) [-2937.543] -- 0:01:09
      547500 -- (-2938.226) [-2941.637] (-2936.617) (-2937.697) * [-2936.532] (-2938.528) (-2937.270) (-2939.028) -- 0:01:09
      548000 -- [-2934.258] (-2935.070) (-2938.746) (-2941.474) * (-2937.232) (-2944.503) (-2942.342) [-2936.405] -- 0:01:09
      548500 -- (-2938.926) [-2936.330] (-2946.405) (-2944.563) * (-2942.460) (-2937.218) [-2939.464] (-2936.205) -- 0:01:09
      549000 -- (-2943.374) (-2936.158) [-2943.328] (-2939.994) * (-2939.421) (-2942.418) [-2937.815] (-2938.001) -- 0:01:09
      549500 -- (-2937.346) (-2937.902) (-2953.431) [-2941.674] * (-2941.125) [-2936.915] (-2939.901) (-2938.724) -- 0:01:08
      550000 -- (-2938.854) (-2944.469) (-2946.089) [-2940.621] * (-2941.594) [-2939.118] (-2937.636) (-2944.877) -- 0:01:08

      Average standard deviation of split frequencies: 0.002568

      550500 -- (-2945.443) (-2937.251) (-2942.716) [-2932.933] * (-2941.432) [-2936.022] (-2939.347) (-2937.930) -- 0:01:08
      551000 -- (-2938.932) (-2936.473) (-2943.563) [-2939.502] * (-2936.886) (-2937.541) (-2944.019) [-2937.763] -- 0:01:08
      551500 -- [-2940.642] (-2941.468) (-2943.567) (-2945.452) * (-2942.318) (-2940.057) (-2944.349) [-2935.972] -- 0:01:08
      552000 -- (-2943.566) [-2939.038] (-2945.034) (-2942.218) * [-2941.164] (-2938.922) (-2948.818) (-2938.057) -- 0:01:08
      552500 -- (-2945.342) [-2935.242] (-2942.129) (-2938.080) * (-2935.321) (-2940.627) (-2938.785) [-2939.854] -- 0:01:08
      553000 -- [-2936.698] (-2935.775) (-2942.442) (-2949.798) * (-2942.108) (-2941.349) [-2938.719] (-2950.199) -- 0:01:08
      553500 -- [-2938.547] (-2946.016) (-2946.944) (-2932.849) * (-2937.904) (-2945.567) [-2940.164] (-2941.935) -- 0:01:08
      554000 -- [-2937.042] (-2942.110) (-2938.960) (-2938.547) * (-2948.034) (-2940.185) [-2936.734] (-2941.699) -- 0:01:08
      554500 -- (-2946.260) [-2936.072] (-2937.262) (-2938.366) * (-2937.389) (-2936.941) [-2945.591] (-2938.733) -- 0:01:08
      555000 -- (-2946.296) [-2946.891] (-2939.717) (-2938.020) * (-2947.408) (-2942.333) [-2939.630] (-2939.826) -- 0:01:08

      Average standard deviation of split frequencies: 0.003391

      555500 -- [-2947.573] (-2940.233) (-2938.135) (-2942.987) * (-2935.722) [-2935.738] (-2939.555) (-2936.466) -- 0:01:08
      556000 -- [-2937.672] (-2941.309) (-2936.247) (-2944.766) * (-2934.970) [-2936.466] (-2936.349) (-2943.494) -- 0:01:07
      556500 -- (-2943.436) [-2938.248] (-2942.278) (-2943.303) * (-2942.634) [-2940.862] (-2941.934) (-2936.757) -- 0:01:07
      557000 -- (-2940.292) [-2942.270] (-2936.079) (-2942.041) * [-2937.727] (-2940.955) (-2941.771) (-2942.646) -- 0:01:07
      557500 -- (-2940.067) (-2936.867) [-2943.771] (-2941.695) * (-2940.894) (-2940.268) (-2939.104) [-2942.125] -- 0:01:07
      558000 -- (-2936.604) (-2939.529) [-2939.843] (-2946.674) * [-2938.562] (-2942.021) (-2939.220) (-2939.549) -- 0:01:07
      558500 -- (-2938.709) [-2945.026] (-2940.896) (-2940.525) * [-2939.296] (-2945.764) (-2939.895) (-2940.856) -- 0:01:07
      559000 -- [-2941.069] (-2935.590) (-2944.764) (-2939.354) * (-2938.532) [-2941.420] (-2935.334) (-2943.516) -- 0:01:07
      559500 -- [-2939.939] (-2946.251) (-2940.677) (-2937.541) * (-2937.666) (-2938.246) [-2937.908] (-2937.957) -- 0:01:07
      560000 -- (-2939.831) [-2941.601] (-2943.328) (-2940.350) * [-2939.738] (-2936.535) (-2938.283) (-2940.076) -- 0:01:07

      Average standard deviation of split frequencies: 0.003363

      560500 -- (-2941.100) [-2940.275] (-2939.858) (-2942.616) * (-2936.704) (-2939.730) [-2936.342] (-2937.100) -- 0:01:07
      561000 -- (-2937.391) [-2944.615] (-2942.623) (-2944.758) * (-2940.850) (-2950.803) (-2933.937) [-2939.803] -- 0:01:07
      561500 -- (-2937.991) (-2938.771) (-2940.423) [-2938.062] * (-2941.629) [-2942.004] (-2944.867) (-2938.585) -- 0:01:07
      562000 -- (-2942.774) (-2947.193) (-2944.599) [-2940.070] * (-2948.873) [-2937.607] (-2939.798) (-2937.295) -- 0:01:07
      562500 -- (-2936.943) (-2934.417) (-2942.083) [-2937.709] * (-2941.484) [-2935.570] (-2935.401) (-2946.628) -- 0:01:06
      563000 -- (-2939.870) (-2938.686) [-2934.894] (-2945.479) * (-2938.591) (-2941.511) [-2938.262] (-2944.923) -- 0:01:06
      563500 -- (-2942.294) (-2935.263) [-2942.982] (-2945.563) * (-2931.109) (-2939.300) [-2936.980] (-2933.808) -- 0:01:06
      564000 -- [-2942.526] (-2939.783) (-2943.081) (-2940.465) * [-2938.084] (-2942.324) (-2938.930) (-2935.073) -- 0:01:06
      564500 -- (-2939.932) (-2936.456) [-2941.326] (-2936.665) * (-2934.885) (-2942.441) [-2938.900] (-2935.851) -- 0:01:06
      565000 -- (-2938.734) (-2943.539) [-2936.328] (-2938.987) * (-2938.807) [-2939.923] (-2937.179) (-2945.375) -- 0:01:06

      Average standard deviation of split frequencies: 0.002499

      565500 -- (-2938.200) (-2947.479) [-2943.034] (-2940.858) * (-2942.332) (-2943.721) (-2943.148) [-2947.366] -- 0:01:06
      566000 -- (-2940.368) [-2943.978] (-2935.756) (-2941.377) * (-2941.771) [-2946.406] (-2944.470) (-2935.811) -- 0:01:06
      566500 -- [-2939.280] (-2936.387) (-2938.890) (-2936.927) * [-2938.706] (-2941.553) (-2940.797) (-2942.845) -- 0:01:06
      567000 -- (-2944.672) (-2940.516) [-2946.411] (-2933.843) * (-2939.495) (-2939.338) [-2937.109] (-2937.828) -- 0:01:06
      567500 -- (-2943.331) [-2941.277] (-2946.632) (-2937.102) * (-2950.045) [-2936.073] (-2942.220) (-2936.864) -- 0:01:06
      568000 -- (-2938.306) (-2946.583) (-2942.760) [-2934.725] * [-2949.915] (-2937.596) (-2942.622) (-2936.048) -- 0:01:06
      568500 -- (-2939.090) [-2939.736] (-2938.170) (-2945.389) * (-2945.471) [-2938.840] (-2942.876) (-2936.356) -- 0:01:06
      569000 -- (-2939.921) (-2938.711) (-2940.437) [-2939.389] * [-2935.893] (-2936.494) (-2935.700) (-2935.687) -- 0:01:05
      569500 -- (-2940.928) [-2940.257] (-2935.562) (-2944.775) * (-2945.721) [-2942.842] (-2950.237) (-2944.067) -- 0:01:05
      570000 -- (-2938.157) (-2940.088) (-2941.987) [-2939.800] * [-2938.576] (-2939.311) (-2946.733) (-2940.782) -- 0:01:05

