--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Wed Nov 16 23:51:51 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/257/Gfat1-PF/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2935.96 -2944.93 2 -2936.07 -2946.00 -------------------------------------- TOTAL -2936.02 -2945.60 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.912159 0.015608 0.690897 1.174277 0.900269 1475.62 1488.31 1.000 r(A<->C){all} 0.125304 0.000816 0.068366 0.179000 0.123795 934.77 1145.14 1.000 r(A<->G){all} 0.373520 0.003134 0.265740 0.481918 0.370770 798.46 867.97 1.000 r(A<->T){all} 0.058165 0.000700 0.011073 0.111344 0.055579 835.86 959.69 1.000 r(C<->G){all} 0.012636 0.000087 0.000001 0.030822 0.010816 1318.22 1324.31 1.000 r(C<->T){all} 0.368232 0.002515 0.272497 0.467975 0.367262 844.67 945.65 1.000 r(G<->T){all} 0.062142 0.000382 0.026698 0.101515 0.060087 1227.71 1228.66 1.000 pi(A){all} 0.229834 0.000119 0.207942 0.250007 0.229575 1227.82 1261.00 1.000 pi(C){all} 0.275758 0.000125 0.254969 0.298191 0.275586 1501.00 1501.00 1.000 pi(G){all} 0.260222 0.000132 0.237722 0.282347 0.260090 895.06 1198.03 1.000 pi(T){all} 0.234186 0.000115 0.212297 0.254238 0.234397 1202.43 1265.64 1.000 alpha{1,2} 0.030872 0.000370 0.000153 0.063604 0.029572 1298.22 1344.84 1.000 alpha{3} 3.881736 1.109113 1.913491 5.866375 3.752311 1501.00 1501.00 1.000 pinvar{all} 0.446452 0.001438 0.371988 0.520269 0.446483 1411.94 1431.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2671.201949 Model 2: PositiveSelection -2671.201949 Model 0: one-ratio -2672.907872 Model 3: discrete -2670.402957 Model 7: beta -2670.827861 Model 8: beta&w>1 -2670.827932 Model 0 vs 1 3.411846000000878 Model 2 vs 1 0.0 Model 8 vs 7 1.4199999986885814E-4
>C1 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C2 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C3 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C4 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=434 C1 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS C2 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS C3 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS C4 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS ************************************************** C1 LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD C2 LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD C3 LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD C4 LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD ************************************************** C1 GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM C2 GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM C3 GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM C4 GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM ************************************************** C1 VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT C2 VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT C3 VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT C4 VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT ************************************************** C1 NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL C2 NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL C3 NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL C4 NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL ************************************************** C1 SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY C2 SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY C3 SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY C4 SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY **************:****** **:**:**:******************* C1 NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP C2 NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP C3 NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP C4 NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP ************************************************** C1 VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI C2 VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI C3 VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI C4 VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI ******************************:******************* C1 LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE C2 LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE C3 LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE C4 LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE ********************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 434 type PROTEIN Struct Unchecked Input File /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 434 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [5208] Library Relaxation: Multi_proc [72] Relaxation Summary: [5208]--->[5208] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/257/Gfat1-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.260 Mb, Max= 30.585 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C2 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C3 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C4 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE FORMAT of file /tmp/tmp6783399981136000706aln Not Supported[FATAL:T-COFFEE] >C1 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C2 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C3 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C4 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:434 S:100 BS:434 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 99.31 C1 C2 99.31 TOP 1 0 99.31 C2 C1 99.31 BOT 0 2 99.54 C1 C3 99.54 TOP 2 0 99.54 C3 C1 99.54 BOT 0 3 98.85 C1 C4 98.85 TOP 3 0 98.85 C4 C1 98.85 BOT 1 2 99.77 C2 C3 99.77 TOP 2 1 99.77 C3 C2 99.77 BOT 1 3 98.85 C2 C4 98.85 TOP 3 1 98.85 C4 C2 98.85 BOT 2 3 99.08 C3 C4 99.08 TOP 3 2 99.08 C4 C3 99.08 AVG 0 C1 * 99.23 AVG 1 C2 * 99.31 AVG 2 C3 * 99.46 AVG 3 C4 * 98.92 TOT TOT * 99.23 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTTTTCGCATCGGACGCCTC C2 ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC C3 ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC C4 ATGCCCTTGGAAGAAAAGGAAGTAGAATACTTCTTCGCATCGGATGCCTC **************.********:**.***** *****.***** ***** C1 AGCCGTCATAGAGCACACTAACCGGGTCATCTATTTGGAGGACGACGATG C2 AGCCGTCATAGAGCACACTAACAGGGTCATCTATTTGGAGGACGACGATG C3 AGCCGTCATAGAGCACACTAACCGAGTCATCTATTTGGAGGACGACGATG C4 GGCCGTCATTGAGCACACTAACCGGGTGATCTATTTGGAGGACGACGATG .********:************.*.** ********************** C1 TTGCTGCTGTTCGGGATGGAACTTTGAGTATACATCGCCTAAAGAAGAGC C2 TTGCTGCTGTTCGGGATGGTACATTGAGTATCCATCGCCTGAAGAAGAGC C3 TTGCTGCTGTTCGGGATGGTACCTTGAGTATCCATCGCCTAAAGAAGAGC C4 TGGCCGCAGTTCGGGACGGAACTCTGAGTATTCATCGTCTAAAGAAAAGT * ** **:******** **:** ******* ***** **.*****.** C1 CTGGATGATCCGCACGCTCGCGAAATCACTACCCTAAAAATGGAAATTCA C2 CTGGATGATCCGCATGCTCGTGAAATCACTACCCTAAAGATGGAAATTCA C3 CTGGATGATCCGCACGCGCGCGAAATCACTACCCTGAAGATGGAAATTCA C4 TTAGATGACCCGCATGCCCGTGAGATCACTACATTAAAGATGGAAATCCA *.***** ***** ** ** **.********. *.**.******** ** C1 ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG C2 ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTTG C3 ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG C4 ACAGATCATGAAGGGCAACTATGACTACTTCATGCAGAAGGAGATTTTTG ***************.*********** ** *****.*********** * C1 AGCAGCCCGACTCCGTGGTGAACACAATGCGCGGTCGCGTCCGCTTCGAT C2 AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT C3 AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT C4 AGCAGCCCGACTCTGTGGTCAACACGATGCGTGGTCGCGTTCGCTTCGAC ************* ***** ** **.***** ******** ******** C1 GGTAACGCCATAGTGCTCGGCGGGATCAAAGACTACATTCCTGAAATCAA C2 GGGAACGCCATAGTGCTCGGCGGAATTAAGGACTACATTCCTGAAATCAA C3 GGGAACGCCATAGTGCTCGGCGGAATCAAAGACTACATTCCTGAAATCAA C4 GGTAACGCGATTGTGCTCGGCGGTATCAAGGACTACATTCCGGAAATCAA ** ***** **:*********** ** **.*********** ******** C1 ACGCTGTCGACGCCTGATGTTGATTGGATGTGGCACATCTTACCACAGCG C2 ACGCTGTCGACGCCTGATGTTGATAGGATGTGGCACATCCTACCACAGCG C3 ACGCTGTCGACGCCTGATGTTGATTGGCTGTGGCACATCTTACCACAGCG C4 ACGTTGTCGCCGTCTCATGCTGATCGGGTGTGGCACGTCTTACCACAGCG *** *****.** ** *** **** ** ********.** ********** C1 CTGTAGCCACTAGGCAGCTGCTCGAAGAACTCACAGAGCTTCCCGTGATG C2 CTGTTGCCACTAGACAGCTTTTAGAAGAGCTCACGGAGCTCCCCGTGATG C3 CTGTTGCCACTAGGCAGCTTCTGGAAGAGCTCACGGAGCTTCCCGTGATG C4 CCGTAGCCACCAGGCAGCTGCTCGAAGAGCTCACTGAGCTTCCTGTCATG * **:***** **.***** * *****.***** ***** ** ** *** C1 GTTGAGCTGGCTTCCGACTTTTTAGACCGAAACACTCCTATTTTTCGAGA C2 GTTGAGCTTGCTTCCGATTTCTTAGACCGGAACACGCCTATTTTCAGAGA C3 GTCGAGCTGGCTTCCGATTTCTTAGACCGGAATACGCCTATTTTCCGAGA C4 GTCGAGCTGGCGTCTGACTTCCTGGACCGCAACACACCAATCTTCCGCGA ** ***** ** ** ** ** *.***** ** ** **:** ** .*.** C1 CGACGTCTGCTTTTTTATATCGCAGTCCGGAGAGACTGCCGACACCCTGA C2 CGACGTCTGCTTCTTCATATCGCAGTCTGGAGAGACTGCCGACACCCTAA C3 CGACGTCTGCTTCTTCATATCGCAGTCCGGAGAGACTGCCGACACCCTGA C4 CGACGTCTGCTTCTTTATATCGCAGTCCGGCGAGACGGCGGACACCCTAA ************ ** *********** **.***** ** ********.* C1 TGGCCTTACGTTACTGTAAGCAGCGAGGAGCCCTGATTGTGGGCATTACG C2 TGGCCTTGCGCTACTGTAAGCAGCGGGGAGCTCTGATTGTGGGAATTACG C3 TGGCCTTGCGTTACTGTAAGCAGCGGGGAGCCCTAATTGTGGGCATTACG C4 TGGCTTTGCGATACTGCAAACAGCGGGGAGCCCTGATTGTGGGCATTACA **** **.** ***** **.*****.***** **.********.*****. C1 AATACCGTAGGCAGCAGCATATGTCGGGAATCGCATTGTGGAGTGCACAT C2 AATACCGTAGGTAGCAGCATCTGTCGCGAATCGCATTGTGGAGTGCACAT C3 AATACCGTAGGCAGCAGCATCTGTCGCGAATCGCATTGTGGAGTTCACAT C4 AACACTGTAGGCAGCAGTATCTGCCGGGAATCGCATTGTGGAGTCCACAT ** ** ***** ***** **.** ** ***************** ***** C1 TAATGCCGGACCAGAGATAGGCGTGGCCTCGACCAAGGCATACACCTCCC C2 AAACGCTGGGCCAGAGATAGGCGTAGCCTCGACCAAGGCCTACACCTCCC C3 TAACGCCGGCCCAGAGATAGGCGTGGCCTCGACCAAGGCCTACACCTCCC C4 TAACGCTGGCCCCGAGATTGGAGTGGCCTCTACAAAGGCATACACCTCGC :** ** ** **.*****:**.**.***** **.*****.******** * C1 AATTCATTTCCCTGGTGATGTTCGCTCTAGTTATGTCCGAAGATCGACTG C2 AGTTCATTTCTTTGGTGATGTTCGCTCTAGTTATGTCCGAGGATCGGCTG C3 AGTTCATTTCCCTGGTGATGTTCGCTCTGGTTATGTCCGAGGATCGGCTG C4 AGTTCATTTCCCTGGTGATGTTCGCACTGGTTATGTCAGAGGATCGTCTT *.******** *************:**.********.**.***** ** C1 TCACTGCAACAGCGACGGCTTGAGATTCTGCAGGCGTTGTCCAAGCTCGC C2 TCACTGCAGCAGCGACGGCTTGAAATTCTGCAGGCGTTGTCCAATCTCGC C3 TCATTGCAACAGCGACGGCTGGAGATTCTGCAGGCGTTGTCAAAGCTCGC C4 TCACTGCAACAGCGACGGCTGGAGATCCTGCAAGCGCTGTCCAAGCTTGC *** ****.*********** **.** *****.*** ****.** ** ** C1 GGATCAAATCCGAGACGTTCTGCAGCTGGACTCCAAAGTTAAAGAACTGG C2 GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAGGTTCAAGAACTGG C3 GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAAGTTCAAGAACTGG C4 TGACCAAATCCGCGAAGTTCTCAAGCTTGATACAAAAGTTCAAGAGCTGG ** ********.*..***** .**** ** :*.**.***.****.**** C1 CCAAAGACCTATACCAACACAAGTCGCTTCTGATAATGGGTAGGGGCTAC C2 CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC C3 CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC C4 CCAAAGACCTTTACCAACACAAGTCGCTACTTATCATGGGTCGCGGCTAC **********:**************.**:** **.******.* ****** C1 AACTTTGCCACTTGCCTAGAAGGTGCATTGAAAGTCAAAGAGTTGACTTA C2 AACTTTGCCACCTGCCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA C3 AACTTTGCCACCTGTCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA C4 AATTTCGCAACCTGTCTGGAAGGTGCCCTGAAAGTCAAGGAGCTGACCTA ** ** **.** ** **.********. **********.*** **** ** C1 CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG C2 CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG C3 CATGCACAGTGAGGGCATCATGGCTGGTGAATTGAAGCACGGTCCACTGG C4 CATGCACAGCGAGGGCATTATGGCCGGTGAACTAAAGCACGGCCCTCTGG ********* ******** ***** ****** *.******** **:**** C1 CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTGCGGGACCCC C2 CTCTTGTAGACGACTCCATGCCCGTGCTGATGATTGTCTTGCGGGACCCC C3 CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTACGCGACCCC C4 CCCTCGTGGACGACTCCATGCCAGTTCTAATGATAGTCCTTCGGGACCCC * ** **.**************.** **.*****:** * ** ****** C1 GTTTACGTAAAGTGCATGAACGCTCTACAGCAGGTCACATCCCGCAAAGG C2 GTTTACGTAAAGTGCATGAACGCCTTACAACAGGTAACATCCCGCAAGGG C3 GTTTACGTAAAGTGCATGAACGCTCTACAACAGGTCACATCCCGCAAGGG C4 GTTTATGTCAAGTGCATGAACGCTCTGCAGCAGGTCACATCGCGCAAGGG ***** **.************** *.**.*****.***** *****.** C1 ATGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT C2 CTGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT C3 CTGCCCGATTATTATCTGCGAGGAAGGCGACGAGGAGACCAAGGCTTTCT C4 CTGCCCTATTATTATTTGTGAGGAGGGAGACGAGGAGACCCAGGCCTTCT .***** ******** ** *****.**.************.**** **** C1 CCTCCCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT C2 CCTCTCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT C3 CTTCCCGCCATCTGGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT C4 CATCCCGGCACCTCGAGATCCCTCGCACCGTTGACTGTCTGCAGGGAATT * ** ** ** ** ***** *********** ***** *****.****** C1 CTCACCGTTATCCCAATGCAACTACTGTCTTATCATATTGCCGTGCTTCG C2 CTCACCGTTATACCAATGCAACTGCTGTCTTATCATATTGCCGTTCTCCG C3 CTCACTGTTATCCCAATGCAACTGCTGTCTTATCATATTGCCGTGCTCCG C4 CTCACCGTTATTCCCATGCAACTCTTATCCTATCATATTGCCGTGCTGCG ***** ***** **.******** *.** ************** ** ** C1 CGGATGCGACGTTGACTGTCCTAGAAACTTAGCAAAGTCTGTGACAGTTG C2 CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAGTCCGTCACAGTTG C3 CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAATCCGTGACAGTTG C4 CGGGTGCGATGTTGACTGTCCTAGAAACCTGGCCAAGTCCGTGACGGTTG ***.***** *********** ****** *.**.**.** ** **.**** C1 AG C2 AG C3 AG C4 AG ** >C1 ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTTTTCGCATCGGACGCCTC AGCCGTCATAGAGCACACTAACCGGGTCATCTATTTGGAGGACGACGATG TTGCTGCTGTTCGGGATGGAACTTTGAGTATACATCGCCTAAAGAAGAGC CTGGATGATCCGCACGCTCGCGAAATCACTACCCTAAAAATGGAAATTCA ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG AGCAGCCCGACTCCGTGGTGAACACAATGCGCGGTCGCGTCCGCTTCGAT GGTAACGCCATAGTGCTCGGCGGGATCAAAGACTACATTCCTGAAATCAA ACGCTGTCGACGCCTGATGTTGATTGGATGTGGCACATCTTACCACAGCG CTGTAGCCACTAGGCAGCTGCTCGAAGAACTCACAGAGCTTCCCGTGATG GTTGAGCTGGCTTCCGACTTTTTAGACCGAAACACTCCTATTTTTCGAGA CGACGTCTGCTTTTTTATATCGCAGTCCGGAGAGACTGCCGACACCCTGA TGGCCTTACGTTACTGTAAGCAGCGAGGAGCCCTGATTGTGGGCATTACG AATACCGTAGGCAGCAGCATATGTCGGGAATCGCATTGTGGAGTGCACAT TAATGCCGGACCAGAGATAGGCGTGGCCTCGACCAAGGCATACACCTCCC AATTCATTTCCCTGGTGATGTTCGCTCTAGTTATGTCCGAAGATCGACTG TCACTGCAACAGCGACGGCTTGAGATTCTGCAGGCGTTGTCCAAGCTCGC GGATCAAATCCGAGACGTTCTGCAGCTGGACTCCAAAGTTAAAGAACTGG CCAAAGACCTATACCAACACAAGTCGCTTCTGATAATGGGTAGGGGCTAC AACTTTGCCACTTGCCTAGAAGGTGCATTGAAAGTCAAAGAGTTGACTTA CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTGCGGGACCCC GTTTACGTAAAGTGCATGAACGCTCTACAGCAGGTCACATCCCGCAAAGG ATGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT CCTCCCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT CTCACCGTTATCCCAATGCAACTACTGTCTTATCATATTGCCGTGCTTCG CGGATGCGACGTTGACTGTCCTAGAAACTTAGCAAAGTCTGTGACAGTTG AG >C2 ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC AGCCGTCATAGAGCACACTAACAGGGTCATCTATTTGGAGGACGACGATG TTGCTGCTGTTCGGGATGGTACATTGAGTATCCATCGCCTGAAGAAGAGC CTGGATGATCCGCATGCTCGTGAAATCACTACCCTAAAGATGGAAATTCA ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTTG AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT GGGAACGCCATAGTGCTCGGCGGAATTAAGGACTACATTCCTGAAATCAA ACGCTGTCGACGCCTGATGTTGATAGGATGTGGCACATCCTACCACAGCG CTGTTGCCACTAGACAGCTTTTAGAAGAGCTCACGGAGCTCCCCGTGATG GTTGAGCTTGCTTCCGATTTCTTAGACCGGAACACGCCTATTTTCAGAGA CGACGTCTGCTTCTTCATATCGCAGTCTGGAGAGACTGCCGACACCCTAA TGGCCTTGCGCTACTGTAAGCAGCGGGGAGCTCTGATTGTGGGAATTACG AATACCGTAGGTAGCAGCATCTGTCGCGAATCGCATTGTGGAGTGCACAT AAACGCTGGGCCAGAGATAGGCGTAGCCTCGACCAAGGCCTACACCTCCC AGTTCATTTCTTTGGTGATGTTCGCTCTAGTTATGTCCGAGGATCGGCTG TCACTGCAGCAGCGACGGCTTGAAATTCTGCAGGCGTTGTCCAATCTCGC GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAGGTTCAAGAACTGG CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC AACTTTGCCACCTGCCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG CTCTTGTAGACGACTCCATGCCCGTGCTGATGATTGTCTTGCGGGACCCC GTTTACGTAAAGTGCATGAACGCCTTACAACAGGTAACATCCCGCAAGGG CTGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT CCTCTCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT CTCACCGTTATACCAATGCAACTGCTGTCTTATCATATTGCCGTTCTCCG CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAGTCCGTCACAGTTG AG >C3 ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC AGCCGTCATAGAGCACACTAACCGAGTCATCTATTTGGAGGACGACGATG TTGCTGCTGTTCGGGATGGTACCTTGAGTATCCATCGCCTAAAGAAGAGC CTGGATGATCCGCACGCGCGCGAAATCACTACCCTGAAGATGGAAATTCA ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT GGGAACGCCATAGTGCTCGGCGGAATCAAAGACTACATTCCTGAAATCAA ACGCTGTCGACGCCTGATGTTGATTGGCTGTGGCACATCTTACCACAGCG CTGTTGCCACTAGGCAGCTTCTGGAAGAGCTCACGGAGCTTCCCGTGATG GTCGAGCTGGCTTCCGATTTCTTAGACCGGAATACGCCTATTTTCCGAGA CGACGTCTGCTTCTTCATATCGCAGTCCGGAGAGACTGCCGACACCCTGA TGGCCTTGCGTTACTGTAAGCAGCGGGGAGCCCTAATTGTGGGCATTACG AATACCGTAGGCAGCAGCATCTGTCGCGAATCGCATTGTGGAGTTCACAT TAACGCCGGCCCAGAGATAGGCGTGGCCTCGACCAAGGCCTACACCTCCC AGTTCATTTCCCTGGTGATGTTCGCTCTGGTTATGTCCGAGGATCGGCTG TCATTGCAACAGCGACGGCTGGAGATTCTGCAGGCGTTGTCAAAGCTCGC GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAAGTTCAAGAACTGG CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC AACTTTGCCACCTGTCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA CATGCACAGTGAGGGCATCATGGCTGGTGAATTGAAGCACGGTCCACTGG CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTACGCGACCCC GTTTACGTAAAGTGCATGAACGCTCTACAACAGGTCACATCCCGCAAGGG CTGCCCGATTATTATCTGCGAGGAAGGCGACGAGGAGACCAAGGCTTTCT CTTCCCGCCATCTGGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT CTCACTGTTATCCCAATGCAACTGCTGTCTTATCATATTGCCGTGCTCCG CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAATCCGTGACAGTTG AG >C4 ATGCCCTTGGAAGAAAAGGAAGTAGAATACTTCTTCGCATCGGATGCCTC GGCCGTCATTGAGCACACTAACCGGGTGATCTATTTGGAGGACGACGATG TGGCCGCAGTTCGGGACGGAACTCTGAGTATTCATCGTCTAAAGAAAAGT TTAGATGACCCGCATGCCCGTGAGATCACTACATTAAAGATGGAAATCCA ACAGATCATGAAGGGCAACTATGACTACTTCATGCAGAAGGAGATTTTTG AGCAGCCCGACTCTGTGGTCAACACGATGCGTGGTCGCGTTCGCTTCGAC GGTAACGCGATTGTGCTCGGCGGTATCAAGGACTACATTCCGGAAATCAA ACGTTGTCGCCGTCTCATGCTGATCGGGTGTGGCACGTCTTACCACAGCG CCGTAGCCACCAGGCAGCTGCTCGAAGAGCTCACTGAGCTTCCTGTCATG GTCGAGCTGGCGTCTGACTTCCTGGACCGCAACACACCAATCTTCCGCGA CGACGTCTGCTTCTTTATATCGCAGTCCGGCGAGACGGCGGACACCCTAA TGGCTTTGCGATACTGCAAACAGCGGGGAGCCCTGATTGTGGGCATTACA AACACTGTAGGCAGCAGTATCTGCCGGGAATCGCATTGTGGAGTCCACAT TAACGCTGGCCCCGAGATTGGAGTGGCCTCTACAAAGGCATACACCTCGC AGTTCATTTCCCTGGTGATGTTCGCACTGGTTATGTCAGAGGATCGTCTT TCACTGCAACAGCGACGGCTGGAGATCCTGCAAGCGCTGTCCAAGCTTGC TGACCAAATCCGCGAAGTTCTCAAGCTTGATACAAAAGTTCAAGAGCTGG CCAAAGACCTTTACCAACACAAGTCGCTACTTATCATGGGTCGCGGCTAC AATTTCGCAACCTGTCTGGAAGGTGCCCTGAAAGTCAAGGAGCTGACCTA CATGCACAGCGAGGGCATTATGGCCGGTGAACTAAAGCACGGCCCTCTGG CCCTCGTGGACGACTCCATGCCAGTTCTAATGATAGTCCTTCGGGACCCC GTTTATGTCAAGTGCATGAACGCTCTGCAGCAGGTCACATCGCGCAAGGG CTGCCCTATTATTATTTGTGAGGAGGGAGACGAGGAGACCCAGGCCTTCT CATCCCGGCACCTCGAGATCCCTCGCACCGTTGACTGTCTGCAGGGAATT CTCACCGTTATTCCCATGCAACTCTTATCCTATCATATTGCCGTGCTGCG CGGGTGCGATGTTGACTGTCCTAGAAACCTGGCCAAGTCCGTGACGGTTG AG >C1 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C2 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C3 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >C4 MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1302 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479340077 Setting output file names to "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1126488652 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 8654051536 Seed = 1540926020 Swapseed = 1479340077 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 14 unique site patterns Division 2 has 5 unique site patterns Division 3 has 71 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3330.500238 -- -26.620141 Chain 2 -- -3360.855848 -- -26.620141 Chain 3 -- -3360.855848 -- -26.620141 Chain 4 -- -3356.696147 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3360.855848 -- -26.620141 Chain 2 -- -3330.500238 -- -26.620141 Chain 3 -- -3360.855848 -- -26.620141 Chain 4 -- -3330.500238 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3330.500] (-3360.856) (-3360.856) (-3356.696) * [-3360.856] (-3330.500) (-3360.856) (-3330.500) 500 -- (-3096.325) (-3092.169) (-3096.966) [-3090.738] * [-3073.191] (-3095.174) (-3082.515) (-3092.656) -- 0:00:00 1000 -- (-3092.622) (-3071.317) [-3067.943] (-3067.553) * (-3019.317) (-3075.934) (-3048.549) [-3028.424] -- 0:00:00 1500 -- (-3057.730) [-2988.315] (-3029.790) (-3040.840) * [-2961.427] (-3049.398) (-2984.070) (-2979.761) -- 0:00:00 2000 -- (-3012.660) [-2961.125] (-3015.212) (-2967.168) * (-2946.489) (-2977.499) [-2957.440] (-2964.634) -- 0:00:00 2500 -- (-2951.352) (-2962.554) (-2950.249) [-2946.143] * (-2948.019) (-2956.258) [-2942.838] (-2966.079) -- 0:00:00 3000 -- (-2945.142) (-2952.058) [-2946.653] (-2941.040) * (-2941.530) (-2958.436) [-2941.022] (-2961.169) -- 0:00:00 3500 -- (-2943.929) [-2946.523] (-2950.037) (-2937.356) * (-2945.340) (-2950.203) [-2933.632] (-2949.351) -- 0:00:00 4000 -- [-2936.372] (-2946.796) (-2952.774) (-2937.794) * (-2941.001) (-2948.734) [-2938.617] (-2944.226) -- 0:00:00 4500 -- (-2940.775) (-2944.347) (-2947.048) [-2940.807] * (-2938.321) [-2944.203] (-2937.525) (-2940.854) -- 0:00:00 5000 -- [-2940.742] (-2939.669) (-2949.057) (-2942.836) * (-2945.744) (-2944.457) (-2938.905) [-2939.975] -- 0:00:00 Average standard deviation of split frequencies: 0.000000 5500 -- (-2939.401) (-2942.430) [-2943.018] (-2941.584) * (-2942.376) (-2945.749) [-2939.942] (-2937.038) -- 0:00:00 6000 -- (-2940.566) [-2941.112] (-2945.448) (-2939.987) * (-2939.625) [-2938.089] (-2939.343) (-2942.211) -- 0:02:45 6500 -- (-2936.956) (-2937.298) (-2945.681) [-2944.762] * (-2936.952) [-2944.145] (-2938.735) (-2935.471) -- 0:02:32 7000 -- (-2940.592) [-2934.393] (-2941.052) (-2938.695) * (-2938.546) (-2936.470) [-2936.744] (-2943.558) -- 0:02:21 7500 -- [-2947.684] (-2939.124) (-2942.248) (-2940.478) * [-2934.953] (-2937.474) (-2941.237) (-2941.305) -- 0:02:12 8000 -- (-2939.276) (-2939.153) [-2935.806] (-2940.347) * (-2936.848) (-2939.927) [-2939.009] (-2936.666) -- 0:02:04 8500 -- [-2936.025] (-2943.009) (-2933.476) (-2942.822) * (-2942.163) (-2946.789) [-2936.348] (-2936.107) -- 0:01:56 9000 -- (-2937.749) [-2936.268] (-2936.816) (-2937.544) * (-2935.526) (-2943.566) [-2939.033] (-2942.094) -- 0:01:50 9500 -- (-2940.174) (-2938.236) (-2935.114) [-2943.295] * (-2937.190) (-2937.193) [-2933.782] (-2935.262) -- 0:01:44 10000 -- (-2938.746) (-2940.023) [-2939.944] (-2940.939) * [-2940.360] (-2944.011) (-2941.339) (-2938.573) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 