      Average standard deviation of split frequencies: 0.002478

      570500 -- (-2941.005) (-2939.505) [-2944.888] (-2938.746) * [-2938.038] (-2934.355) (-2944.808) (-2939.221) -- 0:01:05
      571000 -- (-2940.494) [-2938.467] (-2934.777) (-2943.397) * (-2938.457) (-2941.804) (-2941.532) [-2937.021] -- 0:01:05
      571500 -- (-2937.393) [-2938.887] (-2936.666) (-2947.388) * (-2936.619) [-2938.983] (-2938.587) (-2935.452) -- 0:01:05
      572000 -- [-2940.833] (-2939.969) (-2932.960) (-2944.632) * [-2936.581] (-2944.857) (-2935.682) (-2939.863) -- 0:01:05
      572500 -- (-2945.740) [-2940.722] (-2935.493) (-2942.425) * (-2938.065) (-2939.914) (-2946.037) [-2943.553] -- 0:01:05
      573000 -- (-2942.535) (-2937.071) (-2940.069) [-2943.083] * (-2944.403) (-2943.424) (-2940.938) [-2934.612] -- 0:01:05
      573500 -- (-2940.487) (-2936.800) [-2935.630] (-2936.106) * (-2935.710) (-2936.452) [-2933.967] (-2933.768) -- 0:01:05
      574000 -- [-2936.520] (-2939.218) (-2936.777) (-2944.672) * (-2941.445) (-2939.588) [-2933.762] (-2938.462) -- 0:01:05
      574500 -- [-2940.029] (-2936.014) (-2939.225) (-2937.837) * [-2939.273] (-2938.055) (-2939.484) (-2940.914) -- 0:01:05
      575000 -- (-2939.053) (-2941.576) [-2940.125] (-2943.143) * (-2944.049) (-2937.203) (-2948.987) [-2939.004] -- 0:01:05

      Average standard deviation of split frequencies: 0.002455

      575500 -- (-2937.358) [-2940.318] (-2941.171) (-2941.625) * (-2935.898) [-2939.037] (-2940.705) (-2942.589) -- 0:01:04
      576000 -- (-2941.514) (-2937.568) (-2950.162) [-2938.869] * [-2942.067] (-2945.157) (-2939.202) (-2942.182) -- 0:01:04
      576500 -- [-2939.775] (-2937.861) (-2938.850) (-2934.835) * (-2939.446) [-2937.325] (-2942.242) (-2944.896) -- 0:01:04
      577000 -- (-2939.634) [-2943.358] (-2943.524) (-2939.807) * (-2939.060) (-2948.760) (-2946.303) [-2935.978] -- 0:01:04
      577500 -- (-2938.516) (-2941.410) (-2942.409) [-2941.019] * [-2943.097] (-2945.847) (-2944.646) (-2937.566) -- 0:01:04
      578000 -- (-2949.247) (-2945.626) (-2935.266) [-2942.197] * (-2942.843) (-2934.455) [-2937.935] (-2939.114) -- 0:01:04
      578500 -- (-2943.037) (-2938.849) (-2937.867) [-2939.923] * [-2938.836] (-2942.895) (-2933.198) (-2951.050) -- 0:01:04
      579000 -- (-2945.297) (-2943.351) [-2935.164] (-2938.825) * (-2938.313) (-2935.213) (-2942.875) [-2937.126] -- 0:01:04
      579500 -- [-2937.421] (-2932.697) (-2939.905) (-2933.677) * (-2933.907) (-2940.051) (-2938.055) [-2941.302] -- 0:01:04
      580000 -- (-2936.989) [-2935.473] (-2941.650) (-2937.454) * (-2937.969) (-2939.266) (-2940.671) [-2940.496] -- 0:01:04

      Average standard deviation of split frequencies: 0.003247

      580500 -- (-2938.400) [-2935.031] (-2941.443) (-2939.496) * [-2934.055] (-2942.949) (-2936.221) (-2943.084) -- 0:01:04
      581000 -- [-2938.261] (-2936.318) (-2939.494) (-2945.481) * (-2935.733) (-2945.607) [-2936.886] (-2947.201) -- 0:01:04
      581500 -- [-2938.130] (-2939.986) (-2934.378) (-2942.096) * (-2940.450) (-2936.915) [-2941.470] (-2940.498) -- 0:01:04
      582000 -- (-2939.593) (-2937.750) [-2934.864] (-2943.118) * (-2948.630) [-2936.038] (-2937.896) (-2937.557) -- 0:01:03
      582500 -- (-2945.225) (-2938.398) (-2943.151) [-2934.177] * (-2945.773) [-2940.393] (-2943.807) (-2938.875) -- 0:01:03
      583000 -- (-2939.494) (-2946.833) (-2950.914) [-2939.936] * (-2941.878) (-2935.688) (-2944.696) [-2935.640] -- 0:01:03
      583500 -- (-2940.743) (-2941.170) (-2942.207) [-2941.731] * (-2939.675) (-2938.946) (-2939.272) [-2938.592] -- 0:01:03
      584000 -- (-2941.952) (-2937.827) (-2942.573) [-2937.280] * (-2941.953) (-2935.844) (-2939.015) [-2938.459] -- 0:01:03
      584500 -- (-2937.198) (-2941.304) (-2947.233) [-2940.148] * (-2937.814) (-2936.247) [-2941.505] (-2939.334) -- 0:01:03
      585000 -- (-2941.000) (-2944.266) [-2937.913] (-2935.160) * (-2938.630) [-2937.738] (-2941.833) (-2938.644) -- 0:01:03

      Average standard deviation of split frequencies: 0.003218

      585500 -- (-2936.423) (-2937.389) [-2939.440] (-2937.101) * [-2935.461] (-2941.180) (-2939.210) (-2939.807) -- 0:01:03
      586000 -- (-2943.726) (-2948.325) [-2939.066] (-2937.857) * (-2936.815) (-2939.981) [-2941.339] (-2936.332) -- 0:01:03
      586500 -- (-2943.984) [-2939.911] (-2941.246) (-2944.721) * (-2941.150) [-2948.158] (-2944.553) (-2933.106) -- 0:01:03
      587000 -- (-2940.255) (-2940.978) [-2937.508] (-2948.463) * [-2939.753] (-2940.984) (-2941.982) (-2943.148) -- 0:01:03
      587500 -- [-2938.717] (-2937.737) (-2938.006) (-2953.237) * (-2943.587) (-2935.385) (-2946.062) [-2941.517] -- 0:01:03
      588000 -- [-2947.183] (-2938.688) (-2943.092) (-2942.499) * (-2944.268) (-2937.110) (-2940.184) [-2947.967] -- 0:01:03
      588500 -- [-2940.533] (-2943.754) (-2941.889) (-2939.187) * (-2936.243) [-2939.569] (-2940.365) (-2936.022) -- 0:01:02
      589000 -- (-2937.667) (-2940.586) [-2937.470] (-2942.173) * [-2936.851] (-2944.079) (-2941.626) (-2939.227) -- 0:01:02
      589500 -- (-2939.768) (-2936.684) [-2939.933] (-2937.406) * (-2940.396) (-2943.281) [-2939.187] (-2939.687) -- 0:01:02
      590000 -- [-2942.170] (-2945.333) (-2950.775) (-2939.578) * (-2937.003) (-2938.734) (-2943.901) [-2939.705] -- 0:01:02

      Average standard deviation of split frequencies: 0.003192

      590500 -- (-2939.954) (-2939.162) [-2939.499] (-2941.854) * (-2948.796) (-2935.699) [-2938.564] (-2941.407) -- 0:01:02
      591000 -- [-2937.439] (-2945.819) (-2937.407) (-2938.986) * (-2945.961) (-2939.555) (-2940.879) [-2945.939] -- 0:01:02
      591500 -- [-2940.591] (-2939.507) (-2944.973) (-2936.059) * (-2939.752) (-2942.440) (-2941.908) [-2941.668] -- 0:01:02
      592000 -- (-2940.064) [-2936.148] (-2949.192) (-2942.648) * [-2939.884] (-2942.318) (-2936.260) (-2936.723) -- 0:01:02
      592500 -- (-2935.678) [-2941.055] (-2945.875) (-2936.253) * (-2934.143) (-2943.188) [-2939.702] (-2944.733) -- 0:01:02
      593000 -- (-2947.200) (-2939.402) (-2946.497) [-2940.151] * [-2939.391] (-2936.655) (-2941.106) (-2950.819) -- 0:01:02
      593500 -- (-2949.756) [-2936.586] (-2948.895) (-2940.035) * (-2943.958) [-2942.362] (-2941.973) (-2943.071) -- 0:01:02
      594000 -- (-2945.161) (-2941.229) (-2947.495) [-2937.530] * (-2939.661) (-2941.199) (-2938.849) [-2940.038] -- 0:01:02
      594500 -- (-2945.621) (-2939.436) [-2939.907] (-2938.566) * (-2936.302) (-2942.697) (-2937.711) [-2936.864] -- 0:01:02
      595000 -- (-2941.083) (-2941.068) [-2935.703] (-2947.540) * [-2935.437] (-2946.213) (-2938.752) (-2936.907) -- 0:01:01