10500 -- [-2942.209] (-2937.859) (-2935.795) (-2936.850) * (-2947.703) [-2936.194] (-2944.920) (-2944.373) -- 0:01:34 11000 -- (-2939.792) [-2943.360] (-2938.743) (-2936.756) * (-2937.783) [-2939.525] (-2941.130) (-2936.393) -- 0:01:29 11500 -- [-2936.704] (-2943.687) (-2937.374) (-2936.284) * (-2944.838) (-2939.386) (-2946.119) [-2937.100] -- 0:01:25 12000 -- (-2939.252) (-2939.410) (-2935.247) [-2935.135] * (-2938.173) (-2941.896) [-2938.263] (-2953.286) -- 0:01:22 12500 -- [-2936.675] (-2940.035) (-2945.765) (-2937.441) * [-2934.654] (-2942.762) (-2942.615) (-2943.763) -- 0:02:38 13000 -- (-2941.069) (-2934.199) (-2939.273) [-2937.950] * (-2942.428) [-2934.688] (-2935.834) (-2948.052) -- 0:02:31 13500 -- [-2938.473] (-2938.245) (-2940.924) (-2939.034) * (-2936.333) (-2936.925) [-2939.786] (-2936.872) -- 0:02:26 14000 -- (-2942.618) (-2936.932) [-2940.334] (-2940.455) * (-2937.247) [-2941.759] (-2940.470) (-2947.459) -- 0:02:20 14500 -- (-2936.053) [-2940.131] (-2935.269) (-2939.257) * (-2947.294) (-2945.935) (-2937.746) [-2937.512] -- 0:02:15 15000 -- (-2942.342) (-2942.641) (-2938.605) [-2941.338] * (-2937.476) (-2942.289) [-2936.226] (-2934.842) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 15500 -- (-2939.564) (-2935.833) [-2938.278] (-2943.804) * (-2943.468) (-2937.277) (-2936.260) [-2937.124] -- 0:02:07 16000 -- (-2941.756) (-2935.880) (-2937.844) [-2940.231] * (-2938.611) (-2937.978) (-2936.323) [-2939.857] -- 0:02:03 16500 -- (-2948.959) [-2934.112] (-2938.655) (-2940.487) * (-2937.661) (-2937.793) (-2942.538) [-2943.436] -- 0:01:59 17000 -- [-2945.715] (-2933.736) (-2945.676) (-2939.675) * (-2940.719) (-2937.048) [-2939.207] (-2939.178) -- 0:01:55 17500 -- [-2935.482] (-2937.437) (-2941.853) (-2938.758) * (-2946.140) [-2940.936] (-2939.979) (-2944.408) -- 0:01:52 18000 -- (-2951.432) (-2942.675) [-2934.680] (-2938.369) * (-2939.393) (-2942.249) (-2948.598) [-2941.375] -- 0:01:49 18500 -- (-2945.679) [-2938.509] (-2935.790) (-2939.647) * [-2943.708] (-2938.077) (-2937.016) (-2943.284) -- 0:01:46 19000 -- (-2934.470) (-2937.434) (-2941.334) [-2936.994] * (-2941.590) (-2937.381) [-2940.080] (-2942.790) -- 0:02:34 19500 -- [-2934.697] (-2943.317) (-2937.484) (-2939.130) * (-2943.379) (-2944.242) (-2942.502) [-2942.850] -- 0:02:30 20000 -- (-2944.173) [-2935.222] (-2937.150) (-2943.705) * [-2936.588] (-2937.490) (-2939.035) (-2939.455) -- 0:02:27 Average standard deviation of split frequencies: 0.045620 20500 -- [-2941.148] (-2944.542) (-2936.390) (-2943.804) * (-2938.742) (-2940.295) [-2940.484] (-2940.102) -- 0:02:23 21000 -- [-2945.321] (-2946.575) (-2939.870) (-2936.204) * (-2943.125) (-2942.043) [-2936.600] (-2941.416) -- 0:02:19 21500 -- (-2940.796) [-2943.055] (-2937.486) (-2937.290) * (-2938.835) (-2938.404) (-2937.823) [-2935.344] -- 0:02:16 22000 -- [-2940.724] (-2942.506) (-2936.876) (-2940.048) * (-2933.771) (-2945.387) (-2938.468) [-2941.259] -- 0:02:13 22500 -- [-2942.729] (-2936.710) (-2940.616) (-2938.094) * [-2934.326] (-2943.434) (-2949.126) (-2941.885) -- 0:02:10 23000 -- (-2938.353) [-2939.595] (-2949.200) (-2939.516) * (-2937.624) (-2938.054) [-2937.548] (-2944.257) -- 0:02:07 23500 -- (-2939.922) (-2940.157) [-2942.730] (-2948.014) * (-2941.331) [-2937.012] (-2939.414) (-2934.629) -- 0:02:04 24000 -- (-2936.332) (-2936.654) (-2938.484) [-2937.542] * [-2941.028] (-2938.555) (-2942.787) (-2934.163) -- 0:02:02 24500 -- (-2938.785) (-2943.968) (-2942.854) [-2936.597] * (-2938.786) (-2939.821) [-2942.135] (-2943.794) -- 0:01:59 25000 -- (-2940.129) [-2939.350] (-2947.115) (-2939.606) * (-2936.807) (-2938.798) [-2937.131] (-2936.094) -- 0:01:57 Average standard deviation of split frequencies: 0.018131 25500 -- (-2939.898) [-2942.814] (-2942.065) (-2938.983) * (-2945.357) (-2943.997) [-2931.985] (-2940.652) -- 0:01:54 26000 -- (-2937.074) (-2944.301) (-2946.669) [-2937.357] * (-2938.901) (-2940.684) [-2940.521] (-2937.681) -- 0:02:29 26500 -- (-2936.774) (-2939.065) [-2946.631] (-2936.233) * [-2936.108] (-2947.487) (-2940.101) (-2938.223) -- 0:02:26 27000 -- (-2947.872) (-2939.129) [-2942.774] (-2935.204) * (-2940.934) [-2948.453] (-2940.827) (-2940.908) -- 0:02:24 27500 -- (-2943.091) [-2939.211] (-2935.540) (-2939.595) * (-2936.499) (-2940.258) (-2937.250) [-2944.013] -- 0:02:21 28000 -- (-2942.815) [-2941.313] (-2938.354) (-2942.878) * [-2940.501] (-2943.904) (-2938.261) (-2937.963) -- 0:02:18 28500 -- [-2938.545] (-2944.118) (-2941.372) (-2937.197) * (-2941.572) (-2941.984) (-2942.011) [-2940.329] -- 0:02:16 29000 -- [-2935.522] (-2939.471) (-2943.879) (-2940.770) * (-2937.771) (-2941.895) (-2945.016) [-2939.416] -- 0:02:13 29500 -- [-2934.781] (-2942.342) (-2947.609) (-2940.245) * (-2935.452) [-2941.558] (-2956.831) (-2939.965) -- 0:02:11 30000 -- [-2939.783] (-2945.978) (-2939.360) (-2935.844) * (-2940.313) [-2935.320] (-2942.884) (-2943.448) -- 0:02:09 Average standard deviation of split frequencies: 0.015372 30500 -- (-2943.857) (-2944.438) [-2940.175] (-2938.727) * (-2940.318) (-2939.898) [-2941.771] (-2945.593) -- 0:02:07 31000 -- (-2941.636) (-2939.161) (-2943.144) [-2939.081] * [-2944.322] (-2942.417) (-2935.763) (-2940.927) -- 0:02:05 31500 -- (-2940.434) (-2938.849) (-2946.588) [-2933.910] * (-2936.638) (-2939.591) (-2934.363) [-2937.821] -- 0:02:02 32000 -- [-2942.523] (-2941.906) (-2944.880) (-2939.817) * (-2943.117) [-2944.546] (-2945.128) (-2951.985) -- 0:02:01 32500 -- [-2941.000] (-2937.738) (-2944.059) (-2936.490) * (-2941.047) (-2939.621) (-2940.225) [-2937.008] -- 0:02:28 33000 -- (-2939.068) (-2939.772) (-2944.336) [-2935.685] * (-2934.351) (-2942.196) [-2938.834] (-2942.008) -- 0:02:26 33500 -- (-2939.938) (-2936.572) (-2939.365) [-2936.320] * (-2939.017) [-2938.341] (-2947.309) (-2944.707) -- 0:02:24 34000 -- (-2936.832) (-2941.119) (-2938.033) [-2937.488] * (-2934.865) (-2935.608) (-2938.556) [-2943.884] -- 0:02:22 34500 -- [-2937.225] (-2941.121) (-2947.557) (-2934.759) * (-2941.222) (-2939.093) (-2937.219) [-2939.351] -- 0:02:19 35000 -- [-2943.406] (-2941.854) (-2943.244) (-2944.108) * (-2941.112) [-2939.867] (-2946.254) (-2936.285) -- 0:02:17 Average standard deviation of split frequencies: 0.026189 35500 -- (-2943.889) [-2938.674] (-2938.158) (-2940.508) * (-2937.218) (-2935.346) [-2947.140] (-2943.545) -- 0:02:15 36000 -- (-2945.231) (-2938.308) (-2942.513) [-2945.728] * (-2940.645) (-2939.679) (-2941.960) [-2939.056] -- 0:02:13 36500 -- (-2950.798) (-2942.570) [-2944.576] (-2943.648) * (-2945.899) [-2938.087] (-2942.564) (-2942.558) -- 0:02:11 37000 -- (-2937.250) [-2940.628] (-2941.206) (-2938.451) * [-2941.999] (-2940.136) (-2944.331) (-2940.838) -- 0:02:10 37500 -- (-2941.005) [-2940.064] (-2937.125) (-2944.017) * (-2943.077) (-2942.195) [-2937.816] (-2946.555) -- 0:02:08 38000 -- [-2943.780] (-2942.090) (-2944.787) (-2936.374) * (-2942.507) [-2936.590] (-2949.319) (-2941.408) -- 0:02:06 38500 -- (-2940.629) (-2940.362) [-2936.381] (-2942.106) * (-2939.974) [-2939.836] (-2941.966) (-2945.976) -- 0:02:04 39000 -- (-2940.578) (-2941.126) [-2939.415] (-2937.975) * (-2949.423) (-2940.841) [-2942.964] (-2936.614) -- 0:02:27 39500 -- (-2936.588) [-2934.586] (-2942.816) (-2943.461) * (-2939.515) [-2933.664] (-2940.106) (-2934.865) -- 0:02:25 40000 -- [-2937.918] (-2936.484) (-2939.953) (-2940.680) * (-2949.192) (-2940.611) (-2941.606) [-2942.905] -- 0:02:24 Average standard deviation of split frequencies: 0.023184 40500 -- (-2938.560) [-2936.039] (-2939.621) (-2938.058) * (-2941.542) [-2936.552] (-2941.953) (-2943.433) -- 0:02:22 41000 -- [-2941.668] (-2940.605) (-2940.173) (-2938.424) * (-2938.727) (-2940.459) (-2942.098) [-2942.517] -- 0:02:20 41500 -- (-2939.868) [-2940.326] (-2947.030) (-2938.978) * (-2941.095) (-2945.858) (-2938.301) [-2943.048] -- 0:02:18 42000 -- (-2939.513) (-2949.064) [-2938.443] (-2939.248) * (-2935.249) (-2944.548) (-2946.247) [-2938.398] -- 0:02:16 42500 -- (-2937.459) (-2939.110) (-2937.234) [-2935.127] * (-2941.170) [-2935.076] (-2946.983) (-2936.088) -- 0:02:15 43000 -- [-2948.202] (-2935.650) (-2944.488) (-2932.130) * (-2934.670) (-2940.024) [-2944.824] (-2950.672) -- 0:02:13 43500 -- (-2936.909) (-2937.037) [-2937.773] (-2938.982) * (-2945.386) (-2943.547) (-2937.847) [-2942.605] -- 0:02:11 44000 -- (-2940.966) (-2937.742) [-2941.854] (-2937.563) * (-2939.269) [-2940.809] (-2938.771) (-2940.548) -- 0:02:10 44500 -- (-2937.885) [-2936.871] (-2943.283) (-2939.172) * [-2936.920] (-2937.976) (-2939.730) (-2936.300) -- 0:02:08 45000 -- (-2941.715) (-2947.586) [-2935.821] (-2936.644) * (-2944.059) [-2938.295] (-2941.649) (-2940.422) -- 0:02:07 Average standard deviation of split frequencies: 0.020496 45500 -- [-2940.496] (-2941.122) (-2939.656) (-2935.650) * (-2945.112) (-2944.866) (-2941.974) [-2938.318] -- 0:02:26 46000 -- [-2944.076] (-2944.470) (-2941.440) (-2937.005) * (-2944.961) [-2943.635] (-2939.616) (-2939.887) -- 0:02:25 46500 -- (-2944.548) (-2938.344) (-2936.303) [-2935.313] * (-2941.208) (-2943.231) [-2941.349] (-2949.125) -- 0:02:23 47000 -- (-2944.518) [-2937.527] (-2942.713) (-2937.017) * (-2937.912) [-2938.718] (-2940.062) (-2943.068) -- 0:02:21 47500 -- (-2942.637) (-2940.430) (-2940.735) [-2938.723] * (-2939.570) (-2942.714) (-2936.325) [-2937.480] -- 0:02:20 48000 -- (-2938.722) [-2936.192] (-2937.697) (-2939.508) * (-2939.875) (-2937.549) [-2937.387] (-2939.897) -- 0:02:18 48500 -- (-2942.872) (-2937.206) [-2945.792] (-2936.376) * (-2951.971) (-2937.721) [-2946.844] (-2937.330) -- 0:02:17 49000 -- (-2937.456) (-2936.296) (-2943.087) [-2934.722] * (-2945.463) (-2936.809) (-2941.332) [-2940.472] -- 0:02:15 49500 -- (-2946.762) [-2949.637] (-2953.103) (-2939.391) * (-2949.191) (-2943.414) (-2953.945) [-2938.349] -- 0:02:14 50000 -- [-2937.364] (-2939.259) (-2941.496) (-2944.561) * (-2953.643) (-2934.826) (-2943.241) [-2940.577] -- 0:02:13 Average standard deviation of split frequencies: 0.018608 50500 -- (-2941.993) (-2938.116) (-2938.460) [-2937.948] * (-2946.233) (-2938.282) [-2938.283] (-2939.760) -- 0:02:11 51000 -- [-2938.243] (-2938.834) (-2942.363) (-2936.764) * (-2941.065) (-2946.453) (-2940.608) [-2939.368] -- 0:02:10 51500 -- (-2941.449) [-2937.913] (-2940.066) (-2937.518) * (-2939.016) (-2937.345) [-2935.355] (-2938.627) -- 0:02:08 52000 -- [-2940.397] (-2937.317) (-2942.648) (-2937.358) * (-2946.667) (-2946.199) (-2939.610) [-2934.816] -- 0:02:25 52500 -- (-2948.533) (-2938.324) [-2940.333] (-2939.661) * (-2938.372) [-2941.689] (-2943.938) (-2941.589) -- 0:02:24 53000 -- (-2943.129) (-2944.902) (-2936.770) [-2943.008] * (-2945.060) (-2939.306) [-2947.255] (-2943.302) -- 0:02:22 53500 -- (-2941.830) (-2942.483) [-2939.369] (-2939.954) * (-2943.240) (-2939.296) [-2936.596] (-2947.402) -- 0:02:21 54000 -- [-2948.362] (-2951.880) (-2938.894) (-2934.314) * (-2942.685) (-2938.923) [-2937.061] (-2943.540) -- 0:02:20 54500 -- (-2942.064) (-2939.596) (-2956.166) [-2936.855] * (-2939.959) (-2943.554) (-2942.966) [-2938.934] -- 0:02:18 55000 -- (-2945.382) [-2942.322] (-2952.222) (-2935.436) * (-2945.549) (-2937.672) (-2941.192) [-2936.065] -- 0:02:17 Average standard deviation of split frequencies: 0.016836 55500 -- (-2950.866) (-2944.670) [-2938.149] (-2934.900) * (-2939.280) (-2935.691) (-2940.165) [-2936.928] -- 0:02:16 56000 -- [-2940.097] (-2940.474) (-2939.088) (-2942.009) * (-2935.673) (-2937.955) [-2938.954] (-2941.295) -- 0:02:14 56500 -- [-2950.174] (-2942.571) (-2943.285) (-2933.687) * (-2937.931) (-2937.537) [-2941.661] (-2939.781) -- 0:02:13 57000 -- (-2942.740) (-2942.477) (-2941.446) [-2942.074] * (-2940.493) (-2933.589) (-2938.661) [-2937.856] -- 0:02:12 57500 -- (-2951.485) [-2944.470] (-2943.863) (-2940.060) * (-2935.136) (-2937.369) (-2940.426) [-2947.788] -- 0:02:11 58000 -- (-2942.371) (-2938.164) [-2939.988] (-2939.403) * (-2941.755) (-2933.626) (-2935.566) [-2943.686] -- 0:02:09 58500 -- [-2944.343] (-2943.617) (-2942.709) (-2936.669) * (-2939.936) [-2934.948] (-2937.449) (-2940.223) -- 0:02:08 59000 -- (-2940.667) (-2947.651) (-2937.738) [-2943.300] * (-2940.208) (-2936.651) (-2946.510) [-2939.629] -- 0:02:23 59500 -- (-2942.440) (-2942.959) (-2941.100) [-2935.816] * (-2937.811) [-2943.600] (-2935.171) (-2938.846) -- 0:02:22 60000 -- (-2946.971) (-2947.867) (-2931.197) [-2937.002] * (-2939.520) (-2943.357) (-2938.369) [-2936.974] -- 0:02:21 Average standard deviation of split frequencies: 0.007770 60500 -- (-2939.792) [-2940.299] (-2936.357) (-2937.366) * (-2940.186) (-2939.152) [-2941.190] (-2942.242) -- 0:02:19 61000 -- (-2942.713) (-2940.502) [-2936.623] (-2933.559) * (-2940.646) (-2941.444) [-2939.056] (-2939.756) -- 0:02:18 61500 -- (-2935.588) (-2939.492) [-2937.343] (-2941.846) * (-2939.529) (-2941.321) (-2935.874) [-2946.746] -- 0:02:17 62000 -- (-2951.164) (-2940.847) [-2936.151] (-2935.581) * (-2935.665) [-2944.621] (-2933.603) (-2948.197) -- 0:02:16 62500 -- (-2941.019) (-2947.005) [-2937.669] (-2938.560) * [-2934.766] (-2948.065) (-2938.656) (-2943.922) -- 0:02:15 63000 -- (-2942.512) (-2942.145) (-2940.846) [-2943.668] * (-2939.012) (-2947.596) (-2945.031) [-2943.693] -- 0:02:13 63500 -- [-2937.477] (-2938.751) (-2937.099) (-2944.960) * (-2942.263) (-2954.987) [-2935.455] (-2936.444) -- 0:02:12 64000 -- (-2939.522) [-2936.960] (-2938.710) (-2935.417) * (-2936.258) [-2946.588] (-2934.815) (-2936.747) -- 0:02:11 64500 -- (-2933.456) [-2938.662] (-2943.960) (-2936.159) * (-2945.053) [-2941.592] (-2938.791) (-2941.439) -- 0:02:10 65000 -- (-2933.388) (-2942.364) (-2939.087) [-2938.330] * (-2938.488) (-2954.307) (-2936.542) [-2943.126] -- 0:02:09 Average standard deviation of split frequencies: 0.007142 65500 -- (-2939.010) (-2936.059) (-2940.594) [-2939.885] * [-2936.606] (-2944.842) (-2935.757) (-2937.494) -- 0:02:22 66000 -- (-2934.854) [-2939.227] (-2936.274) (-2936.236) * [-2936.573] (-2939.653) (-2945.129) (-2934.874) -- 0:02:21 66500 -- (-2942.431) (-2949.046) [-2938.024] (-2937.193) * (-2940.417) [-2946.164] (-2942.081) (-2940.648) -- 0:02:20 67000 -- (-2937.756) [-2937.989] (-2946.115) (-2939.689) * (-2939.587) (-2939.284) (-2938.917) [-2937.976] -- 0:02:19 67500 -- (-2944.434) (-2940.641) (-2948.985) [-2941.087] * (-2940.443) (-2932.680) [-2938.617] (-2948.718) -- 0:02:18 68000 -- (-2932.288) [-2932.949] (-2944.221) (-2939.511) * (-2939.611) (-2939.053) (-2940.235) [-2937.085] -- 0:02:17 68500 -- (-2939.374) (-2946.786) [-2940.053] (-2942.984) * (-2940.283) (-2941.655) (-2936.643) [-2940.595] -- 0:02:15 69000 -- (-2932.892) (-2947.441) [-2940.389] (-2937.302) * (-2938.006) [-2936.885] (-2939.855) (-2943.240) -- 0:02:14 69500 -- [-2941.939] (-2939.590) (-2940.354) (-2946.329) * [-2937.530] (-2940.103) (-2942.112) (-2942.091) -- 0:02:13 70000 -- (-2945.079) (-2943.059) [-2934.872] (-2939.974) * (-2941.692) [-2940.919] (-2940.619) (-2940.660) -- 0:02:12 Average standard deviation of split frequencies: 0.006671 70500 -- [-2938.835] (-2940.325) (-2941.138) (-2942.926) * (-2943.597) (-2940.293) (-2940.536) [-2939.317] -- 0:02:11 71000 -- (-2947.510) (-2947.111) (-2941.668) [-2940.459] * (-2937.032) (-2939.275) [-2944.878] (-2940.367) -- 0:02:10 71500 -- [-2940.783] (-2944.641) (-2948.863) (-2939.249) * (-2940.416) (-2934.796) (-2940.938) [-2937.438] -- 0:02:09 72000 -- (-2938.302) [-2935.310] (-2935.408) (-2941.929) * (-2937.704) (-2940.942) [-2936.408] (-2933.975) -- 0:02:21 72500 -- (-2942.187) [-2940.029] (-2942.285) (-2943.910) * [-2943.340] (-2936.247) (-2937.659) (-2942.651) -- 0:02:20 73000 -- (-2938.348) [-2938.651] (-2934.400) (-2936.443) * (-2943.336) (-2935.956) (-2936.538) [-2934.379] -- 0:02:19 73500 -- [-2937.038] (-2942.780) (-2941.782) (-2936.479) * (-2947.412) (-2939.232) [-2935.689] (-2941.006) -- 0:02:18 74000 -- (-2936.038) (-2944.571) (-2937.499) [-2935.269] * (-2939.186) (-2940.798) [-2936.406] (-2940.725) -- 0:02:17 74500 -- (-2942.221) [-2941.181] (-2946.361) (-2934.653) * (-2937.279) (-2943.629) [-2943.730] (-2943.729) -- 0:02:16 75000 -- (-2944.876) (-2939.408) (-2939.865) [-2941.990] * (-2939.863) [-2949.265] (-2944.657) (-2944.890) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 75500 -- (-2940.307) (-2942.122) [-2940.830] (-2941.946) * [-2941.201] (-2944.691) (-2942.622) (-2948.408) -- 0:02:14 76000 -- [-2935.684] (-2934.698) (-2940.728) (-2944.032) * (-2936.966) [-2948.039] (-2941.566) (-2942.880) -- 0:02:13 76500 -- (-2939.713) (-2941.740) [-2942.715] (-2948.560) * (-2937.508) [-2940.399] (-2942.281) (-2943.117) -- 0:02:12 77000 -- [-2935.607] (-2940.019) (-2934.001) (-2938.804) * [-2939.263] (-2940.066) (-2938.945) (-2938.323) -- 0:02:11 77500 -- (-2939.246) (-2941.097) [-2939.837] (-2942.167) * (-2940.235) [-2941.299] (-2944.686) (-2936.718) -- 0:02:10 78000 -- (-2940.713) (-2941.459) [-2940.753] (-2937.417) * (-2939.055) (-2936.345) (-2945.213) [-2941.270] -- 0:02:10 78500 -- (-2949.408) [-2937.987] (-2949.730) (-2942.065) * (-2949.960) (-2940.123) (-2935.998) [-2939.439] -- 0:02:20 79000 -- (-2943.871) [-2939.703] (-2940.758) (-2934.765) * (-2935.985) [-2937.977] (-2944.823) (-2938.826) -- 0:02:19 79500 -- (-2943.897) (-2937.438) (-2941.369) [-2937.866] * (-2941.109) (-2947.977) [-2939.301] (-2939.687) -- 0:02:18 80000 -- (-2941.113) (-2939.309) (-2952.837) [-2945.228] * (-2943.680) [-2936.732] (-2939.103) (-2945.469) -- 0:02:18 Average standard deviation of split frequencies: 0.011688 80500 -- (-2938.025) [-2942.883] (-2946.828) (-2941.530) * (-2940.823) (-2937.567) (-2935.978) [-2938.176] -- 0:02:17 81000 -- (-2941.797) (-2939.121) (-2944.349) [-2948.540] * (-2940.537) (-2937.360) [-2946.344] (-2947.197) -- 0:02:16 81500 -- (-2937.893) (-2937.650) (-2937.580) [-2941.091] * (-2942.347) (-2942.414) [-2947.690] (-2938.909) -- 0:02:15 82000 -- (-2933.993) (-2938.433) (-2937.171) [-2939.376] * [-2940.800] (-2941.013) (-2950.400) (-2938.825) -- 0:02:14 82500 -- (-2934.788) (-2940.330) [-2939.225] (-2948.794) * (-2935.992) [-2937.385] (-2945.072) (-2945.840) -- 0:02:13 83000 -- (-2941.245) (-2937.077) (-2944.374) [-2939.973] * (-2941.191) (-2944.736) (-2940.341) [-2942.398] -- 0:02:12 83500 -- (-2941.645) (-2939.893) [-2938.499] (-2938.967) * (-2941.676) (-2939.520) [-2939.397] (-2936.812) -- 0:02:11 84000 -- (-2944.043) [-2935.883] (-2941.857) (-2942.793) * (-2937.553) [-2936.831] (-2943.407) (-2941.040) -- 0:02:10 84500 -- (-2944.307) (-2938.886) [-2937.240] (-2937.857) * [-2938.958] (-2936.428) (-2939.832) (-2937.754) -- 0:02:10 85000 -- (-2943.861) (-2938.806) (-2935.018) [-2936.812] * (-2939.499) (-2936.145) [-2938.031] (-2944.029) -- 0:02:19 Average standard deviation of split frequencies: 0.016444 85500 -- (-2942.208) (-2943.248) (-2935.412) [-2937.298] * (-2940.397) (-2945.619) [-2936.730] (-2939.474) -- 0:02:19 86000 -- [-2938.094] (-2944.830) (-2934.594) (-2939.179) * [-2940.910] (-2937.987) (-2937.859) (-2939.487) -- 0:02:18 86500 -- (-2941.709) (-2943.398) (-2948.500) [-2944.960] * [-2941.910] (-2939.437) (-2939.119) (-2938.490) -- 0:02:17 87000 -- (-2941.680) (-2941.349) (-2941.137) [-2939.506] * (-2944.400) (-2936.710) [-2940.785] (-2938.948) -- 0:02:16 87500 -- (-2944.491) [-2943.018] (-2948.817) (-2938.624) * (-2940.752) (-2938.278) [-2942.180] (-2941.823) -- 0:02:15 88000 -- (-2943.893) [-2941.619] (-2944.321) (-2934.733) * [-2942.477] (-2946.441) (-2940.823) (-2936.867) -- 0:02:14 88500 -- (-2942.428) (-2943.685) (-2946.126) [-2939.693] * (-2940.923) (-2944.243) (-2942.007) [-2942.752] -- 0:02:13 89000 -- (-2945.089) [-2940.332] (-2944.754) (-2938.721) * [-2937.509] (-2944.179) (-2939.581) (-2939.959) -- 0:02:13 89500 -- [-2941.478] (-2940.028) (-2939.724) (-2936.566) * (-2936.694) (-2948.048) [-2937.884] (-2940.353) -- 0:02:12 90000 -- (-2948.393) (-2931.753) [-2941.835] (-2940.319) * [-2937.161] (-2939.466) (-2936.741) (-2938.822) -- 0:02:11 Average standard deviation of split frequencies: 0.005199 90500 -- (-2941.996) [-2938.922] (-2941.255) (-2938.707) * (-2940.732) (-2945.136) (-2941.487) [-2940.281] -- 0:02:10 91000 -- (-2942.891) (-2935.276) (-2933.698) [-2936.725] * (-2939.558) (-2943.733) (-2947.775) [-2932.679] -- 0:02:09 91500 -- (-2937.676) (-2944.979) [-2938.477] (-2942.511) * (-2940.805) (-2938.285) [-2943.064] (-2940.175) -- 0:02:19 92000 -- (-2936.398) (-2945.104) [-2936.094] (-2941.544) * (-2939.295) (-2938.565) (-2939.126) [-2938.306] -- 0:02:18 92500 -- (-2940.041) (-2938.686) [-2941.838] (-2947.226) * (-2947.493) [-2939.979] (-2935.183) (-2938.494) -- 0:02:17 93000 -- [-2937.174] (-2940.611) (-2944.400) (-2939.992) * [-2934.477] (-2936.875) (-2944.127) (-2935.054) -- 0:02:16 93500 -- (-2946.353) (-2941.910) (-2941.060) [-2939.242] * (-2940.970) (-2935.689) [-2947.254] (-2939.801) -- 0:02:15 94000 -- [-2940.634] (-2939.286) (-2936.817) (-2942.799) * [-2939.300] (-2941.351) (-2935.673) (-2942.662) -- 0:02:14 94500 -- (-2938.203) (-2936.845) [-2938.131] (-2943.882) * (-2940.787) (-2949.947) (-2937.250) [-2944.953] -- 0:02:14 95000 -- (-2937.974) [-2937.418] (-2936.998) (-2943.805) * [-2939.228] (-2941.986) (-2935.148) (-2940.956) -- 0:02:13 Average standard deviation of split frequencies: 0.004910 95500 -- [-2939.772] (-2937.582) (-2940.876) (-2936.167) * (-2938.831) (-2937.268) [-2939.140] (-2944.177) -- 0:02:12 96000 -- (-2933.125) [-2940.614] (-2948.460) (-2937.319) * (-2935.506) [-2937.056] (-2938.885) (-2943.513) -- 0:02:11 96500 -- [-2935.956] (-2936.574) (-2947.233) (-2945.077) * [-2934.376] (-2938.476) (-2941.294) (-2952.259) -- 0:02:11 97000 -- [-2935.452] (-2940.303) (-2944.783) (-2942.060) * [-2936.971] (-2940.502) (-2940.960) (-2935.285) -- 0:02:10 97500 -- [-2939.085] (-2938.224) (-2942.129) (-2946.337) * [-2943.146] (-2942.141) (-2947.116) (-2940.649) -- 0:02:09 98000 -- (-2941.010) (-2937.708) (-2941.448) [-2936.149] * (-2937.755) (-2944.391) [-2938.079] (-2937.752) -- 0:02:18 98500 -- (-2939.067) (-2938.924) [-2934.906] (-2950.919) * (-2943.568) (-2939.762) (-2936.821) [-2939.557] -- 0:02:17 99000 -- [-2939.740] (-2937.716) (-2939.440) (-2945.697) * (-2946.636) (-2936.888) [-2935.370] (-2935.269) -- 0:02:16 99500 -- (-2942.038) [-2938.992] (-2943.497) (-2933.995) * (-2936.589) [-2941.716] (-2948.728) (-2940.557) -- 0:02:15 100000 -- (-2937.855) [-2937.546] (-2939.411) (-2937.426) * (-2942.983) (-2941.543) [-2944.865] (-2943.013) -- 