      Average standard deviation of split frequencies: 0.003164

      595500 -- (-2935.091) [-2934.699] (-2940.167) (-2938.879) * (-2942.766) (-2936.348) (-2935.301) [-2941.826] -- 0:01:01
      596000 -- (-2938.062) (-2943.267) (-2938.304) [-2943.441] * [-2940.823] (-2936.499) (-2938.193) (-2939.132) -- 0:01:01
      596500 -- (-2948.770) (-2940.704) [-2939.856] (-2937.665) * (-2938.875) (-2941.416) [-2933.775] (-2940.963) -- 0:01:01
      597000 -- (-2944.857) (-2940.759) [-2942.486] (-2938.911) * (-2945.861) [-2945.301] (-2944.870) (-2943.039) -- 0:01:01
      597500 -- [-2935.328] (-2941.084) (-2945.350) (-2932.726) * (-2945.493) (-2942.377) [-2940.633] (-2935.854) -- 0:01:01
      598000 -- (-2935.811) (-2945.884) (-2943.935) [-2938.973] * (-2939.358) (-2944.668) (-2945.166) [-2936.769] -- 0:01:01
      598500 -- (-2943.323) (-2941.999) [-2936.979] (-2937.246) * [-2937.817] (-2942.057) (-2944.934) (-2939.502) -- 0:01:01
      599000 -- [-2941.343] (-2934.522) (-2935.327) (-2935.696) * (-2940.246) (-2941.867) (-2935.317) [-2935.737] -- 0:01:01
      599500 -- (-2940.112) [-2938.726] (-2940.266) (-2945.559) * (-2939.436) [-2940.142] (-2937.010) (-2940.632) -- 0:01:01
      600000 -- (-2938.646) [-2938.651] (-2940.545) (-2939.065) * (-2937.870) [-2942.223] (-2939.813) (-2944.148) -- 0:01:01

      Average standard deviation of split frequencies: 0.003924

      600500 -- [-2936.651] (-2940.599) (-2946.338) (-2940.714) * (-2940.070) (-2938.531) (-2947.359) [-2937.218] -- 0:01:01
      601000 -- [-2939.606] (-2939.516) (-2939.008) (-2942.382) * (-2938.692) (-2941.431) [-2944.489] (-2938.866) -- 0:01:01
      601500 -- [-2941.998] (-2942.751) (-2947.092) (-2944.257) * (-2942.374) (-2939.343) (-2945.806) [-2944.648] -- 0:01:00
      602000 -- (-2935.165) (-2939.319) (-2937.758) [-2942.432] * (-2942.675) (-2939.329) (-2936.361) [-2934.825] -- 0:01:00
      602500 -- [-2936.560] (-2937.479) (-2947.347) (-2940.969) * (-2943.116) [-2942.400] (-2937.477) (-2938.221) -- 0:01:00
      603000 -- (-2938.612) (-2948.059) [-2940.987] (-2944.340) * (-2941.106) [-2935.286] (-2937.584) (-2936.819) -- 0:01:00
      603500 -- (-2938.294) (-2936.715) [-2938.326] (-2946.975) * [-2942.152] (-2944.835) (-2942.094) (-2940.815) -- 0:01:00
      604000 -- (-2937.915) (-2935.308) (-2936.482) [-2938.979] * [-2944.453] (-2941.938) (-2941.814) (-2939.321) -- 0:01:00
      604500 -- (-2945.974) [-2937.957] (-2938.389) (-2938.379) * (-2942.946) (-2943.932) (-2938.047) [-2939.081] -- 0:01:00
      605000 -- (-2944.315) (-2943.118) [-2942.055] (-2939.304) * (-2937.509) (-2940.221) (-2943.301) [-2942.063] -- 0:01:00

      Average standard deviation of split frequencies: 0.005445

      605500 -- [-2938.275] (-2938.304) (-2949.083) (-2941.737) * (-2954.141) [-2940.607] (-2947.085) (-2937.081) -- 0:01:00
      606000 -- (-2938.159) [-2942.438] (-2943.961) (-2939.212) * (-2939.727) [-2940.644] (-2940.673) (-2939.790) -- 0:01:00
      606500 -- [-2940.109] (-2940.873) (-2941.744) (-2937.521) * (-2941.414) (-2945.288) (-2937.963) [-2941.482] -- 0:01:00
      607000 -- (-2947.691) (-2946.495) (-2946.493) [-2933.653] * (-2953.661) (-2939.887) (-2942.743) [-2936.568] -- 0:01:00
      607500 -- (-2943.099) (-2937.966) [-2938.429] (-2935.862) * (-2935.682) (-2945.192) [-2934.441] (-2941.585) -- 0:01:00
      608000 -- (-2945.597) (-2944.153) [-2934.698] (-2938.062) * [-2942.188] (-2941.707) (-2931.797) (-2947.094) -- 0:00:59
      608500 -- (-2958.509) (-2935.864) (-2934.005) [-2946.567] * (-2934.596) (-2940.570) (-2945.418) [-2942.995] -- 0:00:59
      609000 -- [-2938.411] (-2940.120) (-2937.850) (-2943.125) * [-2941.634] (-2935.942) (-2936.144) (-2937.214) -- 0:00:59
      609500 -- (-2937.311) [-2936.968] (-2935.830) (-2938.309) * (-2942.842) (-2937.457) [-2938.826] (-2938.701) -- 0:00:59
      610000 -- (-2939.017) (-2944.034) [-2934.615] (-2936.398) * (-2941.748) (-2936.624) [-2937.380] (-2941.634) -- 0:00:59

      Average standard deviation of split frequencies: 0.006176

      610500 -- [-2936.751] (-2939.644) (-2937.758) (-2938.691) * [-2935.593] (-2944.150) (-2942.523) (-2939.461) -- 0:00:59
      611000 -- (-2934.716) (-2937.448) [-2939.715] (-2948.458) * [-2943.457] (-2938.481) (-2939.864) (-2933.595) -- 0:00:59
      611500 -- (-2943.578) (-2937.153) (-2943.068) [-2939.918] * (-2940.422) (-2943.048) [-2943.282] (-2945.682) -- 0:00:59
      612000 -- [-2936.168] (-2939.320) (-2940.322) (-2943.852) * (-2936.724) [-2943.914] (-2945.005) (-2944.360) -- 0:00:59
      612500 -- (-2946.412) [-2938.964] (-2944.802) (-2940.233) * (-2946.530) (-2945.260) (-2945.444) [-2934.888] -- 0:00:59
      613000 -- (-2936.678) [-2942.928] (-2942.426) (-2935.626) * (-2943.338) (-2936.049) (-2944.149) [-2942.784] -- 0:00:59
      613500 -- (-2935.567) (-2948.160) (-2937.938) [-2936.561] * (-2940.011) [-2933.181] (-2943.826) (-2936.862) -- 0:00:59
      614000 -- (-2942.507) (-2943.515) [-2934.951] (-2937.329) * (-2934.641) (-2943.757) [-2939.455] (-2940.418) -- 0:00:59
      614500 -- (-2943.478) (-2949.235) [-2936.900] (-2950.786) * (-2938.921) [-2940.348] (-2938.159) (-2939.690) -- 0:00:58
      615000 -- (-2938.324) (-2942.313) [-2934.353] (-2941.661) * [-2940.507] (-2943.611) (-2942.972) (-2941.519) -- 0:00:58

      Average standard deviation of split frequencies: 0.006887

      615500 -- (-2942.391) (-2940.497) [-2936.911] (-2942.190) * (-2938.672) [-2942.334] (-2944.597) (-2940.929) -- 0:00:58
      616000 -- (-2941.598) (-2937.342) [-2936.487] (-2940.298) * (-2945.992) [-2934.173] (-2940.433) (-2938.053) -- 0:00:58
      616500 -- (-2942.896) [-2940.960] (-2936.940) (-2940.365) * (-2935.140) (-2945.375) [-2937.431] (-2938.710) -- 0:00:58
      617000 -- (-2941.912) (-2937.327) (-2939.891) [-2937.450] * (-2940.883) (-2938.240) [-2938.697] (-2941.365) -- 0:00:58
      617500 -- (-2937.081) [-2939.464] (-2938.783) (-2941.208) * (-2941.512) [-2935.885] (-2940.123) (-2945.280) -- 0:00:58
      618000 -- (-2940.855) [-2950.499] (-2938.145) (-2944.947) * [-2937.758] (-2935.575) (-2934.228) (-2947.392) -- 0:00:58
      618500 -- (-2939.906) [-2937.875] (-2937.669) (-2936.672) * (-2937.588) (-2939.314) [-2934.494] (-2941.662) -- 0:00:58
      619000 -- (-2938.109) (-2942.989) [-2938.046] (-2939.286) * (-2942.935) (-2940.425) (-2942.012) [-2937.112] -- 0:00:58
      619500 -- (-2941.763) (-2947.978) [-2938.179] (-2940.235) * (-2940.242) (-2941.824) [-2940.043] (-2945.030) -- 0:00:58
      620000 -- (-2940.469) [-2948.432] (-2943.465) (-2940.422) * (-2941.062) (-2938.326) [-2938.484] (-2933.710) -- 0:00:58