0:02:15 Average standard deviation of split frequencies: 0.004683 100500 -- (-2943.941) (-2938.120) [-2938.010] (-2945.809) * (-2946.560) (-2946.289) (-2948.691) [-2937.338] -- 0:02:14 101000 -- (-2944.005) (-2946.738) [-2935.910] (-2938.652) * (-2945.624) (-2941.027) (-2940.236) [-2940.074] -- 0:02:13 101500 -- [-2938.104] (-2947.716) (-2940.142) (-2948.361) * [-2937.323] (-2943.542) (-2941.070) (-2940.364) -- 0:02:12 102000 -- (-2943.179) [-2943.292] (-2943.573) (-2936.937) * (-2937.090) (-2939.291) [-2940.400] (-2937.373) -- 0:02:12 102500 -- (-2939.312) (-2939.290) [-2945.279] (-2937.569) * (-2937.977) (-2935.237) [-2944.576] (-2939.142) -- 0:02:11 103000 -- (-2938.199) [-2943.359] (-2941.851) (-2934.566) * (-2940.942) [-2938.049] (-2942.357) (-2942.908) -- 0:02:10 103500 -- (-2953.725) (-2939.540) (-2945.633) [-2943.735] * [-2941.666] (-2938.423) (-2941.362) (-2940.473) -- 0:02:09 104000 -- (-2938.130) (-2943.785) [-2935.134] (-2944.081) * (-2939.761) (-2939.861) (-2948.178) [-2937.824] -- 0:02:09 104500 -- (-2937.798) (-2934.756) [-2936.578] (-2940.719) * (-2938.195) [-2936.741] (-2946.049) (-2940.163) -- 0:02:17 105000 -- [-2941.168] (-2945.062) (-2937.400) (-2946.540) * (-2941.143) (-2942.174) [-2941.276] (-2941.310) -- 0:02:16 Average standard deviation of split frequencies: 0.013342 105500 -- (-2942.983) [-2939.023] (-2941.645) (-2946.060) * (-2945.613) (-2937.534) [-2939.465] (-2936.373) -- 0:02:15 106000 -- (-2940.853) (-2937.473) (-2940.498) [-2943.563] * (-2938.524) (-2942.297) [-2939.783] (-2936.734) -- 0:02:14 106500 -- [-2937.841] (-2940.049) (-2938.743) (-2940.111) * (-2939.321) [-2940.343] (-2940.439) (-2936.701) -- 0:02:14 107000 -- (-2939.157) (-2942.806) (-2942.605) [-2933.811] * (-2936.621) [-2937.355] (-2947.708) (-2944.262) -- 0:02:13 107500 -- (-2945.421) (-2940.786) (-2942.167) [-2936.093] * (-2939.215) (-2935.944) (-2937.911) [-2936.330] -- 0:02:12 108000 -- (-2941.876) [-2942.753] (-2942.678) (-2937.429) * (-2943.270) [-2935.559] (-2943.109) (-2938.339) -- 0:02:12 108500 -- (-2933.934) (-2941.655) (-2938.344) [-2933.858] * [-2939.975] (-2942.328) (-2939.614) (-2940.879) -- 0:02:11 109000 -- (-2942.775) [-2939.662] (-2946.205) (-2938.360) * [-2941.669] (-2938.087) (-2942.705) (-2941.000) -- 0:02:10 109500 -- (-2937.077) (-2941.050) (-2942.621) [-2940.671] * (-2937.333) [-2936.154] (-2938.033) (-2944.334) -- 0:02:10 110000 -- (-2953.465) (-2943.321) (-2944.058) [-2942.013] * [-2937.543] (-2935.635) (-2941.614) (-2938.528) -- 0:02:09 Average standard deviation of split frequencies: 0.012779 110500 -- [-2944.574] (-2940.726) (-2943.913) (-2945.910) * [-2944.353] (-2942.214) (-2940.991) (-2934.421) -- 0:02:08 111000 -- (-2941.757) (-2942.732) (-2942.651) [-2942.428] * (-2943.026) (-2936.780) [-2941.034] (-2942.968) -- 0:02:16 111500 -- (-2938.926) [-2940.303] (-2941.915) (-2937.771) * (-2934.876) [-2937.292] (-2936.210) (-2940.539) -- 0:02:15 112000 -- [-2941.635] (-2940.116) (-2935.318) (-2940.952) * (-2942.988) (-2935.371) (-2936.659) [-2939.384] -- 0:02:14 112500 -- (-2936.619) (-2940.912) (-2937.833) [-2936.038] * (-2939.560) [-2938.483] (-2937.704) (-2937.269) -- 0:02:14 113000 -- (-2939.011) [-2940.298] (-2945.484) (-2942.241) * (-2942.332) (-2943.222) [-2947.495] (-2942.689) -- 0:02:13 113500 -- (-2942.736) [-2941.762] (-2942.618) (-2944.098) * (-2946.156) (-2943.734) [-2939.541] (-2950.181) -- 0:02:12 114000 -- (-2947.344) [-2940.822] (-2940.174) (-2942.381) * (-2940.667) [-2935.944] (-2936.675) (-2950.800) -- 0:02:12 114500 -- (-2942.928) (-2943.176) [-2936.319] (-2935.710) * (-2937.530) [-2937.399] (-2937.536) (-2941.167) -- 0:02:11 115000 -- (-2936.733) [-2939.267] (-2941.091) (-2937.275) * [-2943.086] (-2938.008) (-2936.545) (-2939.657) -- 0:02:10 Average standard deviation of split frequencies: 0.020319 115500 -- (-2936.748) (-2946.308) [-2944.278] (-2934.445) * [-2945.027] (-2939.818) (-2939.055) (-2941.648) -- 0:02:10 116000 -- (-2945.728) [-2940.455] (-2938.171) (-2936.932) * (-2943.163) [-2935.480] (-2940.288) (-2946.588) -- 0:02:09 116500 -- (-2941.025) (-2939.606) [-2940.026] (-2939.361) * (-2939.455) (-2941.230) [-2939.595] (-2939.687) -- 0:02:08 117000 -- [-2939.141] (-2937.479) (-2936.090) (-2943.480) * (-2943.006) (-2935.804) (-2939.025) [-2947.950] -- 0:02:08 117500 -- [-2939.995] (-2938.967) (-2939.003) (-2938.407) * [-2937.598] (-2937.565) (-2939.152) (-2946.383) -- 0:02:15 118000 -- (-2941.301) (-2946.535) (-2940.573) [-2942.317] * [-2941.137] (-2946.162) (-2938.142) (-2941.585) -- 0:02:14 118500 -- [-2936.548] (-2937.038) (-2936.643) (-2938.958) * (-2937.783) (-2948.418) (-2940.897) [-2938.160] -- 0:02:13 119000 -- (-2942.361) [-2935.707] (-2943.593) (-2938.217) * (-2943.461) (-2943.317) (-2942.128) [-2936.035] -- 0:02:13 119500 -- (-2945.818) [-2938.452] (-2938.450) (-2939.263) * (-2944.690) [-2943.276] (-2942.532) (-2937.217) -- 0:02:12 120000 -- (-2942.027) [-2936.772] (-2947.857) (-2943.335) * [-2938.916] (-2939.751) (-2935.390) (-2940.803) -- 0:02:12 Average standard deviation of split frequencies: 0.015627 120500 -- (-2936.294) [-2940.336] (-2942.625) (-2940.603) * (-2944.576) (-2942.277) [-2941.034] (-2938.127) -- 0:02:11 121000 -- [-2942.409] (-2937.610) (-2943.319) (-2937.397) * (-2945.542) [-2938.374] (-2939.670) (-2942.196) -- 0:02:10 121500 -- [-2940.468] (-2936.348) (-2939.949) (-2935.794) * (-2939.571) [-2940.209] (-2943.087) (-2944.749) -- 0:02:10 122000 -- (-2943.179) (-2936.884) (-2941.877) [-2940.547] * (-2946.237) (-2936.371) [-2942.833] (-2942.366) -- 0:02:09 122500 -- (-2939.859) (-2937.905) (-2946.420) [-2940.141] * [-2937.974] (-2936.750) (-2934.210) (-2935.219) -- 0:02:08 123000 -- [-2935.908] (-2936.781) (-2937.533) (-2936.333) * (-2938.626) (-2935.062) [-2940.877] (-2947.319) -- 0:02:08 123500 -- [-2942.309] (-2938.450) (-2936.014) (-2938.298) * (-2936.569) (-2944.184) (-2940.099) [-2942.597] -- 0:02:07 124000 -- (-2936.078) (-2940.553) (-2944.395) [-2934.344] * (-2937.760) [-2937.618] (-2943.192) (-2940.435) -- 0:02:14 124500 -- (-2944.942) (-2949.690) (-2947.938) [-2937.360] * [-2942.618] (-2938.892) (-2940.571) (-2935.622) -- 0:02:13 125000 -- (-2946.149) [-2939.901] (-2941.974) (-2946.227) * [-2936.995] (-2943.758) (-2937.015) (-2941.026) -- 0:02:13 Average standard deviation of split frequencies: 0.011224 125500 -- (-2950.691) [-2942.871] (-2934.629) (-2946.462) * (-2941.691) [-2936.996] (-2944.999) (-2946.178) -- 0:02:12 126000 -- [-2944.689] (-2939.629) (-2936.083) (-2950.101) * (-2939.128) [-2940.603] (-2937.750) (-2938.391) -- 0:02:11 126500 -- (-2935.792) (-2938.616) (-2941.714) [-2939.273] * [-2937.450] (-2934.915) (-2939.337) (-2938.598) -- 0:02:11 127000 -- [-2933.838] (-2940.786) (-2935.977) (-2937.978) * (-2941.028) (-2943.043) (-2942.010) [-2945.078] -- 0:02:10 127500 -- (-2937.386) (-2944.999) [-2941.768] (-2939.700) * (-2942.514) (-2942.126) [-2934.116] (-2941.591) -- 0:02:10 128000 -- (-2944.952) (-2937.281) [-2943.233] (-2937.252) * (-2940.908) (-2935.489) [-2950.101] (-2940.831) -- 0:02:09 128500 -- (-2945.294) (-2938.874) [-2944.745] (-2946.190) * (-2940.156) (-2942.809) (-2943.673) [-2940.957] -- 0:02:08 129000 -- (-2940.727) (-2933.560) [-2938.301] (-2941.882) * (-2940.666) [-2944.701] (-2941.710) (-2942.552) -- 0:02:08 129500 -- [-2936.627] (-2938.747) (-2940.203) (-2940.165) * (-2939.262) (-2943.032) [-2935.344] (-2938.741) -- 0:02:07 130000 -- [-2934.058] (-2950.897) (-2938.906) (-2937.816) * [-2939.419] (-2945.339) (-2939.910) (-2936.725) -- 0:02:07 Average standard deviation of split frequencies: 0.010823 130500 -- [-2934.727] (-2938.801) (-2939.723) (-2939.409) * (-2938.182) [-2945.001] (-2941.969) (-2941.463) -- 0:02:06 131000 -- (-2936.341) (-2936.128) [-2936.688] (-2933.604) * (-2938.673) (-2942.501) [-2941.002] (-2937.736) -- 0:02:12 131500 -- (-2942.108) (-2943.877) [-2936.742] (-2941.319) * (-2937.674) (-2943.279) (-2945.262) [-2939.675] -- 0:02:12 132000 -- (-2936.256) (-2937.541) [-2935.329] (-2942.189) * [-2943.070] (-2935.879) (-2944.082) (-2941.915) -- 0:02:11 132500 -- [-2936.957] (-2942.020) (-2940.446) (-2939.244) * (-2942.980) (-2940.346) (-2939.633) [-2937.929] -- 0:02:10 133000 -- (-2943.527) (-2935.950) [-2935.931] (-2940.388) * [-2932.502] (-2939.603) (-2938.818) (-2937.430) -- 0:02:10 133500 -- (-2940.426) (-2939.842) (-2933.646) [-2935.894] * (-2935.586) (-2939.052) [-2942.852] (-2939.445) -- 0:02:09 134000 -- (-2937.393) (-2938.248) (-2934.124) [-2936.644] * (-2939.023) (-2935.760) [-2941.330] (-2943.306) -- 0:02:09 134500 -- (-2937.056) (-2941.271) [-2938.636] (-2939.166) * [-2938.972] (-2935.821) (-2936.444) (-2943.397) -- 0:02:08 135000 -- (-2941.083) (-2946.882) (-2943.603) [-2935.722] * [-2933.878] (-2941.562) (-2942.369) (-2939.966) -- 0:02:08 Average standard deviation of split frequencies: 0.010399 135500 -- (-2938.539) (-2941.185) [-2939.916] (-2939.974) * [-2939.341] (-2938.857) (-2943.514) (-2943.297) -- 0:02:07 136000 -- (-2935.983) [-2936.484] (-2938.245) (-2936.641) * (-2938.204) (-2943.189) (-2944.389) [-2942.074] -- 0:02:07 136500 -- (-2938.520) (-2941.459) [-2945.730] (-2935.144) * (-2938.038) (-2944.544) [-2939.373] (-2943.280) -- 0:02:06 137000 -- [-2942.107] (-2939.201) (-2943.333) (-2935.683) * (-2940.388) (-2937.207) [-2933.276] (-2942.178) -- 0:02:05 137500 -- (-2941.432) (-2936.707) (-2942.936) [-2939.897] * (-2944.802) (-2936.647) (-2937.890) [-2941.150] -- 0:02:11 138000 -- (-2936.599) (-2940.989) (-2938.927) [-2943.784] * [-2938.674] (-2938.956) (-2940.273) (-2940.087) -- 0:02:11 138500 -- (-2938.144) (-2944.863) [-2936.433] (-2936.418) * (-2939.998) (-2939.813) (-2936.452) [-2943.604] -- 0:02:10 139000 -- (-2940.846) (-2940.855) (-2945.031) [-2937.845] * (-2938.884) (-2944.235) (-2943.710) [-2941.579] -- 0:02:10 139500 -- (-2937.723) (-2935.370) (-2937.229) [-2943.188] * [-2936.308] (-2939.570) (-2934.204) (-2936.771) -- 0:02:09 140000 -- (-2941.476) (-2939.628) [-2944.951] (-2938.308) * [-2945.629] (-2932.520) (-2938.887) (-2937.505) -- 0:02:09 Average standard deviation of split frequencies: 0.010054 140500 -- (-2940.951) (-2939.644) [-2936.639] (-2934.245) * (-2944.160) (-2939.329) [-2936.348] (-2938.697) -- 0:02:08 141000 -- (-2941.417) [-2939.298] (-2940.947) (-2939.762) * [-2932.407] (-2940.424) (-2943.873) (-2941.361) -- 0:02:07 141500 -- [-2938.087] (-2940.199) (-2942.499) (-2942.198) * (-2937.371) [-2935.141] (-2938.087) (-2943.016) -- 0:02:07 142000 -- (-2940.157) [-2937.899] (-2936.244) (-2939.207) * [-2934.549] (-2934.659) (-2942.352) (-2947.094) -- 0:02:06 142500 -- [-2937.131] (-2941.610) (-2937.662) (-2944.780) * [-2932.681] (-2937.216) (-2939.741) (-2937.402) -- 0:02:06 143000 -- (-2943.042) (-2944.285) [-2938.605] (-2941.288) * (-2935.478) (-2937.663) [-2940.062] (-2939.240) -- 0:02:05 143500 -- [-2940.314] (-2938.870) (-2939.573) (-2942.015) * (-2937.537) [-2933.280] (-2940.357) (-2941.749) -- 0:02:05 144000 -- [-2939.544] (-2947.694) (-2936.918) (-2941.448) * (-2934.026) [-2937.906] (-2941.944) (-2936.753) -- 0:02:10 144500 -- (-2941.516) (-2939.323) [-2933.597] (-2941.918) * (-2943.535) [-2934.209] (-2949.128) (-2934.389) -- 0:02:10 145000 -- (-2949.603) (-2939.667) (-2936.812) [-2943.575] * (-2940.476) (-2939.884) (-2939.807) [-2936.239] -- 0:02:09 Average standard deviation of split frequencies: 0.009686 145500 -- (-2933.576) (-2939.093) [-2941.575] (-2934.568) * (-2943.121) (-2941.449) [-2937.679] (-2941.652) -- 0:02:09 146000 -- (-2938.137) (-2939.932) [-2949.075] (-2938.624) * (-2936.074) (-2943.433) (-2940.785) [-2935.864] -- 0:02:08 146500 -- (-2940.640) (-2936.723) [-2937.890] (-2939.837) * (-2943.159) [-2941.526] (-2940.623) (-2946.980) -- 0:02:08 147000 -- (-2941.711) [-2939.417] (-2944.794) (-2937.690) * (-2942.046) (-2940.559) (-2944.579) [-2939.293] -- 0:02:07 147500 -- (-2939.529) (-2940.479) (-2940.220) [-2936.884] * [-2937.300] (-2942.219) (-2944.347) (-2939.768) -- 0:02:07 148000 -- (-2951.566) (-2940.665) [-2937.922] (-2935.693) * [-2943.348] (-2939.212) (-2943.516) (-2939.223) -- 0:02:06 148500 -- (-2941.227) [-2941.532] (-2944.799) (-2938.980) * [-2941.945] (-2936.539) (-2943.142) (-2944.478) -- 0:02:06 149000 -- (-2942.063) (-2938.973) (-2950.570) [-2934.956] * (-2948.483) (-2939.496) (-2946.601) [-2941.659] -- 0:02:05 149500 -- [-2943.049] (-2937.249) (-2941.207) (-2932.418) * (-2940.949) [-2935.874] (-2941.841) (-2941.919) -- 0:02:05 150000 -- (-2943.268) (-2937.077) [-2942.232] (-2935.033) * (-2945.284) [-2938.022] (-2939.382) (-2940.541) -- 0:02:04 Average standard deviation of split frequencies: 0.012515 150500 -- (-2942.546) (-2939.070) [-2943.600] (-2936.167) * [-2939.589] (-2937.109) (-2937.998) (-2943.915) -- 0:02:09 151000 -- (-2947.873) (-2946.171) [-2938.722] (-2940.377) * (-2943.889) (-2935.049) (-2938.325) [-2937.376] -- 0:02:09 151500 -- (-2936.863) (-2935.053) (-2947.080) [-2935.528] * [-2944.609] (-2940.423) (-2936.934) (-2941.398) -- 0:02:08 152000 -- [-2937.757] (-2939.965) (-2939.875) (-2936.637) * [-2933.528] (-2939.598) (-2939.444) (-2943.726) -- 0:02:08 152500 -- (-2940.857) (-2944.406) (-2947.870) [-2937.831] * [-2938.284] (-2954.313) (-2937.630) (-2943.238) -- 0:02:07 153000 -- (-2934.372) (-2935.457) [-2936.559] (-2935.993) * (-2935.926) (-2946.692) [-2938.042] (-2936.317) -- 0:02:07 153500 -- [-2937.482] (-2943.374) (-2936.298) (-2946.018) * (-2935.656) (-2949.383) (-2936.649) [-2937.291] -- 0:02:06 154000 -- [-2939.388] (-2936.686) (-2939.253) (-2943.863) * [-2937.480] (-2944.372) (-2936.162) (-2938.246) -- 0:02:06 154500 -- (-2940.281) [-2936.934] (-2940.327) (-2935.428) * (-2943.614) (-2942.608) (-2937.724) [-2933.520] -- 0:02:05 155000 -- [-2940.523] (-2935.897) (-2943.710) (-2938.960) * (-2937.057) (-2937.457) (-2938.860) [-2934.867] -- 0:02:05 Average standard deviation of split frequencies: 0.012087 155500 -- (-2939.541) (-2943.669) [-2939.735] (-2939.157) * (-2938.878) (-2939.084) [-2944.872] (-2937.790) -- 0:02:10 156000 -- [-2945.287] (-2937.314) (-2937.165) (-2938.548) * (-2940.281) [-2940.579] (-2942.423) (-2936.821) -- 0:02:09 156500 -- (-2941.680) [-2936.366] (-2938.527) (-2938.706) * (-2938.287) (-2941.316) (-2939.762) [-2938.238] -- 0:02:09 157000 -- (-2939.460) (-2937.049) (-2938.065) [-2937.064] * (-2937.245) (-2938.943) (-2944.978) [-2937.174] -- 0:02:08 157500 -- (-2940.846) (-2939.509) [-2935.596] (-2942.491) * (-2945.693) (-2936.868) [-2940.417] (-2940.274) -- 0:02:08 158000 -- (-2937.228) [-2941.887] (-2933.348) (-2938.015) * (-2950.463) (-2943.285) (-2939.550) [-2940.847] -- 0:02:07 158500 -- [-2934.384] (-2942.432) (-2937.799) (-2940.112) * (-2941.241) (-2945.340) (-2942.419) [-2945.700] -- 0:02:07 159000 -- (-2947.514) (-2938.664) (-2939.013) [-2944.730] * [-2937.779] (-2936.072) (-2937.780) (-2945.026) -- 0:02:06 159500 -- (-2943.879) (-2937.066) (-2933.782) [-2941.025] * (-2940.011) (-2940.695) (-2940.362) [-2938.703] -- 0:02:06 160000 -- [-2940.145] (-2943.379) (-2939.305) (-2939.863) * [-2936.048] (-2940.016) (-2934.530) (-2942.365) -- 0:02:05 Average standard deviation of split frequencies: 0.011736 160500 -- (-2938.622) (-2946.852) [-2936.433] (-2941.148) * (-2940.752) [-2937.587] (-2941.602) (-2944.005) -- 0:02:05 161000 -- [-2941.412] (-2943.907) (-2943.145) (-2939.114) * (-2942.479) [-2938.963] (-2937.043) (-2937.420) -- 0:02:05 161500 -- (-2943.401) [-2936.782] (-2938.142) (-2945.130) * (-2948.444) (-2948.835) (-2941.829) [-2942.602] -- 0:02:04 162000 -- (-2939.805) [-2938.494] (-2938.442) (-2939.016) * (-2937.264) (-2941.136) [-2939.816] (-2936.120) -- 0:02:09 162500 -- (-2935.358) (-2942.641) [-2938.283] (-2936.787) * (-2940.238) (-2936.334) (-2936.321) [-2937.120] -- 0:02:08 163000 -- (-2939.537) (-2946.088) (-2942.513) [-2935.026] * [-2941.015] (-2935.862) (-2943.114) (-2942.333) -- 0:02:08 163500 -- (-2939.764) [-2937.006] (-2946.851) (-2937.149) * (-2939.020) (-2937.899) [-2938.353] (-2948.041) -- 0:02:07 164000 -- (-2938.078) [-2940.376] (-2938.773) (-2936.557) * (-2938.854) (-2947.132) (-2934.944) [-2936.816] -- 0:02:07 164500 -- [-2937.067] (-2941.842) (-2939.656) (-2935.652) * [-2936.079] (-2945.060) (-2943.293) (-2946.033) -- 0:02:06 165000 -- (-2936.216) [-2941.992] (-2939.359) (-2937.267) * (-2938.806) [-2939.742] (-2938.204) (-2942.880) -- 0:02:06 Average standard deviation of split frequencies: 0.014199 165500 -- (-2939.513) [-2940.493] (-2939.487) (-2944.575) * (-2942.788) [-2942.581] (-2939.114) (-2938.825) -- 0:02:06 166000 -- (-2943.042) (-2945.291) (-2943.791) [-2939.350] * (-2949.417) (-2947.521) (-2937.280) [-2946.236] -- 0:02:05 166500 -- (-2945.371) [-2935.308] (-2937.596) (-2939.345) * (-2935.251) (-2940.660) [-2936.167] (-2934.870) -- 0:02:05 167000 -- (-2945.767) (-2939.843) [-2934.172] (-2942.187) * (-2940.203) [-2937.696] (-2939.584) (-2936.789) -- 0:02:04 167500 -- (-2938.403) (-2937.560) (-2942.419) [-2936.267] * (-2937.564) (-2940.362) (-2942.101) [-2938.414] -- 0:02:04 168000 -- (-2940.233) (-2945.380) [-2936.414] (-2942.173) * (-2942.327) [-2935.551] (-2936.730) (-2939.104) -- 0:02:03 168500 -- [-2938.635] (-2944.597) (-2942.494) (-2948.211) * (-2938.056) [-2939.394] (-2942.982) (-2938.795) -- 0:02:08 169000 -- (-2936.806) (-2937.344) [-2938.210] (-2940.363) * (-2934.461) [-2933.059] (-2944.802) (-2939.347) -- 0:02:07 169500 -- (-2944.358) (-2943.849) (-2937.101) [-2940.866] * (-2940.193) (-2944.370) (-2944.420) [-2941.714] -- 0:02:07 170000 -- (-2939.683) (-2941.066) [-2937.747] (-2935.335) * [-2941.717] (-2941.264) (-2940.709) (-2938.405) -- 0:02:06 Average standard deviation of split frequencies: 0.013811 170500 -- [-2945.635] (-2941.033) (-2945.237) (-2938.956) * (-2941.734) (-2932.203) [-2937.105] (-2949.017) -- 0:02:06 171000 -- [-2943.152] (-2949.100) (-2940.864) (-2935.790) * (-2939.506) (-2937.575) [-2935.390] (-2938.454) -- 0:02:06 171500 -- [-2942.253] (-2938.384) (-2947.867) (-2937.087) * (-2939.205) [-2945.572] (-2939.473) (-2939.712) -- 0:02:05 172000 -- (-2937.128) [-2938.196] (-2941.051) (-2938.779) * (-2941.749) (-2942.756) [-2945.361] (-2950.772) -- 0:02:05 172500 -- (-2940.904) [-2941.103] (-2939.157) (-2938.513) * (-2937.540) (-2937.348) (-2940.734) [-2937.397] -- 0:02:04 173000 -- (-2942.548) (-2936.034) (-2946.289) [-2937.412] * (-2938.943) (-2938.982) [-2941.345] (-2933.778) -- 0:02:04 173500 -- (-2935.663) (-2946.637) (-2940.151) [-2940.206] * [-2937.427] (-2936.086) (-2933.564) (-2936.702) -- 0:02:03 174000 -- (-2945.335) (-2943.858) [-2940.441] (-2946.534) * (-2940.245) (-2941.466) (-2934.991) [-2939.555] -- 0:02:03 174500 -- (-2945.548) (-2938.226) (-2941.865) [-2944.779] * (-2941.400) (-2940.376) (-2939.080) [-2938.800] -- 0:02:02 175000 -- (-2940.849) [-2936.464] (-2938.445) (-2944.396) * [-2935.923] (-2942.376) (-2943.093) (-2945.885) -- 0:02:02 Average standard deviation of split frequencies: 0.016071 175500 -- [-2937.477] (-2943.536) (-2947.711) (-2944.447) * (-2942.112) (-2939.168) (-2942.809) [-2940.615] -- 0:02:06 176000 -- (-2936.795) [-2940.229] (-2937.367) (-2948.371) * (-2944.207) [-2938.102] (-2938.206) (-2942.238) -- 0:02:06 176500 -- (-2937.318) (-2936.254) [-2937.924] (-2946.723) * [-2939.085] (-2945.426) (-2940.051) (-2939.236) -- 0:02:05 177000 -- (-2940.192) (-2935.997) (-2940.804) [-2941.500] * (-2943.437) [-2937.237] (-2944.455) (-2937.076) -- 0:02:05 177500 -- [-2938.969] (-2943.071) (-2939.658) (-2939.275) * (-2938.742) (-2948.207) [-2940.255] (-2939.554) -- 0:02:05 178000 -- (-2938.404) [-2936.530] (-2936.868) (-2940.531) * (-2937.392) [-2939.882] (-2944.531) (-2943.589) -- 0:02:04 178500 -- [-2939.720] (-2938.728) (-2936.798) (-2949.145) * (-2939.367) (-2939.933) [-2935.950] (-2946.843) -- 0:02:04 179000 -- (-2938.138) (-2938.312) [-2939.990] (-2941.221) * (-2941.179) (-2935.027) (-2933.377) [-2947.907] -- 0:02:03 179500 -- (-2938.697) [-2942.816] (-2938.319) (-2943.727) * (-2940.808) [-2947.508] (-2936.206) (-2948.264) -- 0:02:03 180000 -- [-2937.504] (-2944.471) (-2939.287) (-2943.885) * (-2942.929) (-2952.205) (-2944.906) [-2938.635] -- 0:02:02 Average standard deviation of split frequencies: 0.013046 180500 -- [-2943.457] (-2939.379) (-2941.012) (-2935.330) * [-2942.433] (-2940.594) (-2946.654) (-2943.075) -- 0:02:02 181000 -- (-2950.568) (-2943.595) (-2941.762) [-2938.204] * (-2939.092) [-2943.866] (-2935.738) (-2944.988) -- 0:02:02 181500 -- (-2946.254) (-2939.939) [-2935.134] (-2938.817) * (-2942.124) [-2938.398] (-2947.059) (-2942.923) -- 0:02:06 182000 -- (-2943.837) [-2936.616] (-2933.981) (-2950.496) * (-2937.132) [-2937.034] (-2936.771) (-2942.423) -- 0:02:05 182500 -- (-2938.728) (-2935.420) [-2937.866] (-2942.853) * [-2940.993] (-2942.013) (-2938.970) (-2946.114) -- 0:02:05 183000 -- (-2944.041) [-2935.713] (-2942.782) (-2942.361) * (-2943.200) [-2941.857] (-2942.426) (-2937.933) -- 0:02:05 183500 -- (-2933.247) (-2934.075) (-2948.771) [-2942.156] * (-2942.383) [-2936.079] (-2938.272) (-2936.373) -- 0:02:04 184000 -- (-2935.038) (-2934.710) [-2940.599] (-2937.607) * (-2939.043) (-2939.241) (-2937.256) [-2934.354] -- 0:02:04 184500 -- (-2939.762) (-2934.829) [-2936.042] (-2937.620) * [-2945.703] (-2939.248) (-2936.576) (-2946.307) -- 0:02:03 185000 -- (-2934.888) (-2936.866) (-2932.203) [-2938.472] * (-2943.757) [-2937.257] (-2932.831) (-2944.202) -- 0:02:03 Average standard deviation of split frequencies: 0.012672 185500 -- (-2938.160) (-2938.667) [-2944.368] (-2939.543) * [-2941.387] (-2938.577) (-2935.257) (-2939.303) -- 0:02:02 186000 -- [-2941.719] (-2944.902) (-2942.101) (-2940.974) * (-2949.564) [-2934.544] (-2935.890) (-2938.291) -- 0:02:02 186500 -- [-2940.411] (-2942.968) (-2947.085) (-2936.288) * (-2942.210) (-2939.057) (-2941.517) [-2935.146] -- 0:02:02 187000 -- (-2941.238) (-2943.855) (-2943.418) [-2937.102] * [-2940.335] (-2939.092) (-2946.085) (-2937.518) -- 0:02:01 187500 -- (-2942.243) (-2949.984) (-2942.494) [-2935.928] * (-2941.695) [-2937.854] (-2941.038) (-2934.284) -- 0:02:01 188000 -- [-2940.280] (-2943.467) (-2944.718) (-2936.272) * (-2940.401) [-2940.976] (-2941.433) (-2939.820) -- 0:02:05 188500 -- (-2938.440) [-2944.414] (-2941.196) (-2941.130) * [-2941.924] (-2938.215) (-2944.463) (-2934.098) -- 