      Average standard deviation of split frequencies: 0.006836

      620500 -- (-2940.683) (-2943.270) [-2935.331] (-2940.954) * [-2941.605] (-2945.209) (-2941.197) (-2936.595) -- 0:00:58
      621000 -- (-2937.225) (-2949.547) (-2936.466) [-2941.420] * (-2944.498) [-2938.109] (-2937.292) (-2939.062) -- 0:00:57
      621500 -- (-2943.247) (-2942.098) (-2939.109) [-2943.413] * (-2950.342) (-2945.675) (-2936.229) [-2940.869] -- 0:00:57
      622000 -- (-2936.084) (-2939.902) [-2937.151] (-2934.329) * (-2944.365) (-2939.349) (-2937.474) [-2945.066] -- 0:00:57
      622500 -- (-2945.246) [-2933.120] (-2938.020) (-2943.152) * (-2936.696) [-2936.290] (-2942.630) (-2937.979) -- 0:00:57
      623000 -- [-2939.062] (-2937.943) (-2946.103) (-2941.379) * (-2952.744) [-2936.312] (-2942.047) (-2939.835) -- 0:00:57
      623500 -- (-2933.843) (-2941.783) [-2937.882] (-2948.358) * (-2942.947) [-2940.258] (-2936.063) (-2938.217) -- 0:00:57
      624000 -- (-2938.888) [-2937.226] (-2941.407) (-2943.776) * (-2942.578) (-2948.681) (-2943.596) [-2935.269] -- 0:00:57
      624500 -- (-2942.869) [-2933.170] (-2945.915) (-2943.828) * (-2944.870) (-2942.339) (-2937.480) [-2936.514] -- 0:00:57
      625000 -- [-2932.106] (-2934.380) (-2948.069) (-2944.835) * (-2936.748) (-2942.199) (-2938.554) [-2937.180] -- 0:00:57

      Average standard deviation of split frequencies: 0.006777

      625500 -- (-2936.247) (-2938.219) (-2942.880) [-2941.492] * (-2944.867) (-2940.535) (-2937.234) [-2938.900] -- 0:00:57
      626000 -- (-2935.240) [-2940.332] (-2936.280) (-2942.172) * (-2939.999) (-2945.077) [-2937.413] (-2938.162) -- 0:00:57
      626500 -- (-2941.570) (-2944.558) (-2933.121) [-2936.878] * (-2936.879) [-2940.017] (-2939.277) (-2936.383) -- 0:00:57
      627000 -- (-2935.467) (-2939.945) (-2936.660) [-2939.551] * (-2947.255) (-2938.025) (-2945.011) [-2942.972] -- 0:00:57
      627500 -- (-2935.948) [-2939.802] (-2938.879) (-2942.600) * (-2942.317) (-2939.526) (-2937.800) [-2941.547] -- 0:00:56
      628000 -- (-2935.290) [-2937.039] (-2941.462) (-2940.328) * (-2938.784) (-2939.288) (-2937.182) [-2942.315] -- 0:00:56
      628500 -- (-2938.659) [-2942.010] (-2939.118) (-2945.628) * (-2939.567) [-2947.227] (-2945.056) (-2936.630) -- 0:00:56
      629000 -- (-2940.987) [-2940.486] (-2936.134) (-2949.005) * [-2941.623] (-2951.551) (-2938.843) (-2939.486) -- 0:00:56
      629500 -- (-2935.787) (-2937.627) [-2942.400] (-2942.624) * [-2935.535] (-2943.315) (-2939.275) (-2948.694) -- 0:00:56
      630000 -- (-2940.725) [-2938.158] (-2943.074) (-2946.446) * [-2936.473] (-2942.947) (-2942.459) (-2934.597) -- 0:00:56

      Average standard deviation of split frequencies: 0.006727

      630500 -- [-2935.274] (-2948.707) (-2942.936) (-2950.331) * [-2939.115] (-2940.501) (-2944.008) (-2938.303) -- 0:00:56
      631000 -- (-2941.452) [-2935.327] (-2940.260) (-2937.643) * [-2939.547] (-2948.009) (-2936.131) (-2935.277) -- 0:00:56
      631500 -- (-2944.539) (-2937.604) (-2939.803) [-2940.142] * (-2937.695) (-2946.694) [-2947.374] (-2946.508) -- 0:00:56
      632000 -- [-2935.347] (-2936.812) (-2941.601) (-2938.938) * (-2939.706) [-2946.922] (-2943.675) (-2937.226) -- 0:00:56
      632500 -- (-2944.607) [-2937.337] (-2941.618) (-2940.647) * (-2940.384) (-2943.266) [-2942.741] (-2944.816) -- 0:00:56
      633000 -- (-2945.650) [-2934.094] (-2938.967) (-2939.134) * [-2935.595] (-2937.192) (-2935.761) (-2938.068) -- 0:00:56
      633500 -- (-2937.052) (-2939.074) [-2940.291] (-2943.787) * (-2937.189) (-2939.612) (-2935.857) [-2938.202] -- 0:00:56
      634000 -- (-2939.092) (-2939.308) (-2942.884) [-2947.093] * [-2942.478] (-2938.215) (-2955.290) (-2941.183) -- 0:00:55
      634500 -- (-2941.459) [-2939.416] (-2939.978) (-2942.678) * (-2937.868) (-2944.081) [-2941.779] (-2945.420) -- 0:00:55
      635000 -- (-2941.684) (-2941.098) (-2934.730) [-2938.986] * (-2938.966) (-2935.267) (-2947.414) [-2937.568] -- 0:00:55

      Average standard deviation of split frequencies: 0.005930

      635500 -- (-2937.198) [-2945.882] (-2946.669) (-2942.501) * [-2941.455] (-2937.479) (-2947.219) (-2935.457) -- 0:00:55
      636000 -- (-2937.016) (-2939.323) (-2942.255) [-2936.930] * (-2938.789) (-2939.992) (-2940.779) [-2935.242] -- 0:00:55
      636500 -- (-2936.473) (-2937.492) [-2942.435] (-2940.133) * (-2940.392) (-2941.343) (-2936.898) [-2938.263] -- 0:00:55
      637000 -- (-2941.225) (-2938.002) (-2938.151) [-2944.913] * [-2939.563] (-2937.933) (-2944.534) (-2934.638) -- 0:00:55
      637500 -- (-2945.929) (-2943.622) (-2942.383) [-2939.557] * (-2946.369) (-2943.099) [-2938.458] (-2946.275) -- 0:00:55
      638000 -- (-2936.702) (-2940.736) (-2938.558) [-2937.138] * (-2935.637) [-2937.994] (-2943.690) (-2938.558) -- 0:00:55
      638500 -- (-2942.076) (-2939.538) [-2936.842] (-2941.538) * [-2937.727] (-2937.364) (-2940.343) (-2936.981) -- 0:00:55
      639000 -- (-2941.750) [-2941.578] (-2936.579) (-2943.827) * [-2942.152] (-2938.720) (-2936.509) (-2939.522) -- 0:00:55
      639500 -- (-2937.814) (-2942.938) [-2941.504] (-2946.231) * (-2938.515) [-2943.367] (-2940.283) (-2939.453) -- 0:00:55
      640000 -- [-2944.825] (-2940.165) (-2941.452) (-2940.018) * (-2937.795) (-2941.396) (-2943.680) [-2939.764] -- 0:00:55

      Average standard deviation of split frequencies: 0.005886

      640500 -- (-2937.737) (-2939.240) (-2938.247) [-2937.408] * (-2940.180) (-2944.012) [-2936.188] (-2938.337) -- 0:00:55
      641000 -- (-2940.998) (-2935.076) [-2939.127] (-2940.278) * (-2944.279) [-2938.675] (-2944.526) (-2940.307) -- 0:00:54
      641500 -- (-2933.028) (-2934.229) [-2938.491] (-2945.607) * (-2939.894) (-2940.542) [-2940.879] (-2939.431) -- 0:00:54
      642000 -- (-2937.732) (-2947.554) [-2939.433] (-2947.006) * (-2938.185) [-2934.213] (-2939.176) (-2938.324) -- 0:00:54
      642500 -- (-2946.752) (-2936.403) (-2946.036) [-2937.278] * (-2941.720) (-2936.299) [-2937.197] (-2948.389) -- 0:00:54
      643000 -- (-2947.252) (-2938.541) (-2940.938) [-2938.843] * (-2938.811) (-2936.365) [-2936.444] (-2942.093) -- 0:00:54
      643500 -- (-2939.572) [-2933.530] (-2943.598) (-2941.184) * (-2938.768) (-2944.190) (-2940.056) [-2934.424] -- 0:00:54
      644000 -- (-2939.346) [-2940.545] (-2944.496) (-2942.453) * (-2938.660) (-2936.125) (-2936.414) [-2939.557] -- 0:00:54
      644500 -- (-2936.518) (-2945.015) [-2940.246] (-2942.704) * (-2941.524) (-2938.499) [-2939.581] (-2946.734) -- 0:00:54
      645000 -- (-2943.515) [-2939.303] (-2936.839) (-2942.896) * (-2940.640) (-2936.696) (-2944.213) [-2945.581] -- 0:00:54