0:02:04 189000 -- (-2949.348) [-2939.812] (-2943.569) (-2937.821) * (-2939.853) [-2936.615] (-2943.412) (-2935.121) -- 0:02:04 189500 -- (-2944.068) (-2938.269) [-2937.363] (-2937.477) * (-2938.256) [-2937.818] (-2939.876) (-2934.157) -- 0:02:04 190000 -- (-2940.027) (-2942.295) (-2945.821) [-2935.058] * (-2948.282) (-2945.295) (-2940.344) [-2937.838] -- 0:02:03 Average standard deviation of split frequencies: 0.012362 190500 -- (-2938.285) (-2951.532) [-2940.811] (-2943.845) * [-2937.960] (-2932.810) (-2939.758) (-2939.543) -- 0:02:03 191000 -- (-2940.500) (-2943.096) [-2940.296] (-2943.651) * (-2946.044) (-2937.570) (-2937.161) [-2942.467] -- 0:02:02 191500 -- (-2939.006) (-2943.039) (-2938.927) [-2939.600] * (-2940.898) [-2937.321] (-2944.558) (-2940.300) -- 0:02:02 192000 -- [-2943.246] (-2939.797) (-2940.674) (-2947.145) * (-2941.027) (-2940.380) [-2941.307] (-2942.050) -- 0:02:02 192500 -- [-2941.166] (-2938.155) (-2937.590) (-2943.245) * (-2936.916) (-2946.515) (-2946.121) [-2945.685] -- 0:02:01 193000 -- [-2941.798] (-2937.530) (-2945.282) (-2941.966) * [-2936.132] (-2943.565) (-2939.449) (-2936.040) -- 0:02:01 193500 -- [-2940.045] (-2943.734) (-2940.783) (-2941.891) * (-2935.495) (-2937.716) [-2937.801] (-2939.954) -- 0:02:00 194000 -- [-2942.886] (-2946.792) (-2938.203) (-2934.193) * (-2935.218) [-2939.553] (-2943.249) (-2940.491) -- 0:02:00 194500 -- [-2940.597] (-2941.973) (-2940.852) (-2933.312) * (-2934.692) [-2937.436] (-2943.910) (-2938.291) -- 0:02:04 195000 -- (-2941.218) [-2943.504] (-2940.435) (-2937.441) * (-2939.276) (-2940.382) [-2939.193] (-2938.742) -- 0:02:03 Average standard deviation of split frequencies: 0.012026 195500 -- (-2932.190) (-2939.224) [-2945.742] (-2942.251) * (-2941.836) [-2936.261] (-2948.651) (-2937.454) -- 0:02:03 196000 -- (-2934.145) (-2941.565) [-2940.834] (-2938.341) * [-2935.040] (-2940.137) (-2940.726) (-2941.484) -- 0:02:03 196500 -- (-2939.033) (-2938.245) [-2936.486] (-2937.522) * (-2934.517) [-2940.093] (-2941.897) (-2945.111) -- 0:02:02 197000 -- (-2935.703) (-2936.788) (-2939.231) [-2936.388] * [-2942.258] (-2936.657) (-2938.877) (-2943.009) -- 0:02:02 197500 -- [-2937.240] (-2945.637) (-2937.339) (-2937.741) * (-2937.474) [-2933.419] (-2935.345) (-2945.957) -- 0:02:01 198000 -- [-2935.044] (-2940.223) (-2936.391) (-2941.251) * (-2936.540) (-2937.369) [-2935.417] (-2936.369) -- 0:02:01 198500 -- (-2941.214) [-2936.692] (-2939.467) (-2933.206) * (-2935.400) [-2937.617] (-2940.585) (-2941.414) -- 0:02:01 199000 -- (-2937.372) [-2939.345] (-2933.730) (-2940.654) * (-2938.063) [-2941.870] (-2946.204) (-2938.038) -- 0:02:00 199500 -- [-2938.461] (-2938.843) (-2938.012) (-2943.201) * [-2938.726] (-2944.830) (-2937.650) (-2939.912) -- 0:02:00 200000 -- (-2934.712) (-2935.595) (-2939.130) [-2938.015] * (-2942.105) (-2949.283) [-2945.523] (-2940.468) -- 0:01:59 Average standard deviation of split frequencies: 0.014095 200500 -- [-2937.781] (-2939.364) (-2942.488) (-2942.868) * (-2941.620) (-2943.236) [-2936.388] (-2947.821) -- 0:01:59 201000 -- [-2942.564] (-2942.027) (-2950.628) (-2937.307) * [-2941.856] (-2943.782) (-2937.885) (-2941.336) -- 0:02:03 201500 -- (-2939.760) (-2941.266) (-2944.204) [-2939.040] * (-2941.747) (-2938.788) [-2934.618] (-2945.299) -- 0:02:02 202000 -- (-2937.318) (-2938.849) [-2938.762] (-2939.186) * (-2941.741) (-2934.067) [-2943.354] (-2939.772) -- 0:02:02 202500 -- [-2937.239] (-2937.159) (-2937.494) (-2938.006) * (-2941.954) (-2939.396) (-2944.418) [-2945.581] -- 0:02:02 203000 -- [-2939.213] (-2937.587) (-2943.346) (-2940.483) * (-2939.194) (-2939.426) [-2941.871] (-2938.839) -- 0:02:01 203500 -- (-2943.962) [-2940.818] (-2945.812) (-2942.258) * (-2945.319) (-2952.804) [-2937.188] (-2942.338) -- 0:02:01 204000 -- (-2938.818) (-2934.347) (-2941.331) [-2942.922] * [-2939.414] (-2941.540) (-2935.915) (-2939.743) -- 0:02:00 204500 -- (-2939.603) (-2937.041) (-2943.515) [-2944.084] * (-2940.975) (-2936.467) [-2945.557] (-2940.451) -- 0:02:00 205000 -- (-2946.685) (-2942.477) [-2935.563] (-2936.112) * (-2943.211) (-2939.722) (-2937.462) [-2945.722] -- 0:02:00 Average standard deviation of split frequencies: 0.016019 205500 -- (-2938.137) (-2939.228) (-2937.155) [-2936.880] * (-2948.496) (-2941.454) [-2935.054] (-2943.907) -- 0:01:59 206000 -- (-2933.067) (-2942.558) [-2938.454] (-2939.620) * (-2943.912) (-2939.480) [-2934.531] (-2942.544) -- 0:01:59 206500 -- (-2933.669) [-2936.827] (-2937.362) (-2945.218) * (-2943.397) (-2952.087) (-2941.516) [-2941.393] -- 0:01:59 207000 -- [-2937.072] (-2944.398) (-2943.002) (-2932.816) * [-2940.855] (-2941.253) (-2942.100) (-2946.231) -- 0:01:58 207500 -- (-2940.596) (-2943.374) (-2936.719) [-2937.839] * (-2950.407) [-2938.975] (-2946.637) (-2945.371) -- 0:02:02 208000 -- [-2943.204] (-2941.890) (-2938.733) (-2941.077) * (-2946.787) [-2939.481] (-2944.019) (-2936.775) -- 0:02:01 208500 -- [-2935.346] (-2942.662) (-2935.562) (-2940.280) * (-2941.080) (-2938.282) (-2939.564) [-2938.803] -- 0:02:01 209000 -- [-2933.709] (-2935.892) (-2939.151) (-2940.354) * (-2940.148) (-2941.237) [-2939.059] (-2937.469) -- 0:02:01 209500 -- (-2935.519) (-2941.629) [-2934.180] (-2936.481) * (-2935.094) [-2938.517] (-2936.763) (-2939.839) -- 0:02:00 210000 -- [-2944.646] (-2939.340) (-2937.987) (-2940.758) * (-2939.472) [-2939.437] (-2942.812) (-2943.346) -- 0:02:00 Average standard deviation of split frequencies: 0.015664 210500 -- (-2943.621) (-2934.201) [-2940.133] (-2937.429) * (-2942.308) (-2938.988) (-2937.181) [-2935.092] -- 0:02:00 211000 -- (-2936.079) (-2939.279) (-2932.687) [-2940.973] * (-2937.508) (-2937.528) (-2936.390) [-2939.594] -- 0:01:59 211500 -- (-2934.498) (-2940.940) [-2935.544] (-2936.921) * [-2941.898] (-2942.781) (-2936.533) (-2937.132) -- 0:01:59 212000 -- [-2936.853] (-2938.413) (-2934.647) (-2942.642) * (-2939.353) [-2938.766] (-2945.431) (-2936.982) -- 0:01:58 212500 -- [-2940.998] (-2937.369) (-2943.043) (-2938.688) * [-2941.008] (-2937.188) (-2944.163) (-2936.808) -- 0:01:58 213000 -- (-2937.625) [-2936.267] (-2938.235) (-2935.452) * (-2934.382) [-2936.014] (-2946.473) (-2935.191) -- 0:01:58 213500 -- (-2948.015) (-2940.354) [-2938.539] (-2940.162) * (-2938.343) (-2940.369) (-2939.782) [-2937.190] -- 0:01:57 214000 -- (-2942.623) [-2936.180] (-2941.766) (-2945.204) * [-2933.387] (-2939.557) (-2944.624) (-2936.867) -- 0:01:57 214500 -- (-2941.904) [-2942.319] (-2935.838) (-2942.706) * [-2942.598] (-2937.932) (-2941.407) (-2937.165) -- 0:02:00 215000 -- (-2939.232) (-2934.368) [-2941.679] (-2939.047) * (-2938.524) (-2937.281) [-2940.803] (-2938.067) -- 0:02:00 Average standard deviation of split frequencies: 0.013095 215500 -- (-2937.811) (-2942.347) (-2936.615) [-2941.362] * (-2938.822) [-2942.488] (-2946.045) (-2938.173) -- 0:02:00 216000 -- [-2938.123] (-2945.098) (-2943.177) (-2938.688) * (-2941.584) [-2940.669] (-2942.792) (-2943.401) -- 0:01:59 216500 -- (-2939.097) [-2942.433] (-2935.887) (-2941.968) * (-2937.802) (-2942.912) [-2942.833] (-2943.897) -- 0:01:59 217000 -- (-2947.035) [-2937.682] (-2944.818) (-2942.908) * (-2941.895) (-2942.019) [-2939.203] (-2944.410) -- 0:01:59 217500 -- (-2943.155) (-2942.215) (-2942.530) [-2934.125] * [-2936.465] (-2943.227) (-2942.172) (-2935.066) -- 0:01:58 218000 -- (-2936.867) [-2941.676] (-2939.779) (-2939.945) * (-2937.518) [-2939.613] (-2942.673) (-2944.882) -- 0:01:58 218500 -- (-2940.112) (-2943.855) [-2945.161] (-2940.503) * (-2941.424) [-2936.893] (-2938.429) (-2938.535) -- 0:01:58 219000 -- (-2939.033) [-2935.633] (-2944.357) (-2935.726) * (-2939.403) (-2942.380) [-2935.563] (-2941.245) -- 0:01:57 219500 -- (-2938.795) [-2944.464] (-2939.931) (-2943.392) * (-2939.606) (-2940.841) (-2939.461) [-2940.868] -- 0:01:57 220000 -- (-2936.881) (-2940.768) [-2938.158] (-2933.370) * (-2940.301) [-2941.512] (-2941.578) (-2940.546) -- 0:01:56 Average standard deviation of split frequencies: 0.010681 220500 -- [-2940.488] (-2944.765) (-2933.413) (-2937.499) * (-2943.002) [-2936.746] (-2938.634) (-2935.411) -- 0:01:56 221000 -- [-2938.206] (-2938.265) (-2937.515) (-2940.360) * [-2948.469] (-2940.584) (-2941.601) (-2937.327) -- 0:01:59 221500 -- (-2942.364) (-2940.513) (-2937.804) [-2938.939] * (-2934.977) (-2936.439) [-2937.840] (-2941.014) -- 0:01:59 222000 -- [-2939.092] (-2938.915) (-2942.176) (-2941.908) * [-2937.641] (-2941.428) (-2938.268) (-2942.880) -- 0:01:59 222500 -- [-2935.244] (-2938.028) (-2939.016) (-2944.777) * (-2938.244) (-2937.482) (-2938.201) [-2944.525] -- 0:01:58 223000 -- (-2944.954) (-2938.906) [-2940.931] (-2933.339) * [-2941.478] (-2944.387) (-2934.305) (-2939.502) -- 0:01:58 223500 -- (-2938.143) (-2939.490) (-2938.336) [-2939.282] * (-2940.806) (-2935.086) (-2943.553) [-2942.113] -- 0:01:58 224000 -- (-2946.686) (-2942.767) [-2937.359] (-2936.746) * (-2945.579) (-2940.460) [-2936.189] (-2941.018) -- 0:01:57 224500 -- (-2939.821) (-2939.033) (-2941.476) [-2945.856] * (-2936.201) (-2934.996) [-2936.739] (-2942.752) -- 0:01:57 225000 -- (-2941.997) (-2945.063) (-2944.495) [-2941.804] * [-2942.049] (-2944.804) (-2938.791) (-2937.335) -- 0:01:57 Average standard deviation of split frequencies: 0.010429 225500 -- (-2943.308) (-2939.015) (-2944.916) [-2939.341] * (-2936.548) (-2947.839) [-2938.236] (-2939.783) -- 0:01:56 226000 -- (-2936.937) (-2937.917) [-2934.283] (-2936.559) * [-2935.489] (-2947.215) (-2942.424) (-2941.288) -- 0:01:56 226500 -- (-2943.614) (-2943.338) [-2938.835] (-2934.622) * (-2942.247) (-2939.373) [-2945.091] (-2940.999) -- 0:01:56 227000 -- (-2937.093) (-2943.733) [-2936.089] (-2940.313) * (-2946.695) [-2936.740] (-2942.076) (-2945.087) -- 0:01:55 227500 -- (-2937.206) (-2935.873) [-2935.731] (-2940.056) * (-2937.743) (-2939.399) (-2942.951) [-2936.929] -- 0:01:58 228000 -- (-2941.263) (-2937.063) (-2937.288) [-2935.765] * (-2943.506) [-2938.210] (-2948.380) (-2936.316) -- 0:01:58 228500 -- (-2941.396) [-2937.187] (-2941.338) (-2944.609) * (-2940.443) [-2932.945] (-2945.124) (-2939.700) -- 0:01:58 229000 -- (-2937.594) (-2942.325) [-2939.895] (-2940.099) * (-2939.591) (-2937.974) (-2939.735) [-2938.781] -- 0:01:57 229500 -- [-2935.740] (-2941.838) (-2946.678) (-2939.294) * (-2940.759) (-2940.225) [-2942.191] (-2942.755) -- 0:01:57 230000 -- [-2937.687] (-2946.253) (-2937.699) (-2936.455) * (-2940.532) [-2941.362] (-2942.399) (-2939.662) -- 0:01:57 Average standard deviation of split frequencies: 0.010218 230500 -- (-2935.150) [-2941.410] (-2942.287) (-2937.867) * [-2938.288] (-2941.497) (-2938.432) (-2939.901) -- 0:01:56 231000 -- (-2936.862) (-2940.997) [-2935.841] (-2935.488) * [-2935.063] (-2941.911) (-2936.522) (-2937.481) -- 0:01:56 231500 -- (-2936.306) (-2945.966) [-2943.554] (-2942.783) * (-2939.594) (-2936.308) (-2952.439) [-2937.503] -- 0:01:56 232000 -- [-2947.752] (-2942.666) (-2942.169) (-2939.774) * [-2940.123] (-2940.254) (-2947.500) (-2942.075) -- 0:01:55 232500 -- [-2941.116] (-2938.826) (-2945.650) (-2941.127) * (-2939.805) (-2938.680) [-2942.271] (-2939.036) -- 0:01:55 233000 -- [-2946.358] (-2936.499) (-2939.442) (-2940.114) * (-2939.863) (-2945.224) (-2942.219) [-2939.911] -- 0:01:55 233500 -- (-2943.587) (-2938.766) (-2937.502) [-2940.352] * [-2932.651] (-2941.210) (-2938.648) (-2940.061) -- 0:01:58 234000 -- (-2938.986) [-2939.491] (-2950.273) (-2940.546) * [-2937.926] (-2941.840) (-2937.584) (-2941.064) -- 0:01:57 234500 -- (-2940.376) [-2937.857] (-2933.800) (-2939.984) * [-2935.794] (-2934.970) (-2935.984) (-2938.105) -- 0:01:57 235000 -- (-2944.122) (-2934.915) (-2942.640) [-2937.966] * (-2947.515) (-2946.274) (-2938.010) [-2936.569] -- 0:01:57 Average standard deviation of split frequencies: 0.005992 235500 -- (-2940.295) (-2943.623) (-2930.790) [-2938.596] * (-2940.415) [-2939.736] (-2938.842) (-2935.972) -- 0:01:56 236000 -- (-2947.959) (-2940.811) (-2943.712) [-2936.026] * (-2936.986) (-2940.374) (-2938.104) [-2933.342] -- 0:01:56 236500 -- (-2938.059) (-2942.258) (-2938.050) [-2939.801] * (-2946.291) [-2940.996] (-2945.881) (-2939.247) -- 0:01:56 237000 -- (-2949.242) [-2934.464] (-2942.588) (-2941.343) * (-2938.991) (-2941.996) (-2945.079) [-2936.356] -- 0:01:55 237500 -- (-2953.827) (-2938.546) [-2938.283] (-2936.104) * [-2934.787] (-2940.891) (-2937.150) (-2940.921) -- 0:01:55 238000 -- (-2948.465) (-2946.697) [-2939.242] (-2936.830) * (-2942.153) (-2943.808) (-2937.626) [-2937.584] -- 0:01:55 238500 -- (-2945.680) (-2942.259) (-2948.341) [-2939.755] * (-2944.752) (-2942.293) (-2941.322) [-2939.416] -- 0:01:54 239000 -- (-2947.316) (-2940.991) [-2943.227] (-2936.310) * [-2940.033] (-2941.354) (-2936.954) (-2937.762) -- 0:01:54 239500 -- [-2939.615] (-2943.073) (-2942.295) (-2948.250) * (-2943.369) [-2935.835] (-2935.898) (-2937.504) -- 0:01:54 240000 -- [-2942.787] (-2941.229) (-2939.437) (-2941.534) * [-2938.838] (-2936.381) (-2936.484) (-2943.924) -- 0:01:57 Average standard deviation of split frequencies: 0.007835 240500 -- (-2940.654) (-2936.214) (-2942.120) [-2937.914] * [-2939.565] (-2943.879) (-2940.616) (-2937.923) -- 0:01:56 241000 -- (-2936.434) (-2944.188) [-2936.527] (-2941.195) * [-2940.911] (-2944.056) (-2942.216) (-2941.481) -- 0:01:56 241500 -- [-2938.823] (-2944.920) (-2936.594) (-2939.058) * (-2940.173) (-2948.973) (-2934.844) [-2938.716] -- 0:01:56 242000 -- [-2937.073] (-2941.482) (-2942.828) (-2939.165) * (-2937.292) (-2937.922) (-2934.824) [-2937.333] -- 0:01:55 242500 -- (-2935.826) (-2939.591) (-2937.094) [-2935.300] * (-2937.824) (-2938.529) [-2937.287] (-2943.735) -- 0:01:55 243000 -- (-2937.852) [-2934.953] (-2937.625) (-2937.834) * [-2938.602] (-2937.764) (-2946.057) (-2950.204) -- 0:01:55 243500 -- [-2932.301] (-2943.426) (-2944.303) (-2937.101) * [-2939.519] (-2938.120) (-2939.264) (-2944.533) -- 0:01:54 244000 -- (-2937.291) (-2942.592) (-2935.788) [-2936.625] * (-2942.258) [-2937.860] (-2943.338) (-2941.691) -- 0:01:54 244500 -- (-2945.431) [-2937.170] (-2941.467) (-2946.034) * (-2941.218) [-2942.109] (-2947.889) (-2937.882) -- 0:01:54 245000 -- [-2945.416] (-2937.233) (-2947.393) (-2934.511) * (-2944.471) [-2943.423] (-2939.014) (-2935.710) -- 0:01:54 Average standard deviation of split frequencies: 0.007665 245500 -- (-2937.935) (-2940.889) [-2943.419] (-2934.383) * (-2944.822) (-2956.514) (-2936.236) [-2936.317] -- 0:01:53 246000 -- (-2936.075) (-2941.605) (-2933.691) [-2936.444] * (-2938.040) (-2942.678) (-2940.874) [-2939.796] -- 0:01:53 246500 -- [-2938.890] (-2943.131) (-2942.280) (-2941.683) * (-2939.056) (-2943.050) (-2941.189) [-2936.930] -- 0:01:56 247000 -- [-2936.831] (-2932.330) (-2936.262) (-2938.221) * (-2943.109) (-2940.302) (-2940.895) [-2934.255] -- 0:01:55 247500 -- (-2938.468) [-2937.532] (-2940.099) (-2941.531) * (-2936.421) (-2941.984) [-2940.684] (-2935.940) -- 0:01:55 248000 -- [-2941.293] (-2949.058) (-2938.293) (-2941.870) * [-2937.363] (-2935.702) (-2945.790) (-2946.095) -- 0:01:55 248500 -- [-2932.258] (-2941.014) (-2940.553) (-2942.980) * (-2938.544) (-2939.635) (-2938.887) [-2944.098] -- 0:01:54 249000 -- (-2936.174) (-2947.560) (-2934.957) [-2945.308] * (-2949.574) (-2936.446) [-2940.168] (-2937.667) -- 0:01:54 249500 -- [-2938.965] (-2940.037) (-2936.757) (-2948.373) * (-2938.169) [-2938.439] (-2938.908) (-2937.593) -- 0:01:54 250000 -- [-2943.227] (-2944.158) (-2938.718) (-2937.314) * [-2937.702] (-2935.964) (-2948.942) (-2938.566) -- 0:01:54 Average standard deviation of split frequencies: 0.007522 250500 -- (-2940.550) (-2935.478) [-2941.087] (-2938.875) * (-2940.767) [-2938.632] (-2949.585) (-2943.254) -- 0:01:53 251000 -- (-2940.766) (-2938.046) [-2935.573] (-2937.654) * (-2942.219) [-2933.899] (-2942.975) (-2941.623) -- 0:01:53 251500 -- (-2939.567) (-2944.469) [-2941.180] (-2938.416) * (-2937.845) (-2947.045) (-2940.758) [-2940.943] -- 0:01:53 252000 -- (-2939.795) (-2942.451) (-2945.101) [-2941.935] * [-2946.331] (-2939.839) (-2943.481) (-2951.537) -- 0:01:52 252500 -- (-2939.469) (-2944.494) [-2939.145] (-2939.294) * [-2935.607] (-2952.747) (-2942.789) (-2939.909) -- 0:01:52 253000 -- (-2943.480) (-2945.548) [-2944.216] (-2944.421) * (-2937.763) (-2940.475) (-2940.978) [-2937.975] -- 0:01:55 253500 -- [-2936.466] (-2941.076) (-2937.694) (-2945.540) * (-2935.605) (-2937.844) (-2936.157) [-2941.681] -- 0:01:54 254000 -- (-2936.617) [-2945.453] (-2935.188) (-2937.302) * [-2937.568] (-2938.605) (-2939.977) (-2942.822) -- 0:01:54 254500 -- [-2938.899] (-2939.773) (-2937.894) (-2934.852) * (-2946.682) (-2938.166) [-2934.643] (-2940.044) -- 0:01:54 255000 -- (-2941.620) (-2942.236) (-2943.617) [-2934.515] * (-2942.787) (-2938.732) [-2935.161] (-2940.258) -- 0:01:53 Average standard deviation of split frequencies: 0.011049 255500 -- (-2939.622) [-2936.762] (-2936.833) (-2941.826) * [-2934.056] (-2937.492) (-2942.850) (-2939.044) -- 0:01:53 256000 -- (-2947.349) [-2942.577] (-2934.298) (-2941.448) * (-2934.131) (-2936.789) [-2943.070] (-2937.208) -- 0:01:53 256500 -- [-2949.952] (-2934.161) (-2936.873) (-2945.144) * [-2937.556] (-2943.336) (-2942.782) (-2936.941) -- 0:01:53 257000 -- (-2946.110) (-2950.906) (-2941.688) [-2939.870] * (-2937.870) (-2938.240) (-2935.085) [-2935.889] -- 0:01:52 257500 -- (-2936.999) [-2938.229] (-2941.430) (-2942.201) * (-2937.557) (-2936.643) [-2935.712] (-2937.424) -- 0:01:52 258000 -- (-2940.561) (-2945.780) (-2938.986) [-2939.479] * (-2936.475) (-2948.502) [-2939.804] (-2941.622) -- 0:01:52 258500 -- (-2940.338) (-2949.243) (-2939.675) [-2943.118] * (-2938.074) (-2941.241) [-2936.098] (-2941.960) -- 0:01:51 259000 -- [-2946.766] (-2941.495) (-2945.110) (-2937.821) * (-2941.363) (-2936.224) [-2933.056] (-2940.838) -- 0:01:51 259500 -- (-2936.976) (-2938.024) [-2934.134] (-2941.062) * [-2945.072] (-2939.212) (-2934.833) (-2938.687) -- 0:01:54 260000 -- (-2943.094) (-2941.039) [-2940.971] (-2934.496) * (-2946.566) (-2943.766) (-2946.600) [-2940.112] -- 0:01:53 Average standard deviation of split frequencies: 0.016276 260500 -- [-2943.379] (-2938.385) (-2940.641) (-2939.868) * (-2942.762) [-2942.932] (-2954.120) (-2938.851) -- 0:01:53 261000 -- [-2939.962] (-2932.679) (-2935.588) (-2943.766) * (-2945.119) [-2937.397] (-2942.269) (-2936.741) -- 0:01:53 261500 -- [-2946.077] (-2937.511) (-2937.809) (-2941.871) * (-2943.724) (-2935.779) (-2939.666) [-2934.262] -- 0:01:52 262000 -- (-2938.476) (-2939.431) [-2939.385] (-2943.804) * (-2944.536) (-2940.932) [-2944.876] (-2935.279) -- 0:01:52 262500 -- [-2941.887] (-2936.169) (-2943.062) (-2942.919) * (-2943.349) [-2939.050] (-2937.587) (-2940.142) -- 0:01:52 263000 -- (-2944.541) [-2935.589] (-2952.463) (-2942.209) * (-2939.349) [-2937.595] (-2935.158) (-2940.457) -- 0:01:52 263500 -- (-2936.698) (-2938.297) (-2943.854) [-2937.879] * (-2939.586) (-2932.671) [-2942.838] (-2944.241) -- 0:01:51 264000 -- (-2942.938) [-2935.443] (-2947.463) (-2936.657) * (-2942.458) [-2941.902] (-2939.826) (-2939.460) -- 0:01:51 264500 -- [-2945.292] (-2944.904) (-2942.333) (-2938.073) * (-2936.433) (-2942.586) (-2939.031) [-2939.727] -- 0:01:51 265000 -- (-2943.714) (-2939.396) [-2937.570] (-2943.018) * (-2940.703) (-2942.578) (-2946.138) [-2939.894] -- 0:01:50 Average standard deviation of split frequencies: 0.015950 265500 -- (-2939.440) (-2940.086) [-2942.365] (-2940.407) * [-2936.558] (-2943.661) (-2938.018) (-2942.676) -- 0:01:50 266000 -- (-2936.259) (-2935.885) [-2937.646] (-2938.094) * (-2940.532) (-2940.867) (-2942.948) [-2942.393] -- 0:01:53 266500 -- (-2935.235) [-2937.568] (-2936.145) (-2942.897) * (-2941.621) (-2938.456) (-2942.770) [-2942.524] -- 0:01:52 267000 -- (-2940.364) (-2940.480) (-2944.860) [-2939.428] * (-2939.254) (-2937.290) (-2939.988) [-2934.383] -- 0:01:52 267500 -- (-2938.881) [-2939.112] (-2939.552) (-2937.525) * (-2936.749) (-2941.441) [-2937.736] (-2935.301) -- 0:01:52 268000 -- (-2935.192) (-2940.188) [-2938.682] (-2938.585) * (-2936.848) (-2939.102) [-2938.369] (-2934.835) -- 0:01:51 268500 -- [-2940.824] (-2946.183) (-2937.069) (-2940.029) * (-2945.321) [-2939.895] (-2941.017) (-2938.575) -- 0:01:51 269000 -- (-2934.848) (-2941.395) [-2944.018] (-2940.091) * (-2937.537) (-2939.212) (-2937.635) [-2937.252] -- 0:01:51 269500 -- (-2944.402) (-2941.062) (-2944.198) [-2936.854] * (-2938.551) (-2937.577) [-2939.230] (-2938.383) -- 0:01:51 270000 -- (-2936.301) (-2942.712) [-2936.014] (-2939.079) * (-2941.026) (-2948.306) (-2939.130) [-2938.359] -- 0:01:50 Average standard deviation of split frequencies: 0.015675 270500 -- [-2939.160] (-2947.217) (-2945.319) (-2937.187) * (-2937.376) (-2940.755) (-2944.142) [-2935.576] -- 0:01:50 271000 -- (-2937.595) (-2945.931) [-2944.639] (-2937.205) * (-2940.494) (-2939.776) (-2948.046) [-2936.137] -- 0:01:50 271500 -- (-2939.079) (-2945.056) (-2944.437) [-2933.635] * [-2933.872] (-2940.914) (-2937.142) (-2943.886) -- 0:01:50 272000 -- [-2939.740] (-2945.849) (-2938.255) (-2934.351) * (-2937.782) (-2943.729) (-2937.194) [-2940.113] -- 0:01:49 272500 -- (-2939.655) (-2940.328) (-2942.964) [-2934.957] * [-2940.153] (-2944.399) (-2938.693) (-2939.357) -- 0:01:52 273000 -- (-2939.662) (-2940.368) [-2938.899] (-2943.485) * (-2939.520) (-2939.422) [-2943.923] (-2942.610) -- 0:01:51 273500 -- [-2948.297] (-2939.178) (-2934.807) (-2939.362) * (-2936.354) (-2946.276) (-2941.005) [-2946.387] -- 0:01:51 274000 -- (-2946.246) (-2942.893) (-2936.676) [-2936.444] * [-2942.438] (-2936.186) (-2941.868) (-2937.983) -- 0:01:51 274500 -- (-2937.661) (-2940.957) [-2936.235] (-2945.349) * (-2943.450) (-2940.220) (-2944.187) [-2938.148] -- 0:01:51 275000 -- (-2936.880) (-2936.976) [-2936.940] (-2948.272) * (-2944.290) (-2938.560) [-2939.064] (-2937.203) -- 0:01:50 Average standard deviation of split frequencies: 0.017080 275500 -- [-2938.945] (-2939.119) (-2937.982) (-2941.082) * (-2939.010) (-2938.004) (-2937.934) [-2942.711] -- 0:01:50 276000 -- (-2941.251) (-2938.165) [-2935.165] (-2937.597) * (-2940.478) (-2942.300) (-2941.555) [-2939.538] -- 0:01:50 276500 -- (-2943.554) [-2940.815] (-2943.270) (-2945.049) * (-2940.817) (-2939.829) (-2938.821) [-2937.004] -- 0:01:49 277000 -- (-2950.048) [-2937.516] (-2936.366) (-2939.206) * (-2941.338) (-2944.176) [-2938.553] (-2938.556) -- 0:01:49 277500 -- (-2951.828) (-2937.486) [-2941.468] (-2933.207) * [-2946.097] (-2945.528) (-2936.915) (-2935.755) -- 0:01:49 278000 -- (-2941.017) (-2944.466) [-2943.541] (-2938.456) * (-2939.611) (-2937.499) (-2940.962) [-2937.498] -- 0:01:49 278500 -- (-2936.407) (-2943.258) [-2937.689] (-2949.269) * (-2950.723) (-2942.741) [-2936.927] (-2940.052) -- 0:01:48 279000 -- (-2942.171) (-2937.655) [-2936.199] (-2940.978) * [-2945.802] (-2943.943) (-2947.772) (-2938.625) -- 0:01:48 279500 -- (-2939.148) (-2935.894) [-2942.802] (-2938.814) * (-2949.666) [-2946.317] (-2938.670) (-2947.393) -- 0:01:50 280000 -- [-2934.288] (-2940.475) (-2944.410) (-2937.073) * (-2937.068) (-2949.231) [-2937.217] (-2942.211) -- 0:01:50 Average standard deviation of split frequencies: 0.011757 280500 -- (-2950.435) (-2945.463) [-2939.522] (-2939.528) * (-2940.385) (-2936.504) [-2941.905] (-2948.083) -- 0:01:50 281000 -- (-2938.685) [-2933.656] (-2942.991) (-2946.198) * (-2939.366) [-2943.111] (-2938.137) (-2944.275) -- 0:01:50 281500 -- (-2939.260) (-2942.118) [-2940.199] (-2937.118) * (-2935.822) (-2947.083) [-2937.177] (-2938.177) -- 0:01:49 282000 -- [-2939.331] (-2949.773) (-2944.838) (-2936.330) * [-2937.790] (-2941.318) (-2938.377) (-2938.111) -- 0:01:49 282500 -- (-2940.034) (-2940.149) (-2941.977) [-2942.266] * (-2934.186) (-2946.849) [-2938.415] (-2938.381) -- 0:01:49 283000 -- (-2945.568) (-2937.570) (-2949.343) [-2940.360] * (-2941.777) (-2939.722) [-2946.066] (-2939.656) -- 0:01:48 283500 -- (-2944.711) (-2938.897) [-2939.542] (-2939.837) * [-2941.365] (-2944.988) (-2953.235) (-2938.598) -- 0:01:48 284000 -- (-2954.483) (-2935.656) [-2939.623] (-2945.232) * (-2935.507) (-2942.885) [-2938.902] (-2942.517) -- 0:01:48 284500 -- (-2945.574) [-2938.890] (-2943.003) (-2940.277) * (-2941.197) (-2945.215) (-2938.305) [-2938.850] -- 0:01:48 285000 -- (-2949.285) (-2939.011) [-2937.070] (-2951.738) * [-2945.781] (-2938.299) (-2940.197) (-2943.785) -- 0:01:47 Average standard deviation of split frequencies: 0.009890 285500 -- (-2938.407) (-2937.412) [-2935.884] (-2951.379) * (-2949.590) (-2941.914) [-2946.764] (-2938.535) -- 0:01:47 286000 -- [-2941.348] (-2937.109) (-2941.052) (-2941.867) * (-2942.418) [-2938.439] (-2940.130) (-2936.829) -- 0:01:49 286500 -- (-2942.141) (-2942.621) [-2935.300] (-2948.342) * [-2933.347] (-2937.690) (-2940.114) (-2938.851) -- 0:01:49 287000 -- (-2947.345) (-2939.465) (-2943.197) [-2938.142] * [-2934.410] (-2941.861) (-2937.884) (-2941.125) -- 0:01:49 287500 -- (-2936.089) (-2936.335) [-2938.488] (-2945.373) * (-2939.752) (-2935.036) [-2935.159] (-2941.014) -- 0:01:49 288000 -- (-2937.078) (-2942.023) [-2941.269] (-2938.945) * (-2940.463) [-2938.298] (-2942.458) (-2943.252) -- 0:01:48 288500 -- [-2938.886] (-2946.730) (-2937.109) (-2941.622) * (-2934.821) (-2942.256) (-2934.712) [-2942.004] -- 0:01:48 289000 -- [-2939.745] (-2943.546) (-2937.681) (-2942.767) * (-2932.149) (-2936.987) [-2935.725] (-2941.143) -- 0:01:48 289500 -- [-2938.296] (-2939.234) (-2939.017) (-2942.467) * (-2943.581) (-2939.247) [-2940.791] (-2942.494) -- 0:01:47 290000 -- [-2935.911] (-2939.863) (-2940.659) (-2946.229) * (-2938.114) (-2944.616) (-2947.571) [-2940.903] -- 0:01:47 Average standard deviation of split frequencies: 0.008109 290500 -- (-2936.691) (-2943.855) (-2936.420) [-2938.019] * [-2945.906] (-2944.903) (-2935.675) (-2943.691) -- 0:01:47 291000 -- (-2940.275) (-2944.936) (-2940.159) [-2942.027] * (-2941.186) (-2942.718) [-2935.286] (-2948.786) -- 0:01:47 291500 -- [-2937.047] (-2940.964) (-2947.942) (-2938.108) * [-2939.708] (-2943.988) (-2943.326) (-2951.564) -- 0:01:46 292000 -- [-2937.929] (-2948.002) (-2941.463) (-2940.248) * (-2943.719) (-2936.313) (-2949.348) [-2946.853] -- 0:01:46 292500 -- [-2936.604] (-2937.844) (-2936.907) (-2936.221) * (-2951.789) (-2941.996) [-2939.290] (-2950.182) -- 0:01:48 293000 -- (-2939.878) (-2942.633) [-2939.733] (-2942.405) * (-2937.715) [-2938.649] (-2945.089) (-2941.454) -- 0:01:48 293500 -- [-2940.990] (-2947.117) (-2939.804) (-2937.749) * (-2939.273) [-2934.419] (-2939.440) (-2940.150) -- 0:01:48 294000 -- [-2934.763] (-2943.532) (-2934.370) (-2935.740) * (-2942.183) [-2942.058] (-2942.800) (-2940.386) -- 0:01:48 294500 -- (-2938.246) [-2945.439] (-2939.179) (-2936.015) * [-2941.930] (-2935.058) (-2941.328) (-2939.916) -- 0:01:47 295000 -- (-2937.933) [-2941.887] (-2932.882) (-2946.859) * (-2941.014) (-2941.791) (-2934.662) [-2935.662] -- 0:01:47 Average standard deviation of split frequencies: 0.007963 295500 -- (-2939.896) (-2945.931) [-2935.129] (-2942.448) * (-2944.306) [-2938.546] (-2940.274) (-2939.865) -- 0:01:47 296000 -- (-2942.450) [-2939.498] (-2944.032) (-2940.103) * (-2940.514) [-2935.234] (-2940.991) (-2944.329) -- 0:01:47 296500 -- (-2937.287) (-2938.378) (-2938.034) [-2935.592] * [-2939.521] (-2940.096) (-2940.754) (-2940.290) -- 0:01:46 297000 -- [-2936.607] (-2939.893) (-2945.118) (-2949.184) * (-2942.157) (-2943.584) [-2942.555] (-2944.604) -- 0:01:46 297500 -- [-2936.243] (-2936.735) (-2938.706) (-2945.226) * (-2933.600) (-2939.317) [-2938.843] (-2940.485) -- 0:01:46 298000 -- (-2934.547) (-2936.353) (-2937.729) [-2938.684] * [-2936.098] (-2935.907) (-2942.379) (-2939.619) -- 0:01:46 298500 -- (-2940.727) [-2939.897] (-2944.727) (-2938.215) * (-2937.872) [-2941.535] (-2940.852) (-2940.569) -- 0:01:45 299000 -- [-2939.028] (-2937.408) (-2937.668) (-2936.945) * (-2943.178) (-2939.880) (-2938.445) [-2940.780] -- 0:01:47 299500 -- [-2936.835] (-2933.937) (-2949.707) (-2941.342) * (-2943.010) (-2941.072) [-2942.317] (-2943.145) -- 0:01:47 300000 -- (-2942.551) (-2934.711) (-2936.957) [-2942.550] * [-2940.260] (-2939.053) (-2944.060) (-2938.346) -- 0:01:47 Average standard deviation of split frequencies: 0.007839 300500 -- [-2941.337] (-2946.877) (-2938.766) (-2943.648) * (-2935.169) (-2941.066) (-2946.177) [-2935.821] -- 0:01:47 301000 -- (-2943.560) (-2939.707) (-2940.544) [-2943.524] * (-2942.630) (-2936.191) (-2938.187) [-2939.893] -- 0:01:46 301500 -- (-2944.034) (-2941.446) [-2937.760] (-2936.689) * (-2937.877) [-2934.274] (-2942.917) (-2940.340) -- 0:01:46 302000 -- (-2939.782) [-2936.903] (-2933.955) (-2941.050) * (-2943.276) (-2937.500) (-2940.526) [-2936.260] -- 0:01:46 302500 -- [-2936.708] (-2938.651) (-2942.737) (-2938.127) * (-2937.112) [-2939.274] (-2948.093) (-2941.938) -- 0:01:46 303000 -- (-2939.584) (-2936.530) [-2936.972] (-2937.079) * (-2937.340) (-2936.412) (-2938.152) [-2933.940] -- 0:01:45 303500 -- [-2940.305] (-2945.598) (-2940.902) (-2939.528) * (-2937.705) (-2934.598) [-2945.302] (-2937.333) -- 0:01:45 304000 -- [-2938.234] (-2936.140) (-2937.285) (-2940.505) * (-2939.091) [-2941.452] (-2936.047) (-2942.254) -- 0:01:45 304500 -- (-2936.781) (-2937.824) [-2940.939] (-2941.738) * (-2940.105) (-2938.511) (-2935.567) [-2947.672] -- 0:01:45 305000 -- (-2939.264) [-2944.690] (-2943.759) (-2941.471) * (-2935.674) (-2938.874) (-2936.332) [-2939.364] -- 0:01:44 Average standard deviation of split frequencies: 0.007703 305500 -- (-2936.687) (-2947.648) (-2936.636) [-2937.974] * (-2946.234) [-2943.357] (-2941.791) (-2936.428) -- 0:01:46 306000 -- (-2935.915) [-2944.427] (-2939.204) (-2942.132) * [-2938.297] (-2944.858) (-2935.943) (-2935.408) -- 0:01:46 306500 -- (-2948.148) (-2938.201) (-2944.957) [-2937.282] * (-2940.015) (-2943.612) [-2938.552] (-2942.533) -- 0:01:46 307000 -- (-2944.878) [-2939.516] (-2946.134) (-2933.873) * (-2932.566) [-2937.576] (-2939.684) (-2943.985) -- 0:01:46 307500 -- (-2937.543) [-2934.142] (-2937.499) (-2933.831) * (-2943.851) (-2936.285) (-2942.723) [-2934.425] -- 0:01:45 308000 -- (-2938.097) (-2938.699) [-2934.025] (-2947.732) * [-2936.818] (-2936.538) (-2943.133) (-2945.640) -- 0:01:45 308500 -- (-2943.233) (-2938.179) [-2937.183] (-2940.768) * (-2939.893) (-2935.509) (-2942.536) [-2935.708] -- 0:01:45 309000 -- (-2943.736) (-2940.497) (-2937.128) [-2935.543] * (-2935.929) (-2940.950) (-2941.332) [-2936.020] -- 0:01:45 309500 -- (-2945.159) (-2946.242) (-2940.551) [-2937.231] * [-2940.091] (-2942.968) (-2949.013) (-2944.851) -- 0:01:44 310000 -- (-2939.897) (-2946.584) [-2935.286] (-2937.701) * (-2940.295) (-2942.799) (-2941.878) [-2934.858] -- 0:01:44 Average standard deviation of split frequencies: 0.006070 310500 -- (-2943.748) (-2946.033) (-2937.527) [-2937.613] * [-2939.592] (-2943.189) (-2936.714) (-2937.993) -- 0:01:44 311000 -- [-2943.671] (-2943.942) (-2942.000) (-2939.907) * (-2936.837) (-2939.988) (-2938.054) [-2937.631] -- 0:01:44 311500 -- (-2944.426) (-2951.592) (-2946.035) [-2942.678] * (-2941.166) (-2947.187) (-2941.896) [-2939.251] -- 0:01:43 312000 -- (-2940.361) (-2937.905) (-2939.779) [-2942.775] * (-2945.072) (-2942.009) (-2943.722) [-2942.350] -- 0:01:45 312500 -- (-2949.699) (-2939.584) [-2943.005] (-2942.225) * (-2944.351) [-2938.387] (-2939.664) (-2937.641) -- 0:01:45 313000 -- (-2946.737) (-2946.687) (-2943.445) [-2939.861] * (-2943.634) [-2940.484] (-2938.990) (-2938.022) -- 0:01:45 313500 -- (-2943.167) (-2939.704) (-2949.595) [-2940.840] * (-2939.249) [-2935.445] (-2940.882) (-2936.017) -- 0:01:45 314000 -- [-2945.183] (-2936.999) (-2945.881) (-2937.512) * (-2948.311) (-2936.601) [-2942.319] (-2941.862) -- 0:01:44 314500 -- (-2956.535) [-2943.327] (-2943.073) (-2939.073) * [-2939.873] (-2943.641) (-2940.279) (-2937.143) -- 0:01:44 315000 -- [-2942.758] (-2940.714) (-2945.739) (-2937.579) * (-2938.883) (-2944.238) [-2942.178] (-2933.960) -- 0:01:44 Average standard deviation of split frequencies: 0.007459 315500 -- (-2940.432) (-2939.314) (-2944.243) [-2937.285] * (-2950.855) (-2946.069) (-2939.795) [-2938.811] -- 0:01:44 316000 -- (-2949.105) (-2943.471) (-2940.428) [-2942.786] * (-2941.903) (-2951.592) (-2942.621) [-2938.275] -- 0:01:43 316500 -- [-2938.616] (-2937.593) (-2935.136) (-2938.871) * [-2940.029] (-2943.993) (-2936.446) (-2945.464) -- 0:01:43 317000 -- (-2944.786) [-2937.005] (-2941.853) (-2938.038) * (-2946.456) [-2944.094] (-2936.907) (-2943.711) -- 0:01:43 317500 -- (-2939.174) (-2941.035) (-2935.899) [-2940.487] * (-2941.156) (-2945.304) (-2939.330) [-2940.107] -- 0:01:43 318000 -- [-2938.319] (-2936.715) (-2940.568) (-2939.910) * (-2940.777) (-2942.556) [-2941.151] (-2940.809) -- 0:01:42 318500 -- (-2942.122) (-2938.660) [-2937.412] (-2936.396) * (-2935.304) (-2943.344) (-2940.687) [-2940.444] -- 0:01:44 319000 -- (-2946.984) (-2936.409) [-2942.524] (-2947.089) * (-2933.171) [-2947.182] (-2940.294) (-2933.360) -- 0:01:44 319500 -- (-2937.972) (-2934.398) [-2942.252] (-2937.721) * (-2938.451) [-2944.685] (-2940.499) (-2939.409) -- 0:01:44 320000 -- (-2940.822) [-2934.537] (-2945.746) (-2938.320) * [-2937.587] (-2946.629) (-2943.288) (-2940.891) -- 0:01:44 Average standard deviation of split frequencies: 0.004410 320500 -- (-2941.637) [-2937.646] (-2944.572) (-2946.587) * (-2939.148) (-2937.402) (-2940.486) [-2936.890] -- 0:01:43 321000 -- (-2937.572) [-2941.148] (-2943.823) (-2942.574) * (-2944.765) (-2940.019) [-2934.086] (-2942.046) -- 0:01:43 321500 -- (-2938.972) (-2935.141) [-2938.978] (-2938.155) * (-2940.531) [-2941.679] (-2942.657) (-2937.082) -- 0:01:43 322000 -- (-2933.873) [-2936.293] (-2942.230) (-2942.164) * (-2939.953) [-2943.542] (-2938.454) (-2936.575) -- 0:01:43 322500 -- (-2943.857) (-2938.110) [-2935.620] (-2944.626) * (-2934.808) [-2944.402] (-2936.065) (-2939.175) -- 0:01:42 323000 -- [-2937.750] (-2940.249) (-2941.940) (-2940.507) * (-2936.768) (-2944.427) (-2938.370) [-2939.236] -- 0:01:42 323500 -- (-2939.839) [-2940.333] (-2932.727) (-2943.361) * [-2934.058] (-2945.742) (-2943.677) (-2934.027) -- 0:01:42 324000 -- [-2941.697] (-2940.053) (-2953.346) (-2945.442) * (-2940.095) (-2943.394) (-2935.123) [-2937.610] -- 0:01:42 324500 -- (-2937.110) (-2946.528) [-2934.415] (-2938.057) * [-2938.477] (-2945.004) (-2934.282) (-2936.021) -- 0:01:42 325000 -- (-2936.917) (-2936.789) [-2942.170] (-2941.091) * [-2944.037] (-2939.482) (-2943.428) (-2938.018) -- 0:01:43 Average standard deviation of split frequencies: 0.004338 325500 -- (-2940.724) (-2940.822) (-2946.316) [-2938.952] * (-2939.561) (-2938.214) (-2935.420) [-2934.023] -- 0:01:43 326000 -- (-2947.354) [-2938.691] (-2946.529) (-2934.783) * (-2941.488) (-2936.590) [-2939.247] (-2941.255) -- 0:01:43 326500 -- (-2937.867) (-2940.609) (-2944.314) [-2934.434] * [-2944.343] (-2939.797) (-2940.903) (-2939.910) -- 0:01:43 327000 -- (-2939.254) (-2941.752) [-2937.576] (-2944.119) * (-2939.919) (-2943.432) (-2941.113) [-2938.201] -- 0:01:42 327500 -- (-2937.923) [-2939.350] (-2947.126) (-2941.192) * (-2940.658) (-2942.769) [-2938.007] (-2941.660) -- 0:01:42 328000 -- (-2935.643) [-2943.203] (-2944.631) (-2944.391) * (-2937.150) (-2948.621) [-2938.979] (-2940.836) -- 0:01:42 328500 -- (-2940.897) [-2938.630] (-2942.705) (-2945.409) * (-2941.718) [-2939.949] (-2941.346) (-2937.358) -- 0:01:42 329000 -- (-2938.558) (-2935.926) [-2940.496] (-2936.464) * (-2937.608) (-2940.249) [-2935.556] (-2940.951) -- 0:01:41 329500 -- (-2941.090) (-2937.934) [-2940.793] (-2944.325) * [-2942.506] (-2941.112) (-2942.715) (-2941.790) -- 0:01:41 330000 -- [-2937.464] (-2936.981) (-2943.993) (-2934.859) * (-2938.490) (-2937.072) (-2939.797) [-2944.807] -- 0:01:41 Average standard deviation of split frequencies: 0.005702 330500 -- (-2937.250) (-2954.539) (-2937.403) [-2946.607] * (-2934.733) (-2936.708) (-2950.940) [-2939.367] -- 0:01:41 331000 -- (-2942.332) (-2945.268) (-2946.705) [-2936.719] * (-2935.376) (-2936.424) (-2940.665) [-2938.782] -- 0:01:41 331500 -- (-2942.896) [-2936.393] (-2941.884) (-2936.771) * [-2937.205] (-2945.942) (-2939.332) (-2935.119) -- 0:01:42 332000 -- [-2937.466] (-2939.959) (-2940.546) (-2941.411) * (-2938.263) (-2941.566) [-2936.259] (-2930.473) -- 0:01:42 332500 -- [-2941.417] (-2940.699) (-2945.070) (-2939.924) * (-2947.726) (-2944.515) (-2940.894) [-2932.656] -- 0:01:42 333000 -- (-2939.368) (-2934.456) [-2946.707] (-2934.137) * (-2938.754) [-2938.018] (-2940.794) (-2938.577) -- 0:01:42 333500 -- (-2942.651) (-2941.708) (-2938.641) [-2937.529] * (-2941.269) (-2942.486) [-2941.872] (-2940.612) -- 0:01:41 334000 -- (-2948.409) (-2934.615) [-2940.269] (-2937.198) * [-2940.407] (-2940.036) (-2941.677) (-2937.407) -- 0:01:41 334500 -- (-2940.991) (-2940.043) (-2938.001) [-2939.822] * (-2942.397) (-2940.240) [-2938.835] (-2939.770) -- 0:01:41 335000 -- [-2942.026] (-2939.299) (-2939.301) (-2935.105) * (-2937.961) (-2943.856) (-2938.807) [-2936.979] -- 0:01:41 Average standard deviation of split frequencies: 0.007015 335500 -- [-2944.261] (-2936.603) (-2948.824) (-2939.008) * (-2948.279) (-2940.461) (-2937.019) [-2939.687] -- 0:01:41 336000 -- (-2938.523) [-2941.406] (-2936.184) (-2940.258) * (-2940.508) (-2946.136) [-2942.306] (-2938.403) -- 0:01:40 336500 -- (-2945.000) (-2938.517) [-2937.347] (-2939.834) * [-2936.698] (-2941.456) (-2938.975) (-2935.042) -- 0:01:40 337000 -- (-2940.349) [-2942.887] (-2940.459) (-2940.295) * (-2947.002) (-2940.682) (-2938.700) [-2937.577] -- 0:01:40 337500 -- (-2937.730) (-2934.399) [-2941.610] (-2943.355) * (-2943.855) (-2938.399) (-2939.156) [-2936.275] -- 0:01:40 338000 -- (-2939.663) [-2935.312] (-2941.581) (-2941.467) * (-2941.424) (-2937.910) (-2941.330) [-2936.313] -- 0:01:41 338500 -- (-2943.792) (-2939.258) (-2936.911) [-2938.905] * (-2937.899) (-2941.346) (-2947.324) [-2938.927] -- 0:01:41 339000 -- [-2935.919] (-2941.124) (-2936.502) (-2941.318) * [-2939.223] (-2937.656) (-2945.226) (-2940.016) -- 0:01:41 339500 -- (-2935.659) (-2938.585) [-2937.037] (-2941.592) * (-2937.321) (-2934.178) (-2946.988) [-2941.309] -- 0:01:41 340000 -- (-2935.884) (-2934.645) [-2946.933] (-2935.988) * (-2937.067) (-2935.511) (-2941.808) [-2941.884] -- 0:01:40 Average standard deviation of split frequencies: 0.005535 340500 -- (-2937.809) (-2935.919) (-2942.625) [-2933.466] * (-2938.051) (-2936.650) [-2950.819] (-2939.463) -- 0:01:40 341000 -- (-2938.243) (-2934.484) (-2936.569) [-2937.572] * (-2942.260) (-2942.765) (-2938.885) [-2935.791] -- 0:01:40 341500 -- [-2936.887] (-2936.061) (-2937.245) (-2936.197) * (-2948.955) [-2945.409] (-2943.457) (-2943.167) -- 0:01:40 342000 -- (-2939.806) (-2953.664) [-2945.199] (-2942.489) * (-2943.488) (-2941.902) (-2942.214) [-2937.738] -- 0:01:40 342500 -- [-2938.397] (-2944.511) (-2941.497) (-2941.170) * (-2942.275) (-2949.698) [-2942.890] (-2936.264) -- 0:01:39 343000 -- [-2938.436] (-2941.103) (-2945.101) (-2942.609) * (-2940.755) (-2947.497) [-2942.694] (-2942.752) -- 0:01:39 343500 -- [-2938.603] (-2937.877) (-2945.293) (-2935.763) * (-2935.025) (-2943.669) (-2940.423) [-2946.047] -- 0:01:39 344000 -- (-2939.665) [-2937.506] (-2937.417) (-2941.116) * (-2943.227) (-2946.866) [-2942.562] (-2947.816) -- 0:01:39 344500 -- [-2936.621] (-2946.065) (-2937.051) (-2940.566) * [-2938.725] (-2942.829) (-2946.128) (-2942.814) -- 0:01:40 345000 -- [-2940.336] (-2939.787) (-2940.771) (-2941.931) * (-2940.616) (-2935.574) (-2937.484) [-2945.933] -- 0:01:40 Average standard deviation of split frequencies: 0.005450 345500 -- (-2941.461) [-2942.900] (-2941.294) (-2937.479) * (-2938.369) [-2939.922] (-2935.767) (-2946.149) -- 0:01:40 346000 -- (-2937.965) (-2941.094) (-2943.689) [-2937.468] * (-2942.059) (-2941.431) (-2936.972) [-2940.456] -- 0:01:40 346500 -- [-2938.623] (-2936.926) (-2939.861) (-2942.558) * (-2938.780) [-2941.365] (-2941.172) (-2943.236) -- 0:01:39 347000 -- (-2937.951) (-2937.988) (-2942.978) [-2934.487] * (-2938.077) [-2937.625] (-2944.629) (-2941.599) -- 0:01:39 347500 -- [-2940.130] (-2936.905) (-2938.362) (-2937.521) * (-2937.556) [-2937.143] (-2945.599) (-2942.194) -- 0:01:39 348000 -- (-2938.441) (-2939.322) [-2936.821] (-2935.064) * (-2943.281) [-2942.357] (-2940.812) (-2948.593) -- 0:01:39 348500 -- (-2940.067) [-2945.293] (-2935.624) (-2940.301) * (-2944.394) [-2938.360] (-2942.977) (-2946.739) -- 0:01:39 349000 -- (-2936.614) (-2942.057) [-2938.698] (-2942.098) * [-2938.756] (-2944.148) (-2937.780) (-2943.483) -- 0:01:38 349500 -- [-2936.139] (-2938.992) (-2942.268) (-2943.109) * (-2936.578) (-2944.155) [-2939.739] (-2946.254) -- 0:01:38 350000 -- (-2944.219) [-2940.383] (-2937.390) (-2938.350) * (-2936.798) (-2939.143) [-2936.793] (-2939.264) -- 0:01:38 Average standard deviation of split frequencies: 0.005377 350500 -- [-2941.173] (-2944.119) (-2935.792) (-2945.197) * (-2939.379) [-2934.766] (-2940.796) (-2942.197) -- 0:01:38 351000 -- (-2937.174) (-2945.603) (-2938.199) [-2941.073] * (-2938.577) (-2945.770) (-2941.978) [-2942.558] -- 0:01:39 351500 -- (-2941.273) (-2940.903) (-2937.491) [-2938.198] * [-2936.271] (-2941.259) (-2939.742) (-2941.660) -- 0:01:39 352000 -- [-2941.133] (-2942.362) (-2946.315) (-2936.871) * (-2938.847) [-2939.174] (-2939.150) (-2935.365) -- 0:01:39 352500 -- (-2944.936) (-2933.276) (-2943.415) [-2941.359] * (-2938.956) (-2947.280) (-2942.140) [-2943.857] -- 0:01:39 353000 -- (-2944.338) [-2943.556] (-2942.832) (-2938.115) * (-2941.984) [-2935.581] (-2942.923) (-2948.403) -- 0:01:38 353500 -- (-2940.388) [-2934.377] (-2937.843) (-2936.542) * (-2937.703) [-2942.409] (-2943.403) (-2949.487) -- 0:01:38 354000 -- (-2949.358) [-2936.190] (-2942.010) (-2936.421) * (-2943.672) (-2943.657) (-2945.257) [-2939.531] -- 0:01:38 354500 -- (-2944.737) [-2938.395] (-2938.991) (-2937.311) * (-2940.614) (-2945.222) [-2943.598] (-2941.539) -- 0:01:38 355000 -- (-2936.890) (-2943.463) (-2937.540) [-2942.198] * (-2941.652) [-2940.082] (-2946.485) (-2946.670) -- 0:01:38 Average standard deviation of split frequencies: 0.005297 355500 -- [-2935.250] (-2947.678) (-2940.972) (-2936.206) * (-2942.199) [-2933.345] (-2938.049) (-2942.650) -- 0:01:37 356000 -- (-2934.593) [-2942.645] (-2942.396) (-2940.446) * (-2934.874) [-2939.067] (-2934.698) (-2947.119) -- 0:01:37 356500 -- (-2937.689) (-2942.424) [-2941.046] (-2938.756) * (-2946.556) (-2942.990) [-2937.693] (-2948.018) -- 0:01:37 357000 -- (-2933.605) (-2946.079) [-2933.992] (-2937.595) * (-2941.135) [-2936.312] (-2937.953) (-2938.320) -- 0:01:37 357500 -- (-2935.102) (-2941.134) [-2939.970] (-2942.938) * (-2944.144) [-2934.465] (-2934.645) (-2937.101) -- 0:01:38 358000 -- (-2938.328) [-2938.204] (-2943.347) (-2938.852) * (-2945.470) [-2939.501] (-2944.956) (-2943.625) -- 0:01:38 358500 -- (-2947.196) [-2933.215] (-2937.354) (-2939.490) * (-2938.503) [-2940.613] (-2938.367) (-2942.290) -- 0:01:38 359000 -- [-2940.685] (-2953.512) (-2945.040) (-2936.116) * [-2933.658] (-2934.123) (-2939.487) (-2940.157) -- 0:01:38 359500 -- (-2937.473) (-2940.157) (-2941.042) [-2937.591] * (-2936.636) [-2938.816] (-2937.243) (-2938.101) -- 0:01:37 360000 -- (-2942.251) (-2943.202) [-2945.068] (-2940.785) * (-2939.922) [-2938.179] (-2936.846) (-2935.413) -- 0:01:37 Average standard deviation of split frequencies: 0.006535 360500 -- (-2939.122) (-2936.678) [-2937.350] (-2947.912) * [-2936.212] (-2953.085) (-2941.786) (-2935.239) -- 0:01:37 361000 -- (-2935.401) (-2936.438) (-2941.574) [-2941.270] * (-2940.328) (-2941.465) (-2940.371) [-2934.909] -- 0:01:37 361500 -- (-2942.318) [-2938.100] (-2942.184) (-2941.621) * [-2939.051] (-2946.615) (-2939.336) (-2937.610) -- 0:01:37 362000 -- (-2932.402) [-2937.856] (-2943.585) (-2945.895) * [-2938.038] (-2951.411) (-2938.192) (-2938.791) -- 0:01:36 362500 -- [-2937.014] (-2940.272) (-2938.865) (-2942.049) * (-2937.267) (-2943.487) [-2935.504] (-2940.065) -- 0:01:36 363000 -- (-2938.483) (-2938.195) [-2940.524] (-2941.080) * (-2941.020) (-2938.636) [-2939.676] (-2939.408) -- 0:01:36 363500 -- [-2939.707] (-2947.902) (-2942.533) (-2936.279) * [-2936.271] (-2937.809) (-2938.334) (-2940.183) -- 0:01:36 364000 -- [-2942.471] (-2944.332) (-2945.031) (-2935.321) * (-2943.689) [-2938.581] (-2942.836) (-2942.769) -- 0:01:37 364500 -- (-2934.209) (-2945.782) [-2944.025] (-2941.851) * [-2936.566] (-2938.171) (-2939.779) (-2941.851) -- 0:01:37 365000 -- (-2947.339) [-2937.348] (-2938.576) (-2936.225) * [-2936.872] (-2941.045) (-2936.481) (-2938.279) -- 0:01:37 Average standard deviation of split frequencies: 0.005152 365500 -- (-2938.966) (-2943.811) (-2942.697) [-2940.958] * (-2949.143) (-2942.962) [-2934.425] (-2939.074) -- 0:01:37 366000 -- (-2941.485) [-2938.739] (-2938.176) (-2946.391) * (-2941.445) (-2941.308) [-2938.234] (-2937.552) -- 