      Average standard deviation of split frequencies: 0.007297

      645500 -- (-2937.520) [-2937.708] (-2935.589) (-2938.248) * (-2939.347) [-2937.365] (-2937.692) (-2944.572) -- 0:00:54
      646000 -- (-2936.359) (-2941.505) [-2937.939] (-2943.725) * (-2937.873) (-2935.638) [-2941.464] (-2934.719) -- 0:00:54
      646500 -- [-2935.596] (-2941.021) (-2939.735) (-2938.670) * [-2940.766] (-2941.466) (-2935.331) (-2944.538) -- 0:00:54
      647000 -- (-2938.840) (-2935.456) (-2944.149) [-2934.221] * (-2945.020) (-2934.566) (-2941.095) [-2940.279] -- 0:00:54
      647500 -- [-2950.955] (-2938.050) (-2940.403) (-2935.318) * (-2937.215) (-2943.881) (-2936.858) [-2939.731] -- 0:00:53
      648000 -- (-2941.525) (-2942.258) [-2934.044] (-2936.281) * (-2935.837) (-2945.467) (-2942.490) [-2938.511] -- 0:00:53
      648500 -- (-2934.800) (-2936.314) [-2936.755] (-2939.149) * (-2941.068) (-2938.248) (-2951.636) [-2939.363] -- 0:00:53
      649000 -- (-2939.489) [-2934.959] (-2942.648) (-2944.338) * (-2940.032) [-2942.926] (-2946.330) (-2936.342) -- 0:00:53
      649500 -- [-2939.887] (-2934.944) (-2939.403) (-2942.392) * [-2941.767] (-2939.856) (-2947.479) (-2940.486) -- 0:00:53
      650000 -- (-2942.117) (-2938.664) [-2941.429] (-2934.781) * [-2939.116] (-2940.245) (-2939.329) (-2936.333) -- 0:00:53

      Average standard deviation of split frequencies: 0.008694

      650500 -- (-2947.137) (-2936.996) [-2935.411] (-2941.348) * [-2942.346] (-2938.171) (-2945.573) (-2943.649) -- 0:00:53
      651000 -- (-2941.290) (-2932.761) [-2937.118] (-2942.263) * (-2943.512) (-2934.316) [-2936.349] (-2948.876) -- 0:00:53
      651500 -- (-2938.354) [-2934.296] (-2934.769) (-2938.672) * (-2938.365) [-2937.110] (-2943.273) (-2937.355) -- 0:00:53
      652000 -- (-2940.565) [-2939.445] (-2940.289) (-2939.177) * (-2936.851) [-2940.731] (-2940.447) (-2938.614) -- 0:00:53
      652500 -- [-2938.329] (-2939.938) (-2938.872) (-2949.359) * (-2937.284) (-2943.159) [-2939.301] (-2938.595) -- 0:00:53
      653000 -- (-2937.436) (-2937.970) (-2944.300) [-2935.824] * (-2937.892) [-2936.002] (-2940.968) (-2952.869) -- 0:00:53
      653500 -- (-2937.043) [-2936.884] (-2938.305) (-2942.755) * (-2937.264) (-2940.598) (-2941.175) [-2940.304] -- 0:00:53
      654000 -- (-2943.860) (-2936.404) [-2938.741] (-2939.136) * [-2944.208] (-2940.655) (-2941.140) (-2932.729) -- 0:00:52
      654500 -- (-2942.284) (-2934.764) [-2935.561] (-2938.519) * (-2934.867) (-2938.913) (-2939.964) [-2947.191] -- 0:00:52
      655000 -- (-2936.876) (-2935.105) [-2939.157] (-2949.554) * [-2939.335] (-2941.436) (-2937.079) (-2940.583) -- 0:00:52

      Average standard deviation of split frequencies: 0.008623

      655500 -- (-2937.909) (-2937.772) [-2934.860] (-2935.375) * (-2937.703) [-2936.983] (-2941.248) (-2939.088) -- 0:00:52
      656000 -- (-2938.171) [-2937.616] (-2939.299) (-2940.024) * (-2938.384) (-2937.022) (-2939.921) [-2936.157] -- 0:00:52
      656500 -- (-2938.632) [-2942.760] (-2941.342) (-2941.519) * (-2943.197) [-2937.518] (-2939.024) (-2937.033) -- 0:00:52
      657000 -- (-2943.114) (-2941.901) [-2939.941] (-2934.374) * (-2948.623) (-2942.562) [-2947.310] (-2938.608) -- 0:00:52
      657500 -- [-2937.658] (-2944.051) (-2939.980) (-2933.699) * (-2937.735) [-2935.587] (-2934.269) (-2939.814) -- 0:00:52
      658000 -- [-2940.480] (-2946.342) (-2937.491) (-2937.343) * [-2938.822] (-2938.784) (-2943.789) (-2936.278) -- 0:00:52
      658500 -- (-2937.274) (-2940.811) (-2945.067) [-2935.369] * (-2937.184) (-2943.003) [-2937.993] (-2943.029) -- 0:00:52
      659000 -- [-2942.936] (-2943.483) (-2952.274) (-2941.173) * [-2933.454] (-2937.938) (-2942.231) (-2937.238) -- 0:00:52
      659500 -- (-2935.920) (-2951.556) [-2947.854] (-2938.179) * (-2940.957) (-2945.223) (-2937.340) [-2936.956] -- 0:00:52
      660000 -- (-2936.094) (-2943.492) (-2948.780) [-2941.571] * [-2937.029] (-2949.093) (-2946.386) (-2941.964) -- 0:00:52

      Average standard deviation of split frequencies: 0.008562

      660500 -- (-2935.680) (-2937.766) [-2939.002] (-2935.393) * (-2938.469) (-2945.201) (-2942.721) [-2941.688] -- 0:00:51
      661000 -- (-2936.498) [-2933.254] (-2935.871) (-2934.274) * (-2938.381) [-2945.475] (-2942.782) (-2937.394) -- 0:00:51
      661500 -- (-2938.347) (-2948.442) [-2933.998] (-2937.335) * (-2940.979) [-2935.502] (-2934.855) (-2939.725) -- 0:00:51
      662000 -- (-2945.313) (-2937.758) [-2934.903] (-2938.519) * (-2941.581) (-2941.551) [-2935.170] (-2941.679) -- 0:00:51
      662500 -- (-2940.085) (-2940.339) (-2937.913) [-2940.117] * (-2945.816) (-2940.180) [-2943.362] (-2940.706) -- 0:00:51
      663000 -- (-2939.863) [-2935.388] (-2946.890) (-2944.992) * (-2944.524) (-2956.447) [-2943.054] (-2938.351) -- 0:00:51
      663500 -- (-2937.856) (-2939.688) [-2937.903] (-2945.146) * (-2945.163) (-2939.997) (-2937.820) [-2943.285] -- 0:00:51
      664000 -- [-2944.277] (-2941.145) (-2942.033) (-2939.770) * [-2937.752] (-2938.234) (-2935.939) (-2941.210) -- 0:00:51
      664500 -- (-2939.030) [-2933.666] (-2937.255) (-2939.873) * [-2945.656] (-2945.600) (-2940.201) (-2939.745) -- 0:00:51
      665000 -- (-2941.497) (-2939.133) (-2941.448) [-2942.096] * (-2936.460) [-2943.961] (-2947.330) (-2937.856) -- 0:00:51

      Average standard deviation of split frequencies: 0.008494

      665500 -- (-2936.469) [-2938.685] (-2944.382) (-2937.518) * [-2937.959] (-2938.887) (-2941.527) (-2940.544) -- 0:00:51
      666000 -- (-2938.581) (-2948.754) (-2944.251) [-2941.685] * (-2938.626) (-2942.435) (-2940.262) [-2937.136] -- 0:00:51
      666500 -- (-2938.941) (-2935.944) (-2946.260) [-2938.050] * (-2940.683) [-2941.135] (-2939.590) (-2939.663) -- 0:00:51
      667000 -- (-2948.250) (-2948.088) (-2941.538) [-2944.320] * (-2935.497) (-2939.075) (-2943.139) [-2939.392] -- 0:00:50
      667500 -- [-2935.546] (-2941.288) (-2939.044) (-2937.116) * (-2937.587) (-2945.404) (-2939.202) [-2937.641] -- 0:00:50
      668000 -- (-2939.913) (-2942.957) (-2936.169) [-2938.240] * (-2937.699) (-2938.729) [-2939.389] (-2942.667) -- 0:00:50
      668500 -- [-2934.981] (-2945.927) (-2936.666) (-2941.774) * (-2939.272) (-2940.810) [-2941.863] (-2941.375) -- 0:00:50
      669000 -- (-2935.412) (-2942.211) (-2940.285) [-2933.947] * (-2937.570) (-2940.658) [-2939.841] (-2942.601) -- 0:00:50
      669500 -- (-2939.387) (-2936.545) (-2938.689) [-2941.583] * (-2937.111) (-2936.753) [-2936.423] (-2942.636) -- 0:00:50
      670000 -- (-2939.651) (-2940.613) (-2938.655) [-2936.629] * (-2940.258) (-2939.434) (-2949.330) [-2938.986] -- 0:00:50