0:01:37 366500 -- (-2948.757) [-2939.364] (-2937.874) (-2941.119) * [-2943.758] (-2938.452) (-2942.453) (-2945.646) -- 0:01:36 367000 -- [-2937.608] (-2939.856) (-2941.378) (-2941.426) * (-2945.149) (-2942.975) (-2935.195) [-2937.428] -- 0:01:36 367500 -- (-2937.330) (-2943.259) [-2939.253] (-2937.415) * (-2939.755) (-2938.923) [-2940.693] (-2940.674) -- 0:01:36 368000 -- [-2938.964] (-2936.388) (-2948.179) (-2938.103) * (-2936.814) (-2948.434) (-2949.020) [-2938.555] -- 0:01:36 368500 -- [-2938.303] (-2938.888) (-2940.395) (-2936.733) * (-2946.699) [-2942.586] (-2939.762) (-2940.067) -- 0:01:35 369000 -- (-2940.187) (-2938.301) [-2938.570] (-2939.800) * (-2936.486) [-2938.531] (-2945.927) (-2942.153) -- 0:01:35 369500 -- (-2940.353) [-2939.690] (-2939.650) (-2939.619) * (-2935.744) (-2942.510) (-2947.657) [-2940.893] -- 0:01:35 370000 -- (-2947.628) [-2933.453] (-2944.145) (-2939.335) * (-2934.725) (-2937.073) (-2947.846) [-2940.859] -- 0:01:35 Average standard deviation of split frequencies: 0.005087 370500 -- (-2944.771) [-2934.742] (-2939.191) (-2940.796) * [-2939.605] (-2938.292) (-2943.030) (-2942.045) -- 0:01:36 371000 -- [-2935.106] (-2940.585) (-2952.642) (-2945.671) * (-2947.081) [-2943.849] (-2941.427) (-2939.645) -- 0:01:36 371500 -- [-2943.843] (-2938.592) (-2940.361) (-2949.379) * (-2937.814) [-2943.317] (-2936.460) (-2941.478) -- 0:01:36 372000 -- [-2938.915] (-2944.601) (-2938.613) (-2941.523) * (-2940.780) (-2940.371) (-2943.260) [-2939.250] -- 0:01:36 372500 -- [-2938.614] (-2941.270) (-2939.972) (-2941.168) * (-2948.232) [-2943.110] (-2941.600) (-2942.015) -- 0:01:36 373000 -- (-2936.273) (-2945.549) [-2937.611] (-2934.652) * (-2940.431) (-2936.102) [-2935.373] (-2937.041) -- 0:01:35 373500 -- (-2940.242) [-2939.640] (-2941.470) (-2939.341) * (-2940.996) (-2944.664) (-2940.467) [-2941.761] -- 0:01:35 374000 -- (-2941.526) (-2941.915) [-2938.694] (-2934.868) * (-2936.280) (-2938.944) [-2939.033] (-2938.519) -- 0:01:35 374500 -- (-2948.521) (-2936.473) (-2934.316) [-2946.192] * [-2940.770] (-2934.734) (-2937.811) (-2938.421) -- 0:01:35 375000 -- (-2949.911) (-2938.681) [-2941.222] (-2942.089) * (-2943.482) (-2938.285) (-2937.724) [-2938.930] -- 0:01:35 Average standard deviation of split frequencies: 0.005015 375500 -- (-2938.314) [-2942.500] (-2935.035) (-2941.571) * [-2938.884] (-2943.335) (-2949.420) (-2943.667) -- 0:01:34 376000 -- (-2941.751) [-2940.155] (-2936.207) (-2937.011) * (-2941.971) [-2943.034] (-2939.969) (-2938.389) -- 0:01:34 376500 -- (-2939.786) [-2939.704] (-2938.794) (-2936.274) * (-2941.587) (-2944.135) [-2941.322] (-2938.618) -- 0:01:34 377000 -- (-2940.321) (-2943.502) [-2935.438] (-2944.508) * (-2945.893) (-2940.186) [-2937.554] (-2945.522) -- 0:01:35 377500 -- (-2943.663) [-2938.352] (-2936.680) (-2941.810) * (-2943.683) [-2934.971] (-2940.729) (-2947.350) -- 0:01:35 378000 -- (-2944.424) [-2938.129] (-2943.473) (-2944.701) * (-2937.977) [-2945.651] (-2939.345) (-2939.489) -- 0:01:35 378500 -- (-2936.574) (-2940.340) [-2940.788] (-2938.098) * (-2942.452) (-2940.292) [-2938.342] (-2937.634) -- 0:01:35 379000 -- (-2938.055) (-2936.874) [-2940.152] (-2942.270) * (-2939.479) (-2941.356) (-2937.397) [-2940.035] -- 0:01:35 379500 -- (-2940.476) (-2939.282) (-2936.943) [-2937.299] * (-2945.070) (-2937.275) [-2939.697] (-2942.594) -- 0:01:34 380000 -- (-2936.812) (-2943.163) (-2941.385) [-2939.209] * (-2938.894) (-2935.026) (-2939.153) [-2936.435] -- 0:01:34 Average standard deviation of split frequencies: 0.004953 380500 -- (-2942.096) (-2941.231) [-2936.507] (-2947.574) * (-2935.164) (-2938.862) (-2944.625) [-2944.447] -- 0:01:34 381000 -- [-2943.443] (-2939.724) (-2945.891) (-2942.872) * [-2938.612] (-2939.470) (-2943.224) (-2936.707) -- 0:01:34 381500 -- (-2940.319) [-2938.697] (-2935.530) (-2942.230) * [-2931.638] (-2936.504) (-2942.559) (-2945.787) -- 0:01:34 382000 -- (-2935.305) (-2939.300) (-2945.952) [-2937.101] * [-2934.125] (-2945.512) (-2937.390) (-2938.412) -- 0:01:33 382500 -- (-2938.262) [-2943.843] (-2941.417) (-2940.920) * [-2936.991] (-2939.367) (-2949.009) (-2938.051) -- 0:01:33 383000 -- (-2941.997) [-2940.417] (-2945.361) (-2941.494) * [-2947.035] (-2937.902) (-2943.492) (-2940.334) -- 0:01:33 383500 -- (-2937.539) (-2947.075) (-2942.835) [-2938.243] * (-2947.060) [-2940.317] (-2937.880) (-2943.046) -- 0:01:34 384000 -- (-2941.282) [-2937.257] (-2945.703) (-2939.019) * (-2945.721) (-2951.184) [-2940.343] (-2939.182) -- 0:01:34 384500 -- (-2943.631) (-2938.893) [-2935.037] (-2939.865) * (-2940.828) (-2943.905) [-2936.023] (-2940.287) -- 0:01:34 385000 -- (-2948.665) [-2936.375] (-2947.916) (-2939.256) * (-2941.374) (-2945.889) (-2938.832) [-2943.971] -- 0:01:34 Average standard deviation of split frequencies: 0.003664 385500 -- [-2935.955] (-2940.544) (-2945.129) (-2936.666) * (-2945.319) (-2945.651) [-2938.697] (-2943.825) -- 0:01:34 386000 -- (-2943.993) [-2936.817] (-2939.915) (-2942.966) * [-2942.622] (-2940.760) (-2944.571) (-2943.155) -- 0:01:33 386500 -- (-2940.915) [-2936.848] (-2947.718) (-2939.460) * (-2940.493) (-2939.880) [-2938.710] (-2951.108) -- 0:01:33 387000 -- [-2938.663] (-2940.806) (-2936.304) (-2940.835) * (-2947.190) (-2941.563) [-2936.518] (-2943.950) -- 0:01:33 387500 -- (-2942.827) (-2943.139) (-2939.962) [-2937.165] * [-2933.693] (-2943.607) (-2940.674) (-2944.616) -- 0:01:33 388000 -- (-2943.919) (-2939.337) (-2935.395) [-2938.122] * [-2940.974] (-2935.480) (-2944.814) (-2944.675) -- 0:01:33 388500 -- (-2945.121) [-2940.192] (-2936.059) (-2937.171) * [-2942.845] (-2940.244) (-2935.525) (-2941.821) -- 0:01:32 389000 -- (-2942.596) (-2939.721) [-2940.357] (-2937.075) * (-2937.143) [-2944.853] (-2940.162) (-2939.756) -- 0:01:32 389500 -- (-2940.450) [-2938.723] (-2940.828) (-2942.384) * (-2940.723) (-2942.243) (-2946.667) [-2945.099] -- 0:01:32 390000 -- [-2939.449] (-2940.444) (-2946.308) (-2941.278) * [-2940.934] (-2943.984) (-2938.587) (-2940.678) -- 0:01:33 Average standard deviation of split frequencies: 0.003620 390500 -- (-2941.985) (-2938.233) [-2937.515] (-2938.362) * (-2943.228) (-2939.958) [-2936.665] (-2935.573) -- 0:01:33 391000 -- [-2938.288] (-2936.883) (-2935.597) (-2944.788) * (-2947.495) (-2940.913) [-2937.272] (-2936.298) -- 0:01:33 391500 -- (-2940.401) (-2937.669) [-2939.512] (-2937.619) * (-2949.375) [-2935.031] (-2946.551) (-2946.334) -- 0:01:33 392000 -- (-2939.251) (-2940.844) [-2939.717] (-2939.652) * (-2944.645) [-2937.166] (-2947.601) (-2936.162) -- 0:01:33 392500 -- (-2939.880) (-2937.680) (-2943.398) [-2945.380] * (-2942.777) [-2945.579] (-2943.957) (-2936.012) -- 0:01:32 393000 -- (-2942.409) (-2937.544) [-2936.850] (-2942.846) * [-2937.932] (-2945.844) (-2942.752) (-2935.975) -- 0:01:32 393500 -- (-2937.950) [-2941.404] (-2935.903) (-2944.157) * [-2944.065] (-2941.284) (-2956.927) (-2941.435) -- 0:01:32 394000 -- [-2937.806] (-2947.574) (-2941.807) (-2940.512) * (-2936.078) (-2941.210) (-2943.100) [-2938.603] -- 0:01:32 394500 -- [-2935.542] (-2933.524) (-2936.499) (-2946.783) * (-2940.621) (-2939.435) (-2942.254) [-2938.143] -- 0:01:32 395000 -- (-2941.163) [-2935.050] (-2942.590) (-2943.746) * (-2941.718) (-2937.576) [-2936.772] (-2938.777) -- 0:01:31 Average standard deviation of split frequencies: 0.002381 395500 -- (-2947.270) (-2936.466) [-2936.853] (-2943.280) * (-2947.463) (-2944.402) [-2936.573] (-2936.243) -- 0:01:31 396000 -- [-2944.169] (-2935.855) (-2938.112) (-2935.158) * (-2939.099) (-2938.756) [-2940.019] (-2948.732) -- 0:01:31 396500 -- (-2937.301) (-2940.898) [-2938.290] (-2948.046) * (-2934.260) (-2947.249) (-2939.668) [-2937.774] -- 0:01:32 397000 -- (-2935.609) (-2937.294) [-2945.367] (-2940.956) * (-2942.969) (-2936.339) (-2939.472) [-2945.254] -- 0:01:32 397500 -- (-2938.129) (-2943.548) (-2943.909) [-2945.066] * (-2942.971) (-2938.180) [-2941.961] (-2946.486) -- 0:01:32 398000 -- (-2937.051) [-2940.448] (-2938.842) (-2948.180) * (-2945.929) (-2938.195) (-2941.266) [-2946.683] -- 0:01:32 398500 -- (-2933.798) (-2940.189) (-2943.280) [-2936.278] * (-2935.264) [-2935.410] (-2940.851) (-2947.880) -- 0:01:32 399000 -- (-2946.319) (-2937.004) (-2950.984) [-2933.798] * (-2935.990) (-2940.026) (-2938.367) [-2945.551] -- 0:01:31 399500 -- (-2941.170) [-2937.917] (-2940.783) (-2936.850) * (-2942.951) [-2935.946] (-2946.947) (-2936.843) -- 0:01:31 400000 -- (-2934.862) (-2944.640) (-2942.427) [-2944.185] * (-2939.508) [-2944.440] (-2939.905) (-2939.803) -- 0:01:31 Average standard deviation of split frequencies: 0.002353 400500 -- (-2938.284) (-2940.904) (-2935.671) [-2944.757] * [-2943.658] (-2942.165) (-2934.853) (-2939.881) -- 0:01:31 401000 -- (-2940.657) [-2940.020] (-2939.904) (-2940.143) * (-2942.715) [-2935.950] (-2942.699) (-2943.170) -- 0:01:31 401500 -- (-2942.899) (-2944.759) [-2938.131] (-2938.316) * (-2932.544) (-2935.178) (-2942.766) [-2941.516] -- 0:01:30 402000 -- (-2944.772) (-2935.354) [-2937.824] (-2945.910) * (-2936.762) (-2942.630) [-2934.759] (-2936.408) -- 0:01:30 402500 -- (-2934.728) (-2938.261) [-2937.158] (-2944.203) * (-2940.275) [-2935.148] (-2935.709) (-2936.032) -- 0:01:30 403000 -- [-2939.015] (-2936.930) (-2939.624) (-2950.395) * (-2940.560) [-2935.043] (-2938.745) (-2937.660) -- 0:01:31 403500 -- [-2939.354] (-2940.262) (-2939.574) (-2937.840) * (-2934.826) (-2941.859) (-2941.186) [-2939.110] -- 0:01:31 404000 -- (-2943.996) (-2941.110) (-2935.825) [-2937.536] * (-2938.794) (-2938.065) (-2943.143) [-2942.933] -- 0:01:31 404500 -- (-2939.023) (-2942.628) [-2946.741] (-2937.088) * [-2934.816] (-2938.776) (-2945.428) (-2941.164) -- 0:01:31 405000 -- (-2940.927) [-2941.729] (-2942.620) (-2940.790) * [-2939.794] (-2944.645) (-2941.041) (-2940.424) -- 0:01:31 Average standard deviation of split frequencies: 0.003483 405500 -- [-2938.563] (-2938.738) (-2935.731) (-2945.095) * (-2937.802) (-2935.955) [-2938.992] (-2942.916) -- 0:01:30 406000 -- (-2934.485) [-2936.669] (-2938.587) (-2939.187) * (-2940.331) [-2937.843] (-2938.771) (-2943.179) -- 0:01:30 406500 -- [-2935.530] (-2941.820) (-2936.938) (-2942.618) * [-2940.131] (-2938.968) (-2945.868) (-2936.343) -- 0:01:30 407000 -- (-2940.706) (-2938.333) [-2940.333] (-2940.411) * (-2939.368) (-2939.706) [-2942.401] (-2936.897) -- 0:01:30 407500 -- [-2941.152] (-2938.928) (-2940.597) (-2939.956) * [-2939.787] (-2940.941) (-2942.547) (-2949.815) -- 0:01:30 408000 -- [-2946.065] (-2940.299) (-2943.390) (-2946.924) * (-2936.584) (-2938.944) [-2936.345] (-2941.104) -- 0:01:29 408500 -- [-2943.435] (-2939.760) (-2943.583) (-2940.927) * (-2945.702) (-2933.845) [-2938.682] (-2935.896) -- 0:01:29 409000 -- (-2942.556) (-2939.025) [-2945.609] (-2939.174) * (-2942.715) (-2938.654) (-2933.467) [-2940.241] -- 0:01:29 409500 -- (-2936.725) (-2938.564) (-2942.069) [-2934.391] * (-2941.439) (-2939.031) [-2939.171] (-2946.061) -- 0:01:30 410000 -- (-2941.474) [-2939.734] (-2938.094) (-2937.237) * (-2941.170) (-2940.069) [-2939.608] (-2941.693) -- 0:01:30 Average standard deviation of split frequencies: 0.003444 410500 -- (-2945.467) (-2937.744) (-2935.962) [-2937.471] * (-2937.778) [-2936.774] (-2942.451) (-2946.372) -- 0:01:30 411000 -- (-2938.313) (-2939.347) (-2938.459) [-2940.239] * (-2941.701) [-2940.973] (-2940.918) (-2941.599) -- 0:01:30 411500 -- (-2940.263) [-2937.500] (-2938.607) (-2941.163) * [-2938.791] (-2941.085) (-2940.894) (-2939.211) -- 0:01:30 412000 -- (-2937.267) [-2943.153] (-2949.664) (-2942.749) * (-2938.160) (-2937.155) (-2936.546) [-2940.670] -- 0:01:29 412500 -- (-2936.688) (-2941.427) (-2941.148) [-2936.684] * (-2934.816) [-2935.738] (-2945.780) (-2943.145) -- 0:01:29 413000 -- (-2942.554) (-2936.913) [-2941.206] (-2934.583) * [-2944.745] (-2935.267) (-2934.344) (-2938.695) -- 0:01:29 413500 -- [-2934.779] (-2938.814) (-2939.930) (-2937.459) * (-2944.374) (-2943.538) (-2942.658) [-2946.880] -- 0:01:29 414000 -- (-2939.424) (-2939.513) (-2943.340) [-2938.785] * (-2942.942) [-2933.903] (-2941.128) (-2948.969) -- 0:01:29 414500 -- (-2940.676) [-2934.978] (-2940.825) (-2943.390) * (-2939.407) [-2936.531] (-2939.026) (-2939.683) -- 0:01:28 415000 -- (-2949.391) [-2938.226] (-2940.888) (-2938.104) * (-2941.144) (-2938.834) (-2939.559) [-2941.038] -- 0:01:28 Average standard deviation of split frequencies: 0.001133 415500 -- (-2941.957) (-2938.416) [-2935.788] (-2944.525) * (-2943.635) (-2941.469) (-2949.630) [-2937.896] -- 0:01:28 416000 -- (-2940.195) [-2941.148] (-2936.415) (-2942.049) * [-2941.086] (-2938.558) (-2944.230) (-2939.857) -- 0:01:29 416500 -- (-2938.435) (-2943.840) [-2935.961] (-2934.697) * (-2941.523) [-2935.389] (-2938.257) (-2937.862) -- 0:01:29 417000 -- (-2936.001) (-2940.411) [-2939.510] (-2941.816) * [-2942.323] (-2933.137) (-2940.453) (-2935.602) -- 0:01:29 417500 -- (-2946.006) (-2939.840) (-2943.473) [-2941.040] * (-2943.718) [-2934.119] (-2945.614) (-2946.116) -- 0:01:29 418000 -- (-2941.640) (-2944.014) (-2939.232) [-2935.552] * (-2938.782) [-2936.919] (-2934.797) (-2944.168) -- 0:01:29 418500 -- [-2941.016] (-2938.509) (-2940.061) (-2946.818) * (-2940.945) (-2941.304) (-2935.492) [-2945.005] -- 0:01:28 419000 -- (-2936.769) (-2937.171) [-2934.979] (-2941.862) * (-2938.229) [-2936.666] (-2944.559) (-2943.772) -- 0:01:28 419500 -- (-2944.202) (-2939.287) (-2936.549) [-2937.047] * (-2939.714) (-2942.002) [-2938.437] (-2935.776) -- 0:01:28 420000 -- [-2940.977] (-2938.486) (-2940.275) (-2942.295) * [-2937.974] (-2941.915) (-2937.563) (-2939.927) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 420500 -- (-2941.214) [-2936.972] (-2936.296) (-2944.443) * (-2946.868) [-2939.318] (-2934.823) (-2944.502) -- 0:01:28 421000 -- (-2940.212) [-2938.773] (-2939.932) (-2947.395) * (-2936.539) (-2935.916) [-2939.716] (-2939.136) -- 0:01:28 421500 -- (-2936.261) [-2941.258] (-2937.723) (-2941.723) * [-2942.697] (-2939.948) (-2937.897) (-2940.710) -- 0:01:27 422000 -- (-2937.147) (-2938.364) [-2948.584] (-2945.244) * (-2939.839) (-2952.602) [-2940.924] (-2940.417) -- 0:01:27 422500 -- (-2938.405) (-2937.626) (-2941.736) [-2945.283] * (-2949.292) (-2942.169) (-2939.879) [-2934.731] -- 0:01:28 423000 -- [-2944.390] (-2940.590) (-2941.037) (-2943.652) * (-2945.465) (-2937.343) [-2944.445] (-2935.073) -- 0:01:28 423500 -- (-2936.679) (-2938.906) (-2946.414) [-2938.775] * (-2939.003) (-2945.324) [-2947.411] (-2938.770) -- 0:01:28 424000 -- (-2936.670) [-2938.545] (-2943.744) (-2936.210) * (-2941.274) [-2936.618] (-2945.473) (-2939.586) -- 0:01:28 424500 -- [-2938.792] (-2940.294) (-2947.007) (-2942.432) * (-2941.575) [-2939.339] (-2944.663) (-2941.307) -- 0:01:28 425000 -- (-2948.672) (-2935.839) (-2943.905) [-2938.238] * (-2949.771) [-2935.693] (-2943.484) (-2932.988) -- 0:01:27 Average standard deviation of split frequencies: 0.001107 425500 -- (-2946.151) [-2935.351] (-2939.359) (-2939.124) * (-2938.908) [-2939.039] (-2942.482) (-2942.045) -- 0:01:27 426000 -- (-2940.718) (-2942.246) (-2939.518) [-2943.834] * (-2940.595) [-2937.640] (-2946.749) (-2944.311) -- 0:01:27 426500 -- (-2943.794) (-2940.586) (-2940.076) [-2939.627] * (-2941.163) (-2936.901) [-2942.401] (-2940.189) -- 0:01:27 427000 -- (-2940.181) [-2937.457] (-2941.104) (-2938.248) * (-2942.724) (-2935.134) [-2940.027] (-2939.952) -- 0:01:27 427500 -- (-2945.630) (-2943.555) [-2940.261] (-2941.834) * [-2942.182] (-2938.493) (-2938.160) (-2939.533) -- 0:01:27 428000 -- (-2942.171) (-2941.214) [-2940.745] (-2937.743) * (-2933.717) [-2939.426] (-2950.939) (-2939.268) -- 0:01:26 428500 -- (-2937.591) (-2945.287) (-2942.562) [-2937.517] * (-2936.640) [-2937.985] (-2943.480) (-2934.525) -- 0:01:26 429000 -- (-2943.014) (-2936.663) (-2941.451) [-2945.000] * (-2939.559) [-2940.110] (-2946.035) (-2942.605) -- 0:01:26 429500 -- [-2933.935] (-2937.491) (-2946.006) (-2936.873) * [-2938.369] (-2943.152) (-2946.736) (-2934.839) -- 0:01:27 430000 -- (-2934.966) (-2940.525) (-2945.951) [-2939.116] * [-2941.824] (-2951.281) (-2940.986) (-2939.555) -- 0:01:27 Average standard deviation of split frequencies: 0.001095 430500 -- (-2940.549) (-2938.662) [-2934.244] (-2938.170) * (-2939.221) [-2941.610] (-2939.022) (-2937.246) -- 0:01:27 431000 -- [-2939.641] (-2938.974) (-2935.007) (-2938.604) * (-2940.449) (-2944.659) (-2937.512) [-2937.108] -- 0:01:27 431500 -- (-2944.903) (-2936.806) [-2936.311] (-2935.089) * (-2947.538) (-2935.144) [-2945.090] (-2940.453) -- 0:01:26 432000 -- (-2940.498) (-2933.652) (-2938.961) [-2938.589] * (-2940.022) (-2938.346) (-2934.922) [-2937.375] -- 0:01:26 432500 -- (-2942.018) (-2937.267) (-2936.526) [-2941.606] * [-2940.679] (-2935.460) (-2934.917) (-2935.966) -- 0:01:26 433000 -- (-2937.156) (-2946.632) (-2938.076) [-2940.829] * (-2942.253) [-2937.437] (-2937.652) (-2947.327) -- 0:01:26 433500 -- (-2935.736) (-2943.164) [-2938.727] (-2937.627) * (-2935.853) [-2938.925] (-2936.675) (-2938.498) -- 0:01:26 434000 -- (-2937.656) [-2939.413] (-2936.866) (-2940.521) * (-2940.508) (-2940.866) [-2937.811] (-2938.823) -- 0:01:26 434500 -- (-2941.087) (-2941.975) [-2938.538] (-2941.523) * (-2938.806) (-2948.032) [-2935.801] (-2937.607) -- 0:01:25 435000 -- (-2935.043) [-2938.882] (-2940.188) (-2939.831) * [-2945.464] (-2943.604) (-2935.644) (-2936.798) -- 0:01:25 Average standard deviation of split frequencies: 0.001081 435500 -- (-2944.354) (-2942.969) [-2939.599] (-2944.238) * (-2937.129) [-2938.064] (-2947.251) (-2936.849) -- 0:01:25 436000 -- (-2937.140) (-2940.932) [-2938.992] (-2942.043) * (-2949.757) [-2939.651] (-2941.536) (-2944.483) -- 0:01:26 436500 -- (-2939.502) (-2939.189) [-2936.919] (-2951.163) * (-2940.169) (-2937.954) (-2943.547) [-2938.199] -- 0:01:26 437000 -- (-2938.799) (-2946.012) (-2934.608) [-2946.574] * (-2948.211) (-2940.944) [-2938.996] (-2934.397) -- 0:01:26 437500 -- [-2942.559] (-2937.008) (-2942.851) (-2942.059) * (-2945.779) (-2947.593) [-2938.505] (-2940.463) -- 0:01:26 438000 -- (-2936.213) [-2941.856] (-2944.485) (-2939.909) * [-2946.919] (-2940.793) (-2936.291) (-2943.050) -- 0:01:25 438500 -- (-2938.832) [-2934.923] (-2945.831) (-2937.057) * (-2939.975) [-2936.282] (-2944.276) (-2938.746) -- 0:01:25 439000 -- [-2934.886] (-2941.042) (-2941.291) (-2940.190) * (-2945.488) [-2937.917] (-2942.853) (-2934.938) -- 0:01:25 439500 -- (-2943.235) [-2939.578] (-2941.456) (-2941.261) * [-2941.629] (-2946.290) (-2942.867) (-2936.507) -- 0:01:25 440000 -- (-2939.248) (-2940.641) (-2939.145) [-2934.221] * [-2946.642] (-2946.078) (-2942.031) (-2938.224) -- 0:01:25 Average standard deviation of split frequencies: 0.003209 440500 -- (-2943.609) (-2944.243) (-2939.880) [-2938.468] * (-2943.126) (-2943.352) [-2936.595] (-2937.993) -- 0:01:25 441000 -- (-2942.161) (-2941.625) [-2939.627] (-2939.416) * (-2950.548) (-2941.945) (-2941.170) [-2937.137] -- 0:01:24 441500 -- (-2940.513) (-2942.440) [-2935.256] (-2935.973) * (-2941.308) (-2935.133) [-2938.561] (-2940.212) -- 0:01:24 442000 -- (-2943.725) (-2939.400) (-2936.408) [-2935.039] * (-2939.760) (-2938.387) (-2935.583) [-2935.484] -- 0:01:24 442500 -- (-2942.045) (-2938.425) [-2936.381] (-2940.963) * (-2935.805) [-2934.982] (-2946.251) (-2943.052) -- 0:01:25 443000 -- (-2935.074) (-2940.746) (-2942.285) [-2941.359] * (-2943.639) (-2937.735) (-2938.313) [-2944.598] -- 0:01:25 443500 -- [-2936.937] (-2943.288) (-2938.368) (-2936.824) * (-2944.223) (-2936.454) [-2938.274] (-2940.193) -- 0:01:25 444000 -- (-2938.024) (-2941.394) [-2947.439] (-2939.643) * (-2944.415) (-2940.614) (-2943.915) [-2936.715] -- 0:01:25 444500 -- [-2941.203] (-2940.482) (-2936.698) (-2950.611) * [-2948.002] (-2938.279) (-2939.248) (-2936.453) -- 0:01:24 445000 -- (-2938.632) [-2936.871] (-2943.144) (-2942.583) * (-2941.960) [-2937.549] (-2938.520) (-2941.846) -- 0:01:24 Average standard deviation of split frequencies: 0.004228 445500 -- [-2934.766] (-2947.501) (-2940.952) (-2943.387) * (-2942.540) (-2939.326) [-2942.250] (-2937.436) -- 0:01:24 446000 -- (-2937.600) [-2936.236] (-2949.238) (-2942.367) * (-2946.755) (-2937.773) (-2942.066) [-2941.703] -- 0:01:24 446500 -- (-2935.615) (-2937.501) [-2937.833] (-2937.226) * (-2943.791) (-2944.076) (-2938.650) [-2937.142] -- 0:01:24 447000 -- [-2939.522] (-2940.529) (-2940.172) (-2939.407) * (-2942.439) (-2940.209) (-2939.278) [-2941.349] -- 0:01:24 447500 -- (-2934.244) (-2948.416) [-2944.151] (-2942.475) * (-2945.135) (-2938.154) (-2938.246) [-2935.277] -- 0:01:23 448000 -- (-2941.041) (-2941.626) [-2938.153] (-2941.996) * (-2941.105) [-2940.512] (-2940.321) (-2938.751) -- 0:01:23 448500 -- (-2938.781) (-2940.881) [-2941.761] (-2942.574) * (-2940.763) [-2939.675] (-2941.993) (-2937.568) -- 0:01:23 449000 -- (-2935.779) (-2940.286) [-2938.263] (-2941.170) * [-2945.163] (-2939.550) (-2941.597) (-2940.698) -- 0:01:24 449500 -- [-2938.085] (-2940.146) (-2936.917) (-2942.705) * (-2933.481) (-2938.406) (-2936.516) [-2938.786] -- 0:01:24 450000 -- [-2933.595] (-2935.845) (-2938.977) (-2940.376) * [-2934.198] (-2940.803) (-2939.080) (-2936.018) -- 0:01:24 Average standard deviation of split frequencies: 0.004184 450500 -- [-2937.495] (-2939.528) (-2934.717) (-2944.355) * (-2942.226) (-2939.777) [-2936.743] (-2938.526) -- 0:01:24 451000 -- (-2937.458) (-2941.573) [-2935.540] (-2935.234) * (-2946.471) (-2944.863) [-2942.986] (-2939.817) -- 0:01:23 451500 -- (-2934.707) (-2938.003) [-2938.724] (-2937.611) * [-2935.797] (-2939.798) (-2944.886) (-2946.373) -- 0:01:23 452000 -- (-2947.751) (-2934.417) [-2939.170] (-2937.892) * [-2938.529] (-2939.542) (-2940.778) (-2935.908) -- 0:01:23 452500 -- (-2942.612) [-2948.172] (-2938.527) (-2942.847) * (-2939.756) (-2944.239) (-2937.909) [-2938.775] -- 0:01:23 453000 -- [-2935.485] (-2938.054) (-2936.336) (-2946.843) * (-2939.766) [-2937.696] (-2941.079) (-2939.589) -- 0:01:23 453500 -- (-2941.656) (-2942.121) (-2946.088) [-2938.393] * (-2937.324) (-2941.774) [-2939.339] (-2939.348) -- 0:01:23 454000 -- (-2943.145) (-2938.090) [-2937.528] (-2942.736) * (-2938.181) [-2938.066] (-2936.322) (-2937.430) -- 0:01:22 454500 -- (-2946.468) [-2938.596] (-2944.308) (-2941.659) * (-2939.799) (-2938.205) [-2934.574] (-2943.995) -- 0:01:22 455000 -- (-2947.975) [-2934.231] (-2944.886) (-2940.628) * (-2937.767) (-2938.759) [-2937.846] (-2945.354) -- 0:01:22 Average standard deviation of split frequencies: 0.003101 455500 -- (-2952.737) (-2937.281) [-2943.777] (-2932.199) * (-2935.241) (-2938.881) [-2941.825] (-2936.614) -- 0:01:23 456000 -- (-2936.539) (-2940.695) [-2939.401] (-2943.242) * (-2941.171) (-2946.787) (-2935.335) [-2934.078] -- 0:01:23 456500 -- (-2932.823) [-2943.151] (-2937.807) (-2938.784) * (-2944.811) [-2936.758] (-2938.402) (-2938.387) -- 0:01:23 457000 -- (-2936.716) (-2936.793) (-2939.271) [-2934.545] * (-2936.171) (-2940.190) [-2936.997] (-2945.266) -- 0:01:23 457500 -- [-2933.565] (-2940.472) (-2935.666) (-2936.268) * (-2944.561) [-2940.790] (-2936.665) (-2940.359) -- 0:01:23 458000 -- (-2944.505) [-2937.022] (-2945.613) (-2942.479) * [-2946.825] (-2936.783) (-2939.299) (-2937.446) -- 0:01:22 458500 -- [-2934.184] (-2939.204) (-2938.037) (-2952.873) * (-2939.946) (-2941.985) [-2938.200] (-2940.676) -- 0:01:22 459000 -- [-2935.740] (-2948.559) (-2938.323) (-2940.390) * (-2945.658) (-2942.847) (-2941.442) [-2938.072] -- 0:01:22 459500 -- (-2939.778) (-2944.181) (-2939.864) [-2938.721] * (-2941.716) [-2943.551] (-2938.539) (-2941.258) -- 0:01:22 460000 -- (-2946.867) [-2940.928] (-2941.765) (-2935.328) * (-2952.963) (-2942.925) (-2944.253) [-2934.732] -- 0:01:22 Average standard deviation of split frequencies: 0.004093 460500 -- (-2942.488) (-2939.861) (-2937.579) [-2937.080] * (-2945.165) (-2940.245) (-2944.103) [-2935.530] -- 0:01:22 461000 -- (-2946.349) [-2938.814] (-2942.378) (-2941.644) * (-2935.740) [-2937.004] (-2941.669) (-2938.790) -- 0:01:21 461500 -- (-2949.208) [-2938.314] (-2938.702) (-2940.542) * (-2937.168) (-2941.224) [-2935.879] (-2947.561) -- 0:01:21 462000 -- (-2946.423) [-2937.742] (-2943.109) (-2943.222) * [-2939.138] (-2951.722) (-2936.783) (-2938.054) -- 0:01:22 462500 -- (-2937.793) [-2939.174] (-2941.508) (-2939.079) * (-2945.468) (-2948.801) (-2938.379) [-2939.903] -- 0:01:22 463000 -- (-2948.220) [-2941.472] (-2945.440) (-2941.818) * (-2941.632) (-2935.522) [-2938.359] (-2944.317) -- 0:01:22 463500 -- (-2944.695) (-2935.543) (-2943.595) [-2940.791] * (-2939.492) (-2936.955) (-2937.746) [-2937.307] -- 0:01:22 464000 -- (-2938.799) (-2940.587) (-2937.574) [-2937.571] * [-2936.193] (-2939.576) (-2936.908) (-2941.018) -- 0:01:22 464500 -- (-2944.221) (-2943.577) (-2938.525) [-2940.470] * (-2939.646) (-2944.422) [-2938.897] (-2942.610) -- 0:01:21 465000 -- [-2938.765] (-2940.428) (-2941.358) (-2950.394) * (-2935.171) [-2941.259] (-2934.605) (-2939.495) -- 0:01:21 Average standard deviation of split frequencies: 0.004046 465500 -- (-2939.617) [-2942.032] (-2935.807) (-2937.850) * [-2941.297] (-2937.143) (-2939.352) (-2935.713) -- 0:01:21 466000 -- [-2940.450] (-2937.082) (-2937.856) (-2943.320) * (-2947.561) (-2939.514) [-2938.856] (-2938.930) -- 0:01:21 466500 -- [-2941.760] (-2943.371) (-2944.313) (-2938.456) * (-2945.927) (-2941.603) [-2944.322] (-2940.597) -- 0:01:21 467000 -- (-2943.287) [-2938.521] (-2938.290) (-2936.403) * (-2941.981) (-2939.891) (-2939.258) [-2940.871] -- 0:01:21 467500 -- (-2943.350) (-2938.336) (-2940.486) [-2943.159] * (-2942.659) (-2936.549) (-2941.927) [-2943.779] -- 0:01:20 468000 -- (-2954.374) (-2936.927) (-2941.335) [-2941.533] * [-2939.417] (-2938.380) (-2936.830) (-2940.493) -- 0:01:20 468500 -- (-2945.018) (-2942.184) (-2939.139) [-2933.831] * (-2941.496) (-2938.737) (-2941.893) [-2935.278] -- 0:01:21 469000 -- (-2943.781) (-2941.334) [-2937.287] (-2941.163) * (-2943.620) (-2948.492) (-2937.104) [-2939.036] -- 0:01:21 469500 -- [-2936.565] (-2941.597) (-2934.909) (-2936.824) * [-2943.652] (-2936.094) (-2939.766) (-2943.506) -- 0:01:21 470000 -- (-2941.731) (-2940.887) (-2947.384) [-2934.511] * [-2937.580] (-2936.234) (-2942.864) (-2941.270) -- 0:01:21 Average standard deviation of split frequencies: 0.002003 470500 -- (-2944.075) (-2951.375) (-2938.139) [-2940.378] * (-2940.998) [-2941.465] (-2937.783) (-2939.335) -- 0:01:21 471000 -- (-2937.744) (-2940.574) (-2941.107) [-2938.849] * (-2945.976) [-2943.451] (-2943.982) (-2945.370) -- 0:01:20 471500 -- (-2934.202) [-2939.617] (-2936.679) (-2940.235) * (-2944.671) [-2936.024] (-2940.253) (-2939.406) -- 0:01:20 472000 -- [-2939.882] (-2945.306) (-2945.411) (-2941.689) * (-2939.637) (-2938.568) (-2948.894) [-2938.119] -- 0:01:20 472500 -- (-2938.255) (-2944.688) (-2944.170) [-2941.007] * [-2943.563] (-2941.428) (-2941.552) (-2939.051) -- 0:01:20 473000 -- (-2936.433) [-2940.088] (-2934.682) (-2945.185) * (-2945.406) [-2940.155] (-2941.095) (-2944.823) -- 0:01:20 473500 -- [-2937.445] (-2939.046) (-2934.320) (-2943.045) * (-2949.777) [-2938.053] (-2944.483) (-2948.372) -- 0:01:20 474000 -- (-2939.641) (-2942.292) (-2944.042) [-2934.168] * (-2937.240) [-2942.760] (-2946.529) (-2939.382) -- 0:01:19 474500 -- [-2935.854] (-2938.723) (-2936.844) (-2937.202) * [-2934.681] (-2942.076) (-2950.616) (-2945.068) -- 0:01:19 475000 -- (-2938.905) (-2938.547) [-2938.494] (-2937.358) * (-2938.147) (-2942.287) [-2944.350] (-2943.114) -- 0:01:20 Average standard deviation of split frequencies: 0.001981 475500 -- (-2938.526) [-2940.213] (-2938.662) (-2940.824) * (-2938.279) (-2939.599) (-2938.871) [-2940.059] -- 0:01:20 476000 -- [-2939.967] (-2935.581) (-2937.920) (-2952.915) * [-2941.632] (-2941.088) (-2936.737) (-2941.520) -- 0:01:20 476500 -- [-2937.377] (-2943.703) (-2940.491) (-2937.884) * [-2944.344] (-2936.817) (-2941.735) (-2945.246) -- 0:01:20 477000 -- [-2934.417] (-2941.652) (-2939.981) (-2952.429) * (-2940.801) [-2944.820] (-2938.404) (-2941.981) -- 0:01:20 477500 -- (-2941.053) [-2938.951] (-2938.507) (-2945.807) * [-2936.941] (-2945.722) (-2937.779) (-2937.917) -- 0:01:19 478000 -- [-2935.284] (-2938.495) (-2936.019) (-2943.410) * (-2936.662) (-2946.700) (-2939.112) [-2935.617] -- 0:01:19 478500 -- [-2940.040] (-2939.731) (-2939.089) (-2940.198) * (-2942.153) (-2946.510) (-2943.612) [-2937.055] -- 0:01:19 479000 -- [-2938.312] (-2943.476) (-2939.902) (-2942.077) * (-2939.102) (-2938.045) (-2940.455) [-2939.016] -- 0:01:19 479500 -- (-2941.808) (-2937.551) (-2946.283) [-2936.719] * (-2939.792) (-2938.818) [-2942.205] (-2939.531) -- 0:01:19 480000 -- [-2942.813] (-2942.290) (-2939.680) (-2940.080) * (-2937.134) [-2941.627] (-2939.322) (-2950.416) -- 0:01:19 Average standard deviation of split frequencies: 0.002942 480500 -- (-2941.358) (-2940.261) (-2941.660) [-2935.444] * (-2935.039) (-2941.961) (-2934.154) [-2938.163] -- 0:01:18 481000 -- [-2945.329] (-2943.926) (-2938.938) (-2941.919) * (-2943.764) (-2950.845) [-2936.418] (-2938.076) -- 0:01:18 481500 -- [-2943.361] (-2940.214) (-2938.194) (-2940.513) * [-2943.845] (-2949.150) (-2938.950) (-2941.755) -- 0:01:19 482000 -- (-2932.428) [-2941.728] (-2941.448) (-2936.941) * (-2933.576) (-2946.336) (-2932.616) [-2934.982] -- 0:01:19 482500 -- (-2936.152) (-2946.184) (-2937.379) [-2940.961] * [-2935.788] (-2938.492) (-2939.453) (-2947.621) -- 0:01:19 483000 -- (-2953.487) [-2940.186] (-2947.746) (-2944.633) * [-2937.586] (-2935.994) (-2943.469) (-2937.838) -- 0:01:19 483500 -- [-2945.064] (-2939.901) (-2943.969) (-2935.736) * (-2941.015) (-2937.709) (-2942.106) [-2937.455] -- 0:01:19 484000 -- (-2941.858) (-2947.239) (-2938.094) [-2938.396] * (-2944.955) [-2938.438] (-2946.130) (-2944.240) -- 0:01:18 484500 -- [-2937.175] (-2941.558) (-2941.875) (-2936.018) * [-2937.950] (-2940.741) (-2950.555) (-2941.800) -- 0:01:18 485000 -- (-2938.225) (-2942.907) (-2936.454) [-2935.312] * (-2939.645) (-2940.709) (-2944.601) [-2938.742] -- 0:01:18 Average standard deviation of split frequencies: 0.002910 485500 -- (-2939.138) (-2941.622) [-2938.273] (-2942.615) * (-2940.978) (-2943.440) [-2941.972] (-2934.850) -- 0:01:18 486000 -- (-2936.248) [-2943.924] (-2939.481) (-2937.670) * (-2945.059) [-2937.020] (-2944.167) (-2936.160) -- 0:01:18 486500 -- [-2946.372] (-2943.123) (-2937.374) (-2946.104) * (-2936.782) (-2936.852) (-2940.384) [-2936.020] -- 0:01:18 487000 -- [-2933.103] (-2950.768) (-2941.091) (-2934.973) * (-2939.250) [-2938.021] (-2936.173) (-2938.601) -- 0:01:17 487500 -- (-2939.480) (-2944.644) (-2942.562) [-2938.132] * (-2940.751) (-2938.906) [-2934.181] (-2940.718) -- 0:01:17 488000 -- (-2936.014) [-2945.657] (-2937.044) (-2938.833) * (-2941.446) [-2938.266] (-2938.596) (-2943.561) -- 0:01:18 488500 -- (-2939.680) (-2942.095) (-2938.507) [-2941.731] * (-2941.791) (-2944.968) (-2942.521) [-2939.753] -- 0:01:18 489000 -- [-2937.835] (-2939.954) (-2940.504) (-2942.618) * (-2931.960) (-2944.476) [-2943.004] (-2941.864) -- 0:01:18 489500 -- [-2938.367] (-2938.679) (-2935.485) (-2938.474) * [-2936.790] (-2941.013) (-2943.241) (-2941.260) -- 0:01:18 490000 -- (-2935.949) [-2940.622] (-2942.217) (-2933.994) * (-2942.734) (-2937.046) (-2937.486) [-2945.296] -- 0:01:18 Average standard deviation of split frequencies: 0.002882 490500 -- (-2939.074) (-2938.226) (-2952.529) [-2938.987] * (-2938.765) [-2936.783] (-2937.032) (-2939.176) -- 0:01:17 491000 -- [-2939.959] (-2945.543) (-2937.599) (-2937.577) * [-2937.461] (-2937.885) (-2946.771) (-2939.102) -- 0:01:17 491500 -- (-2940.939) (-2940.342) [-2941.259] (-2938.674) * [-2943.795] (-2937.497) (-2944.800) (-2939.750) -- 0:01:17 492000 -- (-2938.008) (-2942.554) (-2937.437) [-2938.777] * (-2943.666) [-2939.052] (-2937.778) (-2941.479) -- 0:01:17 492500 -- [-2938.058] (-2935.185) (-2944.898) (-2939.831) * (-2944.435) (-2941.614) (-2944.890) [-2936.101] -- 0:01:17 493000 -- [-2937.150] (-2936.530) (-2945.839) (-2941.151) * (-2938.486) (-2943.040) (-2941.452) [-2939.607] -- 0:01:17 493500 -- (-2939.970) (-2943.745) (-2938.461) [-2941.760] * (-2945.765) (-2947.609) (-2945.094) [-2938.021] -- 0:01:16 494000 -- (-2944.456) (-2940.413) [-2939.540] (-2937.584) * [-2944.833] (-2943.143) (-2941.693) (-2940.931) -- 0:01:16 494500 -- (-2941.570) [-2937.073] (-2941.631) (-2944.722) * (-2935.394) (-2939.391) [-2939.196] (-2939.784) -- 0:01:17 495000 -- (-2938.687) (-2938.638) (-2936.621) [-2941.302] * (-2942.952) (-2944.753) (-2939.594) [-2935.366] -- 0:01:17 Average standard deviation of split frequencies: 0.002851 495500 -- (-2941.647) (-2945.014) [-2942.481] (-2941.285) * (-2952.732) [-2941.424] (-2938.851) (-2939.733) -- 0:01:17 496000 -- [-2942.128] (-2939.542) (-2944.029) (-2950.117) * (-2947.999) [-2937.943] (-2943.849) (-2943.988) -- 0:01:17 496500 -- (-2937.905) [-2938.606] (-2941.195) (-2937.657) * (-2942.454) (-2936.185) (-2944.012) [-2937.115] -- 0:01:17 497000 -- (-2938.814) (-2936.417) [-2938.984] (-2940.536) * (-2943.771) [-2943.755] (-2945.174) (-2942.007) -- 0:01:16 497500 -- (-2936.523) [-2934.259] (-2940.835) (-2944.577) * (-2949.037) [-2939.006] (-2942.458) (-2942.758) -- 0:01:16 498000 -- [-2934.848] (-2937.827) (-2944.228) (-2945.422) * (-2938.875) (-2943.363) [-2943.055] (-2936.945) -- 0:01:16 498500 -- (-2936.200) [-2941.147] (-2945.244) (-2936.462) * (-2944.270) (-2943.027) (-2936.303) [-2936.369] -- 0:01:16 499000 -- (-2939.014) (-2951.102) [-2944.105] (-2939.153) * (-2936.408) (-2947.269) (-2934.895) [-2933.717] -- 0:01:16 499500 -- (-2941.079) (-2934.204) (-2940.574) [-2936.097] * (-2940.241) (-2949.806) (-2944.389) [-2942.972] -- 0:01:16 500000 -- (-2936.084) [-2937.594] (-2942.732) (-2937.213) * (-2935.840) (-2942.591) [-2939.135] (-2943.250) -- 0:01:16 Average standard deviation of split frequencies: 0.003766 500500 -- (-2943.442) (-2939.231) [-2945.444] (-2936.713) * (-2943.325) (-2940.213) (-2941.655) [-2940.602] -- 0:01:15 501000 -- (-2939.099) [-2940.451] (-2945.164) (-2942.643) * (-2937.317) (-2936.994) (-2945.520) [-2946.917] -- 0:01:16 501500 -- [-2942.112] (-2938.498) (-2941.290) (-2941.522) * (-2945.719) [-2937.061] (-2943.142) (-2941.629) -- 0:01:16 502000 -- (-2945.235) (-2937.976) (-2943.783) [-2937.007] * (-2939.057) [-2946.055] (-2938.096) (-2941.880) -- 0:01:16 502500 -- (-2935.943) (-2935.907) (-2940.820) [-2935.704] * (-2939.893) (-2938.720) (-2939.254) [-2936.890] -- 0:01:16 503000 -- (-2939.048) (-2942.623) (-2937.992) [-2938.302] * (-2941.663) (-2937.444) (-2935.235) [-2940.381] -- 0:01:16 503500 -- (-2937.307) [-2937.847] (-2937.829) (-2942.114) * (-2940.353) (-2939.225) [-2939.629] (-2941.407) -- 0:01:15 504000 -- (-2937.657) [-2938.097] (-2947.638) (-2950.652) * (-2945.488) (-2944.275) [-2937.224] (-2939.782) -- 0:01:15 504500 -- (-2941.621) [-2934.309] (-2938.610) (-2937.947) * (-2942.274) [-2935.540] (-2943.903) (-2933.100) -- 0:01:15 505000 -- (-2939.764) (-2935.582) (-2941.977) [-2939.583] * (-2941.946) (-2941.831) (-2937.719) [-2938.188] -- 0:01:15 Average standard deviation of split frequencies: 0.003727 505500 -- [-2942.554] (-2932.712) (-2945.635) (-2939.744) * [-2935.627] (-2943.152) (-2939.287) (-2940.834) -- 0:01:15 506000 -- [-2939.712] (-2941.305) (-2939.648) (-2948.901) * (-2946.583) [-2940.438] (-2935.632) (-2934.077) -- 0:01:15 506500 -- (-2947.353) (-2936.949) (-2944.791) [-2943.536] * (-2937.827) (-2943.422) [-2934.600] (-2939.316) -- 0:01:15 507000 -- [-2940.778] (-2936.701) (-2940.060) (-2936.018) * [-2940.904] (-2948.547) (-2940.817) (-2939.770) -- 0:01:14 507500 -- (-2940.303) (-2938.653) [-2936.431] (-2938.773) * (-2941.110) (-2940.416) (-2940.016) [-2937.029] -- 0:01:15 508000 -- (-2940.043) (-2941.745) (-2936.311) [-2942.809] * (-2936.828) [-2942.536] (-2934.911) (-2947.512) -- 0:01:15 508500 -- (-2939.526) (-2936.811) (-2934.177) [-2942.567] * (-2942.834) (-2936.254) (-2942.372) [-2945.940] -- 0:01:15 509000 -- [-2937.935] (-2942.561) (-2944.517) (-2941.335) * (-2942.167) (-2940.149) [-2938.929] (-2940.219) -- 0:01:15 509500 -- (-2937.494) [-2942.049] (-2935.713) (-2939.691) * (-2935.641) (-2944.736) (-2939.955) [-2937.250] -- 0:01:15 510000 -- (-2940.975) (-2937.028) [-2935.380] (-2935.948) * (-2939.261) (-2936.611) [-2935.783] (-2933.946) -- 0:01:14 Average standard deviation of split frequencies: 0.003692 510500 -- (-2933.110) (-2943.839) [-2937.573] (-2942.285) * [-2936.024] (-2937.751) (-2938.607) (-2942.201) -- 0:01:14 511000 -- (-2938.652) (-2945.302) [-2938.830] (-2940.145) * (-2940.227) (-2939.903) [-2938.449] (-2941.285) -- 0:01:14 511500 -- (-2940.819) (-2945.612) (-2951.059) [-2937.576] * (-2940.525) (-2937.313) [-2941.724] (-2938.207) -- 0:01:14 512000 -- (-2943.265) (-2943.187) [-2941.120] (-2936.691) * [-2935.071] (-2938.420) (-2940.167) (-2934.049) -- 0:01:14 512500 -- [-2936.782] (-2946.745) (-2936.972) (-2935.625) * [-2935.471] (-2939.031) (-2935.289) (-2940.423) -- 0:01:14 513000 -- (-2937.121) [-2939.076] (-2942.917) (-2945.353) * [-2936.208] (-2935.597) (-2936.448) (-2941.673) -- 0:01:14 513500 -- (-2940.386) (-2938.995) [-2940.845] (-2941.446) * (-2950.610) (-2936.433) [-2936.912] (-2938.307) -- 0:01:13 514000 -- (-2945.494) (-2946.853) [-2940.984] (-2941.083) * [-2936.155] (-2937.073) (-2938.523) (-2938.271) -- 0:01:14 514500 -- [-2942.892] (-2940.803) (-2940.529) (-2934.210) * (-2937.009) [-2936.284] (-2941.768) (-2936.659) -- 0:01:14 515000 -- (-2938.239) (-2935.280) [-2934.912] (-2942.676) * [-2943.489] (-2944.615) (-2940.366) (-2940.393) -- 0:01:14 Average standard deviation of split frequencies: 0.003654 515500 -- [-2941.905] (-2942.369) (-2940.875) (-2945.038) * (-2942.709) [-2937.279] (-2937.220) (-2943.553) -- 0:01:14 516000 -- (-2945.852) [-2939.087] (-2939.623) (-2944.074) * (-2936.475) [-2941.627] (-2938.471) (-2934.777) -- 0:01:14 516500 -- (-2941.262) (-2937.777) [-2945.202] (-2941.230) * [-2938.547] (-2943.238) (-2941.302) (-2941.658) -- 0:01:13 517000 -- (-2944.511) (-2938.377) (-2942.711) [-2932.386] * [-2936.611] (-2937.956) (-2940.947) (-2943.605) -- 0:01:13 517500 -- (-2938.903) [-2938.640] (-2936.428) (-2935.041) * (-2944.805) (-2939.746) [-2937.955] (-2940.138) -- 0:01:13 518000 -- (-2941.049) (-2948.276) [-2938.168] (-2936.765) * (-2941.887) [-2945.654] (-2938.875) (-2945.380) -- 0:01:13 518500 -- (-2939.022) (-2939.092) (-2937.795) [-2942.541] * (-2937.493) (-2944.086) [-2933.163] (-2942.531) -- 0:01:13 519000 -- (-2936.257) (-2944.425) [-2938.890] (-2941.917) * [-2942.929] (-2945.459) (-2937.314) (-2941.860) -- 0:01:13 519500 -- (-2935.651) [-2946.610] (-2940.646) (-2937.008) * (-2944.647) (-2937.539) (-2938.353) [-2938.971] -- 0:01:13 520000 -- [-2937.821] (-2944.438) (-2938.814) (-2940.753) * (-2945.273) (-2937.274) (-2938.641) [-2935.863] -- 0:01:12 Average standard deviation of split frequencies: 0.003622 520500 -- (-2941.642) (-2935.469) [-2938.650] (-2945.251) * [-2941.217] (-2948.902) (-2939.938) (-2938.085) -- 0:01:13 521000 -- (-2938.614) (-2943.412) [-2933.193] (-2942.017) * (-2942.960) (-2940.326) (-2942.851) [-2941.308] -- 0:01:13 521500 -- (-2934.152) (-2940.124) (-2937.816) [-2946.235] * (-2940.484) (-2937.997) [-2946.256] (-2937.983) -- 0:01:13 522000 -- [-2939.475] (-2940.794) (-2936.866) (-2943.430) * (-2936.071) (-2934.680) (-2940.260) [-2942.010] -- 0:01:13 522500 -- [-2937.702] (-2938.073) (-2938.038) (-2941.113) * (-2939.453) (-2935.154) (-2943.662) [-2935.677] -- 0:01:13 523000 -- [-2936.631] (-2937.827) (-2941.763) (-2949.856) * (-2946.308) [-2938.634] (-2951.838) (-2938.700) -- 0:01:12 523500 -- (-2938.337) (-2936.905) [-2938.949] (-2944.530) * [-2935.359] (-2938.134) (-2945.515) (-2940.043) -- 0:01:12 524000 -- (-2942.921) [-2944.331] (-2945.276) (-2951.978) * (-2934.484) (-2941.218) (-2939.493) [-2934.363] -- 0:01:12 524500 -- [-2947.062] (-2937.784) (-2936.414) (-2940.637) * (-2943.018) (-2935.181) (-2940.645) [-2936.206] -- 0:01:12 525000 -- (-2943.452) (-2937.457) [-2940.355] (-2943.325) * (-2943.030) (-2946.097) [-2934.595] (-2938.598) -- 0:01:12 Average standard deviation of split frequencies: 0.001792 525500 -- (-2938.371) (-2940.228) (-2936.785) [-2937.774] * (-2940.297) (-2939.550) (-2937.897) [-2944.230] -- 0:01:12 526000 -- (-2939.473) [-2938.866] (-2939.615) (-2940.904) * (-2944.743) (-2936.844) (-2939.324) [-2937.266] -- 0:01:12 526500 -- [-2939.700] (-2946.760) (-2944.457) (-2944.420) * (-2942.089) (-2940.653) (-2939.156) [-2942.623] -- 0:01:11 527000 -- [-2940.542] (-2939.046) (-2946.014) (-2945.334) * (-2944.473) [-2936.874] (-2938.052) (-2936.763) -- 0:01:12 527500 -- (-2938.463) (-2946.148) (-2952.393) [-2939.236] * [-2941.546] (-2945.834) (-2938.481) (-2941.722) -- 0:01:12 528000 -- [-2941.108] (-2938.644) (-2952.003) (-2946.244) * (-2943.359) [-2936.212] (-2941.924) (-2940.158) -- 0:01:12 528500 -- (-2940.203) (-2939.699) (-2942.435) [-2936.969] * [-2940.918] (-2945.192) (-2944.611) (-2938.454) -- 0:01:12 529000 -- (-2941.280) [-2940.881] (-2940.190) (-2943.783) * (-2936.564) (-2949.901) (-2949.447) [-2939.640] -- 0:01:12 529500 -- [-2938.555] (-2950.353) (-2942.808) (-2934.481) * (-2940.130) (-2948.033) [-2941.045] (-2943.041) -- 0:01:11 530000 -- [-2939.443] (-2961.248) (-2940.891) (-2937.059) * (-2936.953) (-2939.324) [-2938.555] (-2938.012) -- 0:01:11 Average standard deviation of split frequencies: 0.001777 530500 -- [-2937.993] (-2946.991) (-2935.606) (-2936.450) * [-2938.367] (-2935.935) (-2944.566) (-2947.043) -- 0:01:11 531000 -- (-2935.150) (-2947.392) [-2941.408] (-2939.789) * (-2938.760) [-2938.747] (-2948.664) (-2939.514) -- 0:01:11 531500 -- (-2936.669) (-2938.273) [-2943.553] (-2936.310) * (-2943.710) (-2937.989) (-2943.212) [-2937.175] -- 0:01:11 532000 -- (-2941.271) (-2947.762) [-2940.751] (-2938.195) * (-2946.793) (-2943.668) [-2938.781] (-2937.383) -- 0:01:11 532500 -- (-2941.318) [-2940.982] (-2941.160) (-2936.636) * (-2947.223) (-2945.822) (-2934.620) [-2936.630] -- 0:01:11 533000 -- [-2939.217] (-2937.016) (-2934.550) (-2941.614) * (-2948.102) [-2934.722] (-2939.644) (-2937.624) -- 0:01:10 533500 -- (-2937.616) [-2937.737] (-2944.487) (-2938.624) * [-2938.744] (-2942.225) (-2939.277) (-2943.498) -- 0:01:11 534000 -- (-2938.847) (-2941.285) [-2941.090] (-2936.568) * [-2938.456] (-2940.050) (-2943.302) (-2941.566) -- 0:01:11 534500 -- (-2931.550) (-2939.050) (-2940.188) [-2940.818] * [-2939.370] (-2942.518) (-2942.229) (-2940.418) -- 0:01:11 535000 -- [-2942.315] (-2936.271) (-2950.469) (-2943.357) * [-2936.556] (-2938.367) (-2938.025) (-2936.280) -- 0:01:11 Average standard deviation of split frequencies: 0.000879 535500 -- (-2935.201) [-2940.416] (-2940.695) (-2944.231) * (-2939.470) (-2940.067) (-2941.227) [-2935.533] -- 0:01:11 536000 -- (-2935.222) [-2938.897] (-2946.580) (-2942.628) * (-2936.350) [-2942.697] (-2937.565) (-2936.256) -- 0:01:10 536500 -- (-2934.108) (-2942.057) (-2941.671) [-2942.170] * (-2942.246) [-2939.387] (-2936.278) (-2943.695) -- 0:01:10 537000 -- (-2935.969) (-2939.213) [-2940.147] (-2937.389) * (-2936.176) [-2936.096] (-2941.675) (-2940.361) -- 0:01:10 537500 -- (-2941.050) (-2939.873) [-2940.586] (-2939.405) * (-2937.536) (-2938.670) (-2935.489) [-2934.434] -- 0:01:10 538000 -- (-2942.428) [-2934.046] (-2934.201) (-2940.199) * (-2937.072) [-2938.933] (-2940.155) (-2942.916) -- 0:01:10 538500 -- (-2936.981) (-2947.116) [-2940.125] (-2937.965) * [-2939.499] (-2939.360) (-2936.982) (-2941.316) -- 0:01:10 539000 -- (-2943.631) (-2939.732) [-2940.816] (-2938.487) * (-2943.987) [-2947.086] (-2941.023) (-2942.700) -- 0:01:10 539500 -- [-2935.347] (-2940.285) (-2945.359) (-2937.588) * (-2939.142) (-2947.876) [-2939.921] (-2936.423) -- 0:01:09 540000 -- (-2941.708) [-2942.639] (-2941.651) (-2936.949) * (-2944.236) (-2939.487) [-2938.574] (-2940.547) -- 0:01:10 Average standard deviation of split frequencies: 0.001744 540500 -- (-2941.036) [-2939.257] (-2935.273) (-2943.393) * (-2950.656) (-2944.223) (-2940.802) [-2938.252] -- 0:01:10 541000 -- (-2937.291) (-2938.769) [-2936.898] (-2943.206) * [-2938.373] (-2938.437) (-2939.955) (-2939.523) -- 0:01:10 541500 -- (-2939.264) [-2933.139] (-2938.153) (-2933.239) * [-2939.941] (-2939.102) (-2939.153) (-2941.545) -- 0:01:10 542000 -- (-2946.620) (-2942.741) (-2936.311) [-2941.959] * (-2940.358) [-2935.177] (-2939.869) (-2937.644) -- 0:01:10 542500 -- (-2940.837) (-2931.964) [-2935.850] (-2940.150) * (-2938.014) [-2936.097] (-2947.139) (-2938.775) -- 0:01:09 543000 -- (-2936.957) (-2937.276) [-2938.942] (-2935.845) * [-2938.057] (-2940.180) (-2942.986) (-2945.420) -- 0:01:09 543500 -- (-2942.977) [-2933.623] (-2941.765) (-2937.040) * [-2942.411] (-2936.426) (-2939.851) (-2942.356) -- 0:01:09 