      Average standard deviation of split frequencies: 0.009138

      670500 -- [-2942.037] (-2936.636) (-2936.180) (-2942.538) * [-2940.212] (-2940.967) (-2942.187) (-2936.615) -- 0:00:50
      671000 -- (-2940.593) (-2941.013) [-2941.355] (-2938.400) * (-2934.625) [-2941.635] (-2939.465) (-2936.099) -- 0:00:50
      671500 -- (-2940.367) [-2934.824] (-2941.049) (-2943.766) * (-2939.654) [-2936.915] (-2936.413) (-2944.037) -- 0:00:50
      672000 -- [-2943.451] (-2944.482) (-2936.567) (-2938.878) * (-2941.023) [-2938.817] (-2937.504) (-2940.555) -- 0:00:50
      672500 -- (-2943.334) (-2937.752) [-2944.499] (-2944.167) * (-2945.434) (-2934.952) [-2938.308] (-2940.839) -- 0:00:50
      673000 -- (-2943.787) [-2941.092] (-2941.259) (-2938.564) * (-2938.885) (-2937.431) (-2935.909) [-2936.598] -- 0:00:50
      673500 -- (-2947.122) [-2944.848] (-2937.435) (-2942.089) * (-2939.370) (-2939.509) [-2937.288] (-2940.850) -- 0:00:49
      674000 -- (-2942.777) (-2937.935) [-2937.777] (-2939.344) * (-2951.528) [-2937.961] (-2942.263) (-2937.660) -- 0:00:49
      674500 -- [-2936.488] (-2940.095) (-2939.838) (-2938.879) * (-2949.264) (-2946.185) (-2935.479) [-2937.309] -- 0:00:49
      675000 -- (-2942.150) (-2944.997) [-2935.068] (-2941.172) * (-2943.908) (-2944.162) [-2937.833] (-2946.134) -- 0:00:49

      Average standard deviation of split frequencies: 0.009065

      675500 -- (-2935.346) (-2944.338) [-2944.179] (-2939.190) * (-2941.172) (-2941.342) [-2940.782] (-2936.665) -- 0:00:49
      676000 -- (-2937.132) (-2940.020) (-2941.909) [-2939.837] * (-2951.441) (-2944.438) (-2940.746) [-2935.123] -- 0:00:49
      676500 -- (-2936.344) [-2937.708] (-2940.950) (-2937.164) * (-2945.001) (-2942.508) [-2942.267] (-2933.402) -- 0:00:49
      677000 -- (-2946.141) [-2936.588] (-2944.914) (-2938.758) * [-2942.423] (-2954.683) (-2943.329) (-2939.195) -- 0:00:49
      677500 -- (-2944.599) [-2932.475] (-2937.898) (-2938.868) * (-2935.697) (-2942.679) (-2935.489) [-2939.707] -- 0:00:49
      678000 -- (-2943.308) (-2940.303) [-2937.612] (-2938.329) * (-2940.618) [-2939.601] (-2948.340) (-2936.215) -- 0:00:49
      678500 -- (-2939.333) [-2939.715] (-2936.663) (-2954.014) * (-2940.587) (-2940.740) (-2945.333) [-2936.765] -- 0:00:49
      679000 -- (-2937.116) [-2939.174] (-2935.701) (-2938.990) * (-2938.555) (-2939.319) (-2947.869) [-2943.005] -- 0:00:49
      679500 -- (-2939.646) (-2939.783) [-2938.203] (-2942.055) * (-2941.407) (-2944.193) [-2940.347] (-2933.775) -- 0:00:49
      680000 -- (-2937.975) (-2939.171) [-2938.531] (-2937.525) * (-2940.470) [-2942.012] (-2937.885) (-2940.265) -- 0:00:48

      Average standard deviation of split frequencies: 0.009003

      680500 -- [-2936.168] (-2945.119) (-2941.048) (-2940.963) * (-2943.871) [-2940.175] (-2942.420) (-2947.557) -- 0:00:48
      681000 -- (-2944.396) (-2943.199) [-2935.373] (-2936.289) * [-2940.123] (-2939.998) (-2937.595) (-2947.448) -- 0:00:48
      681500 -- [-2939.791] (-2945.151) (-2941.290) (-2936.584) * (-2941.455) (-2945.553) (-2935.745) [-2939.591] -- 0:00:48
      682000 -- (-2940.545) [-2940.158] (-2937.610) (-2935.375) * [-2940.283] (-2935.436) (-2943.358) (-2937.055) -- 0:00:48
      682500 -- (-2936.423) (-2944.587) (-2945.186) [-2938.660] * [-2938.320] (-2955.082) (-2940.476) (-2939.110) -- 0:00:48
      683000 -- [-2941.409] (-2951.880) (-2942.907) (-2939.055) * [-2940.238] (-2937.117) (-2949.679) (-2944.908) -- 0:00:48
      683500 -- (-2940.178) (-2938.378) [-2941.193] (-2940.446) * (-2941.921) [-2939.606] (-2945.410) (-2941.424) -- 0:00:48
      684000 -- (-2938.297) (-2939.411) [-2939.817] (-2942.221) * (-2942.154) (-2936.517) [-2940.709] (-2939.610) -- 0:00:48
      684500 -- (-2936.155) (-2946.948) [-2940.845] (-2934.681) * [-2940.907] (-2938.709) (-2936.236) (-2942.398) -- 0:00:48
      685000 -- [-2937.972] (-2937.153) (-2940.546) (-2936.166) * (-2944.225) (-2939.871) (-2935.681) [-2941.055] -- 0:00:48

      Average standard deviation of split frequencies: 0.008933

      685500 -- [-2942.591] (-2940.024) (-2939.825) (-2943.374) * (-2939.735) (-2944.970) [-2936.666] (-2940.744) -- 0:00:48
      686000 -- [-2940.952] (-2937.402) (-2945.148) (-2939.385) * (-2940.721) (-2948.726) (-2943.078) [-2946.172] -- 0:00:48
      686500 -- (-2942.691) (-2938.660) [-2936.668] (-2943.139) * (-2939.483) [-2942.036] (-2935.645) (-2939.816) -- 0:00:47
      687000 -- [-2936.976] (-2937.312) (-2936.574) (-2941.099) * (-2937.875) [-2941.334] (-2946.964) (-2947.237) -- 0:00:47
      687500 -- [-2940.764] (-2941.359) (-2944.165) (-2938.755) * (-2938.415) [-2938.404] (-2940.072) (-2938.403) -- 0:00:47
      688000 -- (-2940.191) [-2939.984] (-2937.733) (-2941.305) * [-2938.288] (-2941.592) (-2938.687) (-2937.163) -- 0:00:47
      688500 -- (-2946.217) (-2941.079) (-2940.655) [-2937.426] * [-2945.787] (-2938.432) (-2937.707) (-2949.361) -- 0:00:47
      689000 -- (-2944.892) (-2940.627) (-2939.906) [-2937.787] * (-2943.056) (-2942.805) (-2942.503) [-2941.320] -- 0:00:47
      689500 -- (-2941.040) [-2937.928] (-2944.001) (-2940.938) * [-2931.986] (-2941.563) (-2941.127) (-2937.907) -- 0:00:47
      690000 -- (-2939.988) [-2944.123] (-2945.711) (-2935.348) * (-2938.283) (-2942.175) [-2938.519] (-2937.205) -- 0:00:47

      Average standard deviation of split frequencies: 0.008873

      690500 -- (-2937.656) (-2939.259) [-2937.208] (-2936.506) * (-2936.237) (-2941.143) (-2939.999) [-2938.940] -- 0:00:47
      691000 -- (-2936.328) (-2938.057) [-2941.280] (-2939.433) * (-2941.122) (-2941.477) (-2943.221) [-2940.183] -- 0:00:47
      691500 -- (-2932.747) (-2938.186) (-2937.421) [-2940.878] * [-2940.175] (-2942.275) (-2941.383) (-2947.995) -- 0:00:47
      692000 -- (-2940.118) (-2939.282) (-2939.455) [-2939.828] * [-2940.102] (-2935.885) (-2937.903) (-2942.218) -- 0:00:47
      692500 -- (-2939.154) (-2943.440) (-2937.557) [-2937.744] * (-2943.211) (-2942.543) (-2940.364) [-2942.941] -- 0:00:47
      693000 -- (-2938.613) [-2940.416] (-2941.780) (-2939.618) * [-2946.091] (-2940.372) (-2936.403) (-2937.864) -- 0:00:46
      693500 -- (-2943.918) [-2936.651] (-2941.846) (-2940.206) * [-2935.545] (-2936.663) (-2941.721) (-2938.739) -- 0:00:46
      694000 -- (-2952.755) (-2942.025) [-2946.057] (-2947.141) * (-2940.205) (-2940.694) (-2943.474) [-2944.261] -- 0:00:46
      694500 -- [-2938.362] (-2940.452) (-2938.574) (-2941.684) * [-2937.518] (-2933.651) (-2938.190) (-2937.235) -- 0:00:46
      695000 -- [-2938.020] (-2940.458) (-2948.599) (-2935.594) * [-2934.597] (-2939.917) (-2942.949) (-2939.775) -- 0:00:46

      Average standard deviation of split frequencies: 0.010160

      695500 -- (-2936.501) (-2944.678) [-2937.795] (-2936.879) * (-2940.383) [-2943.795] (-2945.969) (-2947.174) -- 0:00:46
      696000 -- (-2940.068) [-2944.210] (-2942.257) (-2937.924) * (-2944.553) (-2944.400) [-2936.810] (-2945.846) -- 0:00:46
      696500 -- (-2937.199) (-2943.321) [-2937.781] (-2937.607) * [-2938.880] (-2938.213) (-2934.462) (-2958.210) -- 0:00:46
      697000 -- (-2936.806) (-2944.358) [-2940.917] (-2938.460) * (-2939.267) (-2941.506) [-2936.322] (-2950.811) -- 0:00:46
      697500 -- (-2940.690) (-2943.696) (-2939.397) [-2939.040] * [-2934.202] (-2940.489) (-2936.874) (-2942.424) -- 0:00:46
      698000 -- (-2943.227) (-2942.118) (-2933.172) [-2937.619] * [-2940.933] (-2941.232) (-2937.379) (-2949.739) -- 0:00:46
      698500 -- (-2945.521) (-2940.408) [-2934.871] (-2939.259) * (-2945.687) [-2941.075] (-2940.861) (-2940.519) -- 0:00:46
      699000 -- (-2949.703) [-2943.945] (-2938.444) (-2943.760) * (-2942.682) (-2936.402) [-2942.657] (-2940.372) -- 0:00:46
      699500 -- (-2938.283) (-2942.143) [-2939.084] (-2940.266) * (-2943.625) (-2942.044) [-2939.422] (-2937.733) -- 0:00:45
      700000 -- [-2946.637] (-2944.479) (-2940.678) (-2937.753) * (-2938.635) (-2941.110) (-2936.788) [-2934.501] -- 0:00:45

      Average standard deviation of split frequencies: 0.010092

      700500 -- (-2940.157) (-2936.793) [-2939.815] (-2939.250) * [-2940.006] (-2940.419) (-2941.068) (-2936.498) -- 0:00:45
      701000 -- (-2940.146) (-2940.971) [-2938.495] (-2939.428) * (-2937.671) (-2942.193) (-2946.231) [-2936.814] -- 0:00:45
      701500 -- [-2932.688] (-2936.423) (-2933.327) (-2936.616) * [-2937.353] (-2938.265) (-2936.888) (-2938.366) -- 0:00:45
      702000 -- (-2934.289) (-2936.120) [-2938.522] (-2936.593) * (-2935.774) (-2938.508) [-2940.278] (-2936.371) -- 0:00:45
      702500 -- (-2940.196) [-2936.765] (-2936.908) (-2938.426) * [-2934.076] (-2938.945) (-2939.940) (-2939.055) -- 0:00:45
      703000 -- (-2935.555) (-2937.796) (-2937.844) [-2942.457] * [-2935.735] (-2939.027) (-2935.344) (-2942.638) -- 0:00:45
      703500 -- [-2933.985] (-2941.307) (-2939.057) (-2940.480) * (-2936.234) [-2940.056] (-2940.524) (-2942.294) -- 0:00:45
      704000 -- [-2940.763] (-2938.440) (-2935.501) (-2940.167) * (-2941.505) (-2937.702) [-2948.029] (-2939.031) -- 0:00:45
      704500 -- [-2944.636] (-2940.290) (-2942.670) (-2941.035) * [-2944.216] (-2942.554) (-2938.424) (-2941.750) -- 0:00:45
      705000 -- [-2941.206] (-2936.893) (-2940.306) (-2948.118) * (-2939.163) (-2937.559) [-2937.124] (-2941.707) -- 0:00:45

      Average standard deviation of split frequencies: 0.010683

      705500 -- (-2944.932) [-2939.359] (-2945.641) (-2938.183) * (-2942.416) [-2940.194] (-2937.560) (-2950.629) -- 0:00:45
      706000 -- (-2939.170) (-2933.713) [-2932.200] (-2949.712) * [-2943.555] (-2941.617) (-2938.664) (-2939.914) -- 0:00:44
      706500 -- (-2947.376) (-2942.291) [-2938.873] (-2940.026) * (-2937.814) (-2933.992) (-2940.640) [-2941.645] -- 0:00:44
      707000 -- [-2948.168] (-2940.668) (-2939.192) (-2939.116) * [-2939.959] (-2935.623) (-2948.807) (-2940.017) -- 0:00:44
      707500 -- (-2942.232) (-2951.553) (-2939.202) [-2939.337] * (-2941.161) (-2940.264) [-2939.654] (-2937.645) -- 0:00:44
      708000 -- [-2939.226] (-2938.140) (-2942.602) (-2937.623) * (-2940.359) (-2938.162) (-2939.911) [-2938.003] -- 0:00:44
      708500 -- (-2938.297) [-2933.392] (-2942.671) (-2938.618) * (-2933.894) (-2939.983) (-2940.005) [-2939.500] -- 0:00:44
      709000 -- (-2938.548) (-2936.143) (-2943.927) [-2935.957] * (-2939.388) [-2937.343] (-2939.634) (-2934.834) -- 0:00:44
      709500 -- (-2947.052) (-2937.201) [-2947.823] (-2941.840) * (-2937.842) (-2940.572) (-2940.959) [-2940.541] -- 0:00:44
      710000 -- (-2938.258) [-2935.375] (-2937.650) (-2937.234) * [-2940.031] (-2941.919) (-2944.666) (-2936.801) -- 0:00:44

      Average standard deviation of split frequencies: 0.009950

      710500 -- (-2936.106) (-2941.473) [-2936.533] (-2940.067) * [-2941.090] (-2938.377) (-2937.522) (-2940.003) -- 0:00:44
      711000 -- [-2937.281] (-2937.071) (-2937.727) (-2940.934) * (-2939.372) (-2942.582) (-2941.457) [-2935.481] -- 0:00:44
      711500 -- (-2938.508) (-2935.924) [-2938.010] (-2935.716) * [-2936.745] (-2938.551) (-2938.729) (-2939.428) -- 0:00:44
      712000 -- [-2936.903] (-2938.745) (-2938.046) (-2943.630) * (-2938.295) [-2939.643] (-2936.469) (-2941.495) -- 0:00:44
      712500 -- [-2937.486] (-2947.419) (-2942.184) (-2937.957) * (-2936.462) (-2940.917) [-2935.832] (-2946.178) -- 0:00:43
      713000 -- (-2938.767) (-2941.942) [-2934.231] (-2945.245) * (-2958.467) (-2942.670) [-2944.681] (-2939.172) -- 0:00:43
      713500 -- (-2939.448) (-2934.208) (-2936.234) [-2940.468] * [-2936.389] (-2941.256) (-2943.372) (-2938.471) -- 0:00:43
      714000 -- (-2942.167) (-2944.845) (-2936.294) [-2936.833] * (-2943.376) [-2940.201] (-2940.804) (-2945.146) -- 0:00:43
      714500 -- (-2944.408) (-2942.132) [-2941.116] (-2933.619) * (-2938.976) [-2935.799] (-2940.834) (-2940.420) -- 0:00:43
      715000 -- (-2939.993) (-2934.435) [-2934.888] (-2936.551) * (-2941.212) [-2936.559] (-2943.067) (-2935.808) -- 0:00:43

      Average standard deviation of split frequencies: 0.009217

      715500 -- [-2936.874] (-2937.512) (-2935.867) (-2942.111) * (-2945.096) (-2940.809) (-2935.346) [-2937.340] -- 0:00:43
      716000 -- (-2942.324) [-2940.862] (-2945.052) (-2938.161) * [-2942.631] (-2940.804) (-2943.110) (-2935.149) -- 0:00:43
      716500 -- (-2936.527) (-2943.906) [-2939.787] (-2935.784) * (-2939.934) (-2945.242) [-2935.890] (-2941.772) -- 0:00:43
      717000 -- (-2938.637) (-2943.484) (-2935.266) [-2939.682] * (-2941.675) [-2938.245] (-2939.016) (-2944.313) -- 0:00:43
      717500 -- (-2945.768) (-2944.436) [-2938.809] (-2940.101) * (-2936.305) (-2940.962) (-2936.916) [-2943.523] -- 0:00:43
      718000 -- (-2941.182) (-2944.540) (-2939.320) [-2947.405] * (-2939.704) (-2939.450) (-2947.701) [-2934.265] -- 0:00:43
      718500 -- (-2938.564) (-2943.115) [-2945.507] (-2941.847) * (-2936.168) (-2938.528) (-2944.826) [-2937.611] -- 0:00:43
      719000 -- (-2938.077) [-2937.499] (-2944.466) (-2944.695) * [-2935.610] (-2941.860) (-2940.134) (-2942.120) -- 0:00:42
      719500 -- (-2944.559) (-2939.838) (-2946.038) [-2940.618] * (-2944.589) (-2937.451) [-2941.078] (-2938.082) -- 0:00:42
      720000 -- [-2940.877] (-2941.866) (-2939.157) (-2944.405) * [-2938.578] (-2936.601) (-2936.331) (-2935.600) -- 0:00:42

      Average standard deviation of split frequencies: 0.009158

      720500 -- (-2935.990) (-2942.334) (-2938.249) [-2933.978] * (-2936.607) (-2935.256) (-2940.611) [-2940.519] -- 0:00:42
      721000 -- (-2936.295) (-2955.720) (-2939.360) [-2935.146] * (-2939.134) (-2938.365) (-2943.585) [-2938.704] -- 0:00:42
      721500 -- (-2937.716) (-2947.074) [-2937.882] (-2935.695) * [-2936.487] (-2938.519) (-2946.058) (-2937.061) -- 0:00:42
      722000 -- (-2942.772) (-2939.260) (-2941.371) [-2939.473] * (-2941.543) [-2934.917] (-2943.579) (-2942.813) -- 0:00:42
      722500 -- [-2941.580] (-2942.315) (-2943.309) (-2947.493) * (-2939.081) [-2938.842] (-2935.013) (-2940.022) -- 0:00:42
      723000 -- [-2933.748] (-2935.987) (-2942.747) (-2940.304) * (-2934.562) (-2941.416) (-2935.332) [-2936.748] -- 0:00:42
      723500 -- [-2934.784] (-2944.790) (-2938.277) (-2937.856) * (-2942.225) (-2940.695) (-2943.260) [-2940.903] -- 0:00:42
      724000 -- [-2941.004] (-2941.452) (-2946.661) (-2936.672) * (-2941.905) (-2937.834) (-2937.106) [-2934.227] -- 0:00:42
      724500 -- (-2939.677) [-2941.849] (-2949.451) (-2944.684) * (-2943.588) (-2939.257) [-2937.449] (-2939.131) -- 0:00:42
      725000 -- (-2937.053) [-2941.030] (-2935.931) (-2943.096) * [-2939.016] (-2951.593) (-2942.180) (-2945.777) -- 0:00:42

      Average standard deviation of split frequencies: 0.006493

      725500 -- (-2939.020) (-2939.519) [-2942.021] (-2941.304) * (-2939.009) [-2943.945] (-2945.060) (-2935.885) -- 0:00:41
      726000 -- (-2938.916) (-2941.423) (-2947.464) [-2939.281] * [-2938.652] (-2938.355) (-2939.598) (-2938.210) -- 0:00:41
      726500 -- (-2945.942) [-2943.065] (-2940.762) (-2943.339) * (-2934.122) (-2944.472) (-2943.268) [-2937.229] -- 0:00:41
      727000 -- (-2937.321) [-2936.968] (-2938.568) (-2941.493) * (-2943.063) (-2937.586) (-2942.251) [-2936.947] -- 0:00:41
      727500 -- (-2939.597) [-2938.462] (-2941.252) (-2936.073) * (-2940.180) (-2941.027) [-2939.684] (-2935.995) -- 0:00:41
      728000 -- (-2935.946) (-2935.327) (-2939.747) [-2941.530] * (-2942.051) [-2939.132] (-2940.736) (-2933.395) -- 0:00:41
      728500 -- [-2939.373] (-2939.319) (-2935.966) (-2941.032) * (-2940.529) (-2942.392) (-2952.311) [-2938.133] -- 0:00:41
      729000 -- [-2945.776] (-2942.305) (-2946.218) (-2943.500) * (-2942.290) (-2940.191) [-2937.609] (-2941.757) -- 0:00:41
      729500 -- (-2941.954) (-2936.167) [-2935.316] (-2940.932) * (-2944.934) (-2944.654) (-2940.017) [-2943.058] -- 0:00:41
      730000 -- [-2937.395] (-2942.231) (-2934.176) (-2936.946) * (-2941.112) [-2934.419] (-2939.798) (-2952.389) -- 0:00:41

      Average standard deviation of split frequencies: 0.007097

      730500 -- (-2939.757) (-2936.892) (-2941.278) [-2943.216] * (-2938.464) (-2946.844) [-2940.893] (-2941.644) -- 0:00:41
      731000 -- (-2944.432) (-2938.837) [-2939.238] (-2940.151) * [-2935.527] (-2942.922) (-2942.585) (-2946.999) -- 0:00:41
      731500 -- (-2951.792) [-2939.297] (-2940.674) (-2942.019) * [-2941.082] (-2935.167) (-2937.864) (-2947.798) -- 0:00:41
      732000 -- (-2943.730) (-2937.215) [-2940.925] (-2946.710) * [-2934.512] (-2941.020) (-2937.786) (-2936.539) -- 0:00:41
      732500 -- [-2943.182] (-2940.684) (-2940.041) (-2936.971) * (-2937.018) [-2939.003] (-2939.724) (-2941.894) -- 0:00:40
      733000 -- (-2940.327) [-2934.601] (-2936.109) (-2939.795) * (-2939.494) (-2943.392) [-2942.268] (-2947.797) -- 0:00:40
      733500 -- (-2945.150) (-2932.810) (-2935.784) [-2939.948] * (-2940.638) (-2941.671) [-2934.711] (-2944.531) -- 0:00:40
      734000 -- [-2940.995] (-2938.285) (-2937.276) (-2943.907) * (-2938.370) [-2935.993] (-2937.860) (-2935.797) -- 0:00:40
      734500 -- (-2939.465) [-2938.885] (-2940.299) (-2942.015) * (-2938.328) (-2938.295) [-2939.135] (-2945.414) -- 0:00:40
      735000 -- (-2935.868) (-2940.288) [-2939.356] (-2940.549) * (-2949.932) [-2937.053] (-2936.173) (-2936.087) -- 0:00:40

      Average standard deviation of split frequencies: 0.007045

      735500 -- [-2935.383] (-2933.320) (-2941.251) (-2938.276) * (-2942.159) (-2946.027) (-2936.833) [-2942.881] -- 0:00:40
      736000 -- [-2933.939] (-2940.931) (-2937.104) (-2937.198) * [-2940.735] (-2937.116) (-2943.464) (-2940.601) -- 0:00:40
      736500 -- [-2938.049] (-2937.070) (-2943.090) (-2944.627) * (-2932.182) [-2939.032] (-2944.544) (-2941.872) -- 0:00:40
      737000 -- (-2939.835) [-2943.240] (-2939.801) (-2938.142) * (-2943.045) (-2937.223) [-2946.869] (-2941.947) -- 0:00:40
      737500 -- (-2944.917) [-2936.976] (-2938.866) (-2933.635) * (-2950.378) (-2942.647) [-2939.577] (-2944.337) -- 0:00:40
      738000 -- (-2938.760) (-2941.404) (-2936.883) [-2937.625] * (-2935.561) (-2944.553) (-2946.024) [-2935.304] -- 0:00:40
      738500 -- [-2941.651] (-2935.059) (-2938.783) (-2945.722) * [-2938.031] (-2936.561) (-2939.587) (-2934.917) -- 0:00:40
      739000 -- [-2944.724] (-2936.561) (-2942.958) (-2938.538) * (-2941.164) (-2945.240) [-2941.103] (-2936.824) -- 0:00:39
      739500 -- (-2945.005) (-2936.507) (-2939.223) [-2933.595] * (-2936.833) (-2939.383) [-2942.052] (-2936.786) -- 0:00:39
      740000 -- (-2948.550) (-2938.803) (-2944.985) [-2941.157] * (-2946.478) [-2945.386] (-2941.987) (-2937.387) -- 0:0