544000 -- (-2937.662) (-2935.587) [-2945.291] (-2939.742) * (-2938.066) (-2935.495) (-2943.541) [-2950.869] -- 0:01:09 544500 -- [-2935.922] (-2937.875) (-2942.047) (-2938.770) * [-2937.746] (-2943.394) (-2940.949) (-2938.560) -- 0:01:09 545000 -- (-2938.300) (-2948.511) [-2935.418] (-2941.255) * (-2946.843) [-2943.373] (-2941.903) (-2939.042) -- 0:01:09 Average standard deviation of split frequencies: 0.001727 545500 -- (-2946.422) (-2936.320) (-2939.281) [-2941.305] * (-2937.297) [-2939.779] (-2943.891) (-2942.715) -- 0:01:09 546000 -- (-2940.905) [-2933.970] (-2943.817) (-2938.715) * (-2942.763) (-2939.022) (-2940.282) [-2941.046] -- 0:01:09 546500 -- (-2937.743) [-2941.039] (-2935.761) (-2939.209) * [-2939.611] (-2939.943) (-2938.135) (-2936.998) -- 0:01:09 547000 -- (-2941.306) [-2937.258] (-2942.618) (-2943.578) * (-2937.707) (-2941.610) (-2936.771) [-2937.543] -- 0:01:09 547500 -- (-2938.226) [-2941.637] (-2936.617) (-2937.697) * [-2936.532] (-2938.528) (-2937.270) (-2939.028) -- 0:01:09 548000 -- [-2934.258] (-2935.070) (-2938.746) (-2941.474) * (-2937.232) (-2944.503) (-2942.342) [-2936.405] -- 0:01:09 548500 -- (-2938.926) [-2936.330] (-2946.405) (-2944.563) * (-2942.460) (-2937.218) [-2939.464] (-2936.205) -- 0:01:09 549000 -- (-2943.374) (-2936.158) [-2943.328] (-2939.994) * (-2939.421) (-2942.418) [-2937.815] (-2938.001) -- 0:01:09 549500 -- (-2937.346) (-2937.902) (-2953.431) [-2941.674] * (-2941.125) [-2936.915] (-2939.901) (-2938.724) -- 0:01:08 550000 -- (-2938.854) (-2944.469) (-2946.089) [-2940.621] * (-2941.594) [-2939.118] (-2937.636) (-2944.877) -- 0:01:08 Average standard deviation of split frequencies: 0.002568 550500 -- (-2945.443) (-2937.251) (-2942.716) [-2932.933] * (-2941.432) [-2936.022] (-2939.347) (-2937.930) -- 0:01:08 551000 -- (-2938.932) (-2936.473) (-2943.563) [-2939.502] * (-2936.886) (-2937.541) (-2944.019) [-2937.763] -- 0:01:08 551500 -- [-2940.642] (-2941.468) (-2943.567) (-2945.452) * (-2942.318) (-2940.057) (-2944.349) [-2935.972] -- 0:01:08 552000 -- (-2943.566) [-2939.038] (-2945.034) (-2942.218) * [-2941.164] (-2938.922) (-2948.818) (-2938.057) -- 0:01:08 552500 -- (-2945.342) [-2935.242] (-2942.129) (-2938.080) * (-2935.321) (-2940.627) (-2938.785) [-2939.854] -- 0:01:08 553000 -- [-2936.698] (-2935.775) (-2942.442) (-2949.798) * (-2942.108) (-2941.349) [-2938.719] (-2950.199) -- 0:01:08 553500 -- [-2938.547] (-2946.016) (-2946.944) (-2932.849) * (-2937.904) (-2945.567) [-2940.164] (-2941.935) -- 0:01:08 554000 -- [-2937.042] (-2942.110) (-2938.960) (-2938.547) * (-2948.034) (-2940.185) [-2936.734] (-2941.699) -- 0:01:08 554500 -- (-2946.260) [-2936.072] (-2937.262) (-2938.366) * (-2937.389) (-2936.941) [-2945.591] (-2938.733) -- 0:01:08 555000 -- (-2946.296) [-2946.891] (-2939.717) (-2938.020) * (-2947.408) (-2942.333) [-2939.630] (-2939.826) -- 0:01:08 Average standard deviation of split frequencies: 0.003391 555500 -- [-2947.573] (-2940.233) (-2938.135) (-2942.987) * (-2935.722) [-2935.738] (-2939.555) (-2936.466) -- 0:01:08 556000 -- [-2937.672] (-2941.309) (-2936.247) (-2944.766) * (-2934.970) [-2936.466] (-2936.349) (-2943.494) -- 0:01:07 556500 -- (-2943.436) [-2938.248] (-2942.278) (-2943.303) * (-2942.634) [-2940.862] (-2941.934) (-2936.757) -- 0:01:07 557000 -- (-2940.292) [-2942.270] (-2936.079) (-2942.041) * [-2937.727] (-2940.955) (-2941.771) (-2942.646) -- 0:01:07 557500 -- (-2940.067) (-2936.867) [-2943.771] (-2941.695) * (-2940.894) (-2940.268) (-2939.104) [-2942.125] -- 0:01:07 558000 -- (-2936.604) (-2939.529) [-2939.843] (-2946.674) * [-2938.562] (-2942.021) (-2939.220) (-2939.549) -- 0:01:07 558500 -- (-2938.709) [-2945.026] (-2940.896) (-2940.525) * [-2939.296] (-2945.764) (-2939.895) (-2940.856) -- 0:01:07 559000 -- [-2941.069] (-2935.590) (-2944.764) (-2939.354) * (-2938.532) [-2941.420] (-2935.334) (-2943.516) -- 0:01:07 559500 -- [-2939.939] (-2946.251) (-2940.677) (-2937.541) * (-2937.666) (-2938.246) [-2937.908] (-2937.957) -- 0:01:07 560000 -- (-2939.831) [-2941.601] (-2943.328) (-2940.350) * [-2939.738] (-2936.535) (-2938.283) (-2940.076) -- 0:01:07 Average standard deviation of split frequencies: 0.003363 560500 -- (-2941.100) [-2940.275] (-2939.858) (-2942.616) * (-2936.704) (-2939.730) [-2936.342] (-2937.100) -- 0:01:07 561000 -- (-2937.391) [-2944.615] (-2942.623) (-2944.758) * (-2940.850) (-2950.803) (-2933.937) [-2939.803] -- 0:01:07 561500 -- (-2937.991) (-2938.771) (-2940.423) [-2938.062] * (-2941.629) [-2942.004] (-2944.867) (-2938.585) -- 0:01:07 562000 -- (-2942.774) (-2947.193) (-2944.599) [-2940.070] * (-2948.873) [-2937.607] (-2939.798) (-2937.295) -- 0:01:07 562500 -- (-2936.943) (-2934.417) (-2942.083) [-2937.709] * (-2941.484) [-2935.570] (-2935.401) (-2946.628) -- 0:01:06 563000 -- (-2939.870) (-2938.686) [-2934.894] (-2945.479) * (-2938.591) (-2941.511) [-2938.262] (-2944.923) -- 0:01:06 563500 -- (-2942.294) (-2935.263) [-2942.982] (-2945.563) * (-2931.109) (-2939.300) [-2936.980] (-2933.808) -- 0:01:06 564000 -- [-2942.526] (-2939.783) (-2943.081) (-2940.465) * [-2938.084] (-2942.324) (-2938.930) (-2935.073) -- 0:01:06 564500 -- (-2939.932) (-2936.456) [-2941.326] (-2936.665) * (-2934.885) (-2942.441) [-2938.900] (-2935.851) -- 0:01:06 565000 -- (-2938.734) (-2943.539) [-2936.328] (-2938.987) * (-2938.807) [-2939.923] (-2937.179) (-2945.375) -- 0:01:06 Average standard deviation of split frequencies: 0.002499 565500 -- (-2938.200) (-2947.479) [-2943.034] (-2940.858) * (-2942.332) (-2943.721) (-2943.148) [-2947.366] -- 0:01:06 566000 -- (-2940.368) [-2943.978] (-2935.756) (-2941.377) * (-2941.771) [-2946.406] (-2944.470) (-2935.811) -- 0:01:06 566500 -- [-2939.280] (-2936.387) (-2938.890) (-2936.927) * [-2938.706] (-2941.553) (-2940.797) (-2942.845) -- 0:01:06 567000 -- (-2944.672) (-2940.516) [-2946.411] (-2933.843) * (-2939.495) (-2939.338) [-2937.109] (-2937.828) -- 0:01:06 567500 -- (-2943.331) [-2941.277] (-2946.632) (-2937.102) * (-2950.045) [-2936.073] (-2942.220) (-2936.864) -- 0:01:06 568000 -- (-2938.306) (-2946.583) (-2942.760) [-2934.725] * [-2949.915] (-2937.596) (-2942.622) (-2936.048) -- 0:01:06 568500 -- (-2939.090) [-2939.736] (-2938.170) (-2945.389) * (-2945.471) [-2938.840] (-2942.876) (-2936.356) -- 0:01:06 569000 -- (-2939.921) (-2938.711) (-2940.437) [-2939.389] * [-2935.893] (-2936.494) (-2935.700) (-2935.687) -- 0:01:05 569500 -- (-2940.928) [-2940.257] (-2935.562) (-2944.775) * (-2945.721) [-2942.842] (-2950.237) (-2944.067) -- 0:01:05 570000 -- (-2938.157) (-2940.088) (-2941.987) [-2939.800] * [-2938.576] (-2939.311) (-2946.733) (-2940.782) -- 0:01:05 Average standard deviation of split frequencies: 0.002478 570500 -- (-2941.005) (-2939.505) [-2944.888] (-2938.746) * [-2938.038] (-2934.355) (-2944.808) (-2939.221) -- 0:01:05 571000 -- (-2940.494) [-2938.467] (-2934.777) (-2943.397) * (-2938.457) (-2941.804) (-2941.532) [-2937.021] -- 0:01:05 571500 -- (-2937.393) [-2938.887] (-2936.666) (-2947.388) * (-2936.619) [-2938.983] (-2938.587) (-2935.452) -- 0:01:05 572000 -- [-2940.833] (-2939.969) (-2932.960) (-2944.632) * [-2936.581] (-2944.857) (-2935.682) (-2939.863) -- 0:01:05 572500 -- (-2945.740) [-2940.722] (-2935.493) (-2942.425) * (-2938.065) (-2939.914) (-2946.037) [-2943.553] -- 0:01:05 573000 -- (-2942.535) (-2937.071) (-2940.069) [-2943.083] * (-2944.403) (-2943.424) (-2940.938) [-2934.612] -- 0:01:05 573500 -- (-2940.487) (-2936.800) [-2935.630] (-2936.106) * (-2935.710) (-2936.452) [-2933.967] (-2933.768) -- 0:01:05 574000 -- [-2936.520] (-2939.218) (-2936.777) (-2944.672) * (-2941.445) (-2939.588) [-2933.762] (-2938.462) -- 0:01:05 574500 -- [-2940.029] (-2936.014) (-2939.225) (-2937.837) * [-2939.273] (-2938.055) (-2939.484) (-2940.914) -- 0:01:05 575000 -- (-2939.053) (-2941.576) [-2940.125] (-2943.143) * (-2944.049) (-2937.203) (-2948.987) [-2939.004] -- 0:01:05 Average standard deviation of split frequencies: 0.002455 575500 -- (-2937.358) [-2940.318] (-2941.171) (-2941.625) * (-2935.898) [-2939.037] (-2940.705) (-2942.589) -- 0:01:04 576000 -- (-2941.514) (-2937.568) (-2950.162) [-2938.869] * [-2942.067] (-2945.157) (-2939.202) (-2942.182) -- 0:01:04 576500 -- [-2939.775] (-2937.861) (-2938.850) (-2934.835) * (-2939.446) [-2937.325] (-2942.242) (-2944.896) -- 0:01:04 577000 -- (-2939.634) [-2943.358] (-2943.524) (-2939.807) * (-2939.060) (-2948.760) (-2946.303) [-2935.978] -- 0:01:04 577500 -- (-2938.516) (-2941.410) (-2942.409) [-2941.019] * [-2943.097] (-2945.847) (-2944.646) (-2937.566) -- 0:01:04 578000 -- (-2949.247) (-2945.626) (-2935.266) [-2942.197] * (-2942.843) (-2934.455) [-2937.935] (-2939.114) -- 0:01:04 578500 -- (-2943.037) (-2938.849) (-2937.867) [-2939.923] * [-2938.836] (-2942.895) (-2933.198) (-2951.050) -- 0:01:04 579000 -- (-2945.297) (-2943.351) [-2935.164] (-2938.825) * (-2938.313) (-2935.213) (-2942.875) [-2937.126] -- 0:01:04 579500 -- [-2937.421] (-2932.697) (-2939.905) (-2933.677) * (-2933.907) (-2940.051) (-2938.055) [-2941.302] -- 0:01:04 580000 -- (-2936.989) [-2935.473] (-2941.650) (-2937.454) * (-2937.969) (-2939.266) (-2940.671) [-2940.496] -- 0:01:04 Average standard deviation of split frequencies: 0.003247 580500 -- (-2938.400) [-2935.031] (-2941.443) (-2939.496) * [-2934.055] (-2942.949) (-2936.221) (-2943.084) -- 0:01:04 581000 -- [-2938.261] (-2936.318) (-2939.494) (-2945.481) * (-2935.733) (-2945.607) [-2936.886] (-2947.201) -- 0:01:04 581500 -- [-2938.130] (-2939.986) (-2934.378) (-2942.096) * (-2940.450) (-2936.915) [-2941.470] (-2940.498) -- 0:01:04 582000 -- (-2939.593) (-2937.750) [-2934.864] (-2943.118) * (-2948.630) [-2936.038] (-2937.896) (-2937.557) -- 0:01:03 582500 -- (-2945.225) (-2938.398) (-2943.151) [-2934.177] * (-2945.773) [-2940.393] (-2943.807) (-2938.875) -- 0:01:03 583000 -- (-2939.494) (-2946.833) (-2950.914) [-2939.936] * (-2941.878) (-2935.688) (-2944.696) [-2935.640] -- 0:01:03 583500 -- (-2940.743) (-2941.170) (-2942.207) [-2941.731] * (-2939.675) (-2938.946) (-2939.272) [-2938.592] -- 0:01:03 584000 -- (-2941.952) (-2937.827) (-2942.573) [-2937.280] * (-2941.953) (-2935.844) (-2939.015) [-2938.459] -- 0:01:03 584500 -- (-2937.198) (-2941.304) (-2947.233) [-2940.148] * (-2937.814) (-2936.247) [-2941.505] (-2939.334) -- 0:01:03 585000 -- (-2941.000) (-2944.266) [-2937.913] (-2935.160) * (-2938.630) [-2937.738] (-2941.833) (-2938.644) -- 0:01:03 Average standard deviation of split frequencies: 0.003218 585500 -- (-2936.423) (-2937.389) [-2939.440] (-2937.101) * [-2935.461] (-2941.180) (-2939.210) (-2939.807) -- 0:01:03 586000 -- (-2943.726) (-2948.325) [-2939.066] (-2937.857) * (-2936.815) (-2939.981) [-2941.339] (-2936.332) -- 0:01:03 586500 -- (-2943.984) [-2939.911] (-2941.246) (-2944.721) * (-2941.150) [-2948.158] (-2944.553) (-2933.106) -- 0:01:03 587000 -- (-2940.255) (-2940.978) [-2937.508] (-2948.463) * [-2939.753] (-2940.984) (-2941.982) (-2943.148) -- 0:01:03 587500 -- [-2938.717] (-2937.737) (-2938.006) (-2953.237) * (-2943.587) (-2935.385) (-2946.062) [-2941.517] -- 0:01:03 588000 -- [-2947.183] (-2938.688) (-2943.092) (-2942.499) * (-2944.268) (-2937.110) (-2940.184) [-2947.967] -- 0:01:03 588500 -- [-2940.533] (-2943.754) (-2941.889) (-2939.187) * (-2936.243) [-2939.569] (-2940.365) (-2936.022) -- 0:01:02 589000 -- (-2937.667) (-2940.586) [-2937.470] (-2942.173) * [-2936.851] (-2944.079) (-2941.626) (-2939.227) -- 0:01:02 589500 -- (-2939.768) (-2936.684) [-2939.933] (-2937.406) * (-2940.396) (-2943.281) [-2939.187] (-2939.687) -- 0:01:02 590000 -- [-2942.170] (-2945.333) (-2950.775) (-2939.578) * (-2937.003) (-2938.734) (-2943.901) [-2939.705] -- 0:01:02 Average standard deviation of split frequencies: 0.003192 590500 -- (-2939.954) (-2939.162) [-2939.499] (-2941.854) * (-2948.796) (-2935.699) [-2938.564] (-2941.407) -- 0:01:02 591000 -- [-2937.439] (-2945.819) (-2937.407) (-2938.986) * (-2945.961) (-2939.555) (-2940.879) [-2945.939] -- 0:01:02 591500 -- [-2940.591] (-2939.507) (-2944.973) (-2936.059) * (-2939.752) (-2942.440) (-2941.908) [-2941.668] -- 0:01:02 592000 -- (-2940.064) [-2936.148] (-2949.192) (-2942.648) * [-2939.884] (-2942.318) (-2936.260) (-2936.723) -- 0:01:02 592500 -- (-2935.678) [-2941.055] (-2945.875) (-2936.253) * (-2934.143) (-2943.188) [-2939.702] (-2944.733) -- 0:01:02 593000 -- (-2947.200) (-2939.402) (-2946.497) [-2940.151] * [-2939.391] (-2936.655) (-2941.106) (-2950.819) -- 0:01:02 593500 -- (-2949.756) [-2936.586] (-2948.895) (-2940.035) * (-2943.958) [-2942.362] (-2941.973) (-2943.071) -- 0:01:02 594000 -- (-2945.161) (-2941.229) (-2947.495) [-2937.530] * (-2939.661) (-2941.199) (-2938.849) [-2940.038] -- 0:01:02 594500 -- (-2945.621) (-2939.436) [-2939.907] (-2938.566) * (-2936.302) (-2942.697) (-2937.711) [-2936.864] -- 0:01:02 595000 -- (-2941.083) (-2941.068) [-2935.703] (-2947.540) * [-2935.437] (-2946.213) (-2938.752) (-2936.907) -- 0:01:01 Average standard deviation of split frequencies: 0.003164 595500 -- (-2935.091) [-2934.699] (-2940.167) (-2938.879) * (-2942.766) (-2936.348) (-2935.301) [-2941.826] -- 0:01:01 596000 -- (-2938.062) (-2943.267) (-2938.304) [-2943.441] * [-2940.823] (-2936.499) (-2938.193) (-2939.132) -- 0:01:01 596500 -- (-2948.770) (-2940.704) [-2939.856] (-2937.665) * (-2938.875) (-2941.416) [-2933.775] (-2940.963) -- 0:01:01 597000 -- (-2944.857) (-2940.759) [-2942.486] (-2938.911) * (-2945.861) [-2945.301] (-2944.870) (-2943.039) -- 0:01:01 597500 -- [-2935.328] (-2941.084) (-2945.350) (-2932.726) * (-2945.493) (-2942.377) [-2940.633] (-2935.854) -- 0:01:01 598000 -- (-2935.811) (-2945.884) (-2943.935) [-2938.973] * (-2939.358) (-2944.668) (-2945.166) [-2936.769] -- 0:01:01 598500 -- (-2943.323) (-2941.999) [-2936.979] (-2937.246) * [-2937.817] (-2942.057) (-2944.934) (-2939.502) -- 0:01:01 599000 -- [-2941.343] (-2934.522) (-2935.327) (-2935.696) * (-2940.246) (-2941.867) (-2935.317) [-2935.737] -- 0:01:01 599500 -- (-2940.112) [-2938.726] (-2940.266) (-2945.559) * (-2939.436) [-2940.142] (-2937.010) (-2940.632) -- 0:01:01 600000 -- (-2938.646) [-2938.651] (-2940.545) (-2939.065) * (-2937.870) [-2942.223] (-2939.813) (-2944.148) -- 0:01:01 Average standard deviation of split frequencies: 0.003924 600500 -- [-2936.651] (-2940.599) (-2946.338) (-2940.714) * (-2940.070) (-2938.531) (-2947.359) [-2937.218] -- 0:01:01 601000 -- [-2939.606] (-2939.516) (-2939.008) (-2942.382) * (-2938.692) (-2941.431) [-2944.489] (-2938.866) -- 0:01:01 601500 -- [-2941.998] (-2942.751) (-2947.092) (-2944.257) * (-2942.374) (-2939.343) (-2945.806) [-2944.648] -- 0:01:00 602000 -- (-2935.165) (-2939.319) (-2937.758) [-2942.432] * (-2942.675) (-2939.329) (-2936.361) [-2934.825] -- 0:01:00 602500 -- [-2936.560] (-2937.479) (-2947.347) (-2940.969) * (-2943.116) [-2942.400] (-2937.477) (-2938.221) -- 0:01:00 603000 -- (-2938.612) (-2948.059) [-2940.987] (-2944.340) * (-2941.106) [-2935.286] (-2937.584) (-2936.819) -- 0:01:00 603500 -- (-2938.294) (-2936.715) [-2938.326] (-2946.975) * [-2942.152] (-2944.835) (-2942.094) (-2940.815) -- 0:01:00 604000 -- (-2937.915) (-2935.308) (-2936.482) [-2938.979] * [-2944.453] (-2941.938) (-2941.814) (-2939.321) -- 0:01:00 604500 -- (-2945.974) [-2937.957] (-2938.389) (-2938.379) * (-2942.946) (-2943.932) (-2938.047) [-2939.081] -- 0:01:00 605000 -- (-2944.315) (-2943.118) [-2942.055] (-2939.304) * (-2937.509) (-2940.221) (-2943.301) [-2942.063] -- 0:01:00 Average standard deviation of split frequencies: 0.005445 605500 -- [-2938.275] (-2938.304) (-2949.083) (-2941.737) * (-2954.141) [-2940.607] (-2947.085) (-2937.081) -- 0:01:00 606000 -- (-2938.159) [-2942.438] (-2943.961) (-2939.212) * (-2939.727) [-2940.644] (-2940.673) (-2939.790) -- 0:01:00 606500 -- [-2940.109] (-2940.873) (-2941.744) (-2937.521) * (-2941.414) (-2945.288) (-2937.963) [-2941.482] -- 0:01:00 607000 -- (-2947.691) (-2946.495) (-2946.493) [-2933.653] * (-2953.661) (-2939.887) (-2942.743) [-2936.568] -- 0:01:00 607500 -- (-2943.099) (-2937.966) [-2938.429] (-2935.862) * (-2935.682) (-2945.192) [-2934.441] (-2941.585) -- 0:01:00 608000 -- (-2945.597) (-2944.153) [-2934.698] (-2938.062) * [-2942.188] (-2941.707) (-2931.797) (-2947.094) -- 0:00:59 608500 -- (-2958.509) (-2935.864) (-2934.005) [-2946.567] * (-2934.596) (-2940.570) (-2945.418) [-2942.995] -- 0:00:59 609000 -- [-2938.411] (-2940.120) (-2937.850) (-2943.125) * [-2941.634] (-2935.942) (-2936.144) (-2937.214) -- 0:00:59 609500 -- (-2937.311) [-2936.968] (-2935.830) (-2938.309) * (-2942.842) (-2937.457) [-2938.826] (-2938.701) -- 0:00:59 610000 -- (-2939.017) (-2944.034) [-2934.615] (-2936.398) * (-2941.748) (-2936.624) [-2937.380] (-2941.634) -- 0:00:59 Average standard deviation of split frequencies: 0.006176 610500 -- [-2936.751] (-2939.644) (-2937.758) (-2938.691) * [-2935.593] (-2944.150) (-2942.523) (-2939.461) -- 0:00:59 611000 -- (-2934.716) (-2937.448) [-2939.715] (-2948.458) * [-2943.457] (-2938.481) (-2939.864) (-2933.595) -- 0:00:59 611500 -- (-2943.578) (-2937.153) (-2943.068) [-2939.918] * (-2940.422) (-2943.048) [-2943.282] (-2945.682) -- 0:00:59 612000 -- [-2936.168] (-2939.320) (-2940.322) (-2943.852) * (-2936.724) [-2943.914] (-2945.005) (-2944.360) -- 0:00:59 612500 -- (-2946.412) [-2938.964] (-2944.802) (-2940.233) * (-2946.530) (-2945.260) (-2945.444) [-2934.888] -- 0:00:59 613000 -- (-2936.678) [-2942.928] (-2942.426) (-2935.626) * (-2943.338) (-2936.049) (-2944.149) [-2942.784] -- 0:00:59 613500 -- (-2935.567) (-2948.160) (-2937.938) [-2936.561] * (-2940.011) [-2933.181] (-2943.826) (-2936.862) -- 0:00:59 614000 -- (-2942.507) (-2943.515) [-2934.951] (-2937.329) * (-2934.641) (-2943.757) [-2939.455] (-2940.418) -- 0:00:59 614500 -- (-2943.478) (-2949.235) [-2936.900] (-2950.786) * (-2938.921) [-2940.348] (-2938.159) (-2939.690) -- 0:00:58 615000 -- (-2938.324) (-2942.313) [-2934.353] (-2941.661) * [-2940.507] (-2943.611) (-2942.972) (-2941.519) -- 0:00:58 Average standard deviation of split frequencies: 0.006887 615500 -- (-2942.391) (-2940.497) [-2936.911] (-2942.190) * (-2938.672) [-2942.334] (-2944.597) (-2940.929) -- 0:00:58 616000 -- (-2941.598) (-2937.342) [-2936.487] (-2940.298) * (-2945.992) [-2934.173] (-2940.433) (-2938.053) -- 0:00:58 616500 -- (-2942.896) [-2940.960] (-2936.940) (-2940.365) * (-2935.140) (-2945.375) [-2937.431] (-2938.710) -- 0:00:58 617000 -- (-2941.912) (-2937.327) (-2939.891) [-2937.450] * (-2940.883) (-2938.240) [-2938.697] (-2941.365) -- 0:00:58 617500 -- (-2937.081) [-2939.464] (-2938.783) (-2941.208) * (-2941.512) [-2935.885] (-2940.123) (-2945.280) -- 0:00:58 618000 -- (-2940.855) [-2950.499] (-2938.145) (-2944.947) * [-2937.758] (-2935.575) (-2934.228) (-2947.392) -- 0:00:58 618500 -- (-2939.906) [-2937.875] (-2937.669) (-2936.672) * (-2937.588) (-2939.314) [-2934.494] (-2941.662) -- 0:00:58 619000 -- (-2938.109) (-2942.989) [-2938.046] (-2939.286) * (-2942.935) (-2940.425) (-2942.012) [-2937.112] -- 0:00:58 619500 -- (-2941.763) (-2947.978) [-2938.179] (-2940.235) * (-2940.242) (-2941.824) [-2940.043] (-2945.030) -- 0:00:58 620000 -- (-2940.469) [-2948.432] (-2943.465) (-2940.422) * (-2941.062) (-2938.326) [-2938.484] (-2933.710) -- 0:00:58 Average standard deviation of split frequencies: 0.006836 620500 -- (-2940.683) (-2943.270) [-2935.331] (-2940.954) * [-2941.605] (-2945.209) (-2941.197) (-2936.595) -- 0:00:58 621000 -- (-2937.225) (-2949.547) (-2936.466) [-2941.420] * (-2944.498) [-2938.109] (-2937.292) (-2939.062) -- 0:00:57 621500 -- (-2943.247) (-2942.098) (-2939.109) [-2943.413] * (-2950.342) (-2945.675) (-2936.229) [-2940.869] -- 0:00:57 622000 -- (-2936.084) (-2939.902) [-2937.151] (-2934.329) * (-2944.365) (-2939.349) (-2937.474) [-2945.066] -- 0:00:57 622500 -- (-2945.246) [-2933.120] (-2938.020) (-2943.152) * (-2936.696) [-2936.290] (-2942.630) (-2937.979) -- 0:00:57 623000 -- [-2939.062] (-2937.943) (-2946.103) (-2941.379) * (-2952.744) [-2936.312] (-2942.047) (-2939.835) -- 0:00:57 623500 -- (-2933.843) (-2941.783) [-2937.882] (-2948.358) * (-2942.947) [-2940.258] (-2936.063) (-2938.217) -- 0:00:57 624000 -- (-2938.888) [-2937.226] (-2941.407) (-2943.776) * (-2942.578) (-2948.681) (-2943.596) [-2935.269] -- 0:00:57 624500 -- (-2942.869) [-2933.170] (-2945.915) (-2943.828) * (-2944.870) (-2942.339) (-2937.480) [-2936.514] -- 0:00:57 625000 -- [-2932.106] (-2934.380) (-2948.069) (-2944.835) * (-2936.748) (-2942.199) (-2938.554) [-2937.180] -- 0:00:57 Average standard deviation of split frequencies: 0.006777 625500 -- (-2936.247) (-2938.219) (-2942.880) [-2941.492] * (-2944.867) (-2940.535) (-2937.234) [-2938.900] -- 0:00:57 626000 -- (-2935.240) [-2940.332] (-2936.280) (-2942.172) * (-2939.999) (-2945.077) [-2937.413] (-2938.162) -- 0:00:57 626500 -- (-2941.570) (-2944.558) (-2933.121) [-2936.878] * (-2936.879) [-2940.017] (-2939.277) (-2936.383) -- 0:00:57 627000 -- (-2935.467) (-2939.945) (-2936.660) [-2939.551] * (-2947.255) (-2938.025) (-2945.011) [-2942.972] -- 0:00:57 627500 -- (-2935.948) [-2939.802] (-2938.879) (-2942.600) * (-2942.317) (-2939.526) (-2937.800) [-2941.547] -- 0:00:56 628000 -- (-2935.290) [-2937.039] (-2941.462) (-2940.328) * (-2938.784) (-2939.288) (-2937.182) [-2942.315] -- 0:00:56 628500 -- (-2938.659) [-2942.010] (-2939.118) (-2945.628) * (-2939.567) [-2947.227] (-2945.056) (-2936.630) -- 0:00:56 629000 -- (-2940.987) [-2940.486] (-2936.134) (-2949.005) * [-2941.623] (-2951.551) (-2938.843) (-2939.486) -- 0:00:56 629500 -- (-2935.787) (-2937.627) [-2942.400] (-2942.624) * [-2935.535] (-2943.315) (-2939.275) (-2948.694) -- 0:00:56 630000 -- (-2940.725) [-2938.158] (-2943.074) (-2946.446) * [-2936.473] (-2942.947) (-2942.459) (-2934.597) -- 0:00:56 Average standard deviation of split frequencies: 0.006727 630500 -- [-2935.274] (-2948.707) (-2942.936) (-2950.331) * [-2939.115] (-2940.501) (-2944.008) (-2938.303) -- 0:00:56 631000 -- (-2941.452) [-2935.327] (-2940.260) (-2937.643) * [-2939.547] (-2948.009) (-2936.131) (-2935.277) -- 0:00:56 631500 -- (-2944.539) (-2937.604) (-2939.803) [-2940.142] * (-2937.695) (-2946.694) [-2947.374] (-2946.508) -- 0:00:56 632000 -- [-2935.347] (-2936.812) (-2941.601) (-2938.938) * (-2939.706) [-2946.922] (-2943.675) (-2937.226) -- 0:00:56 632500 -- (-2944.607) [-2937.337] (-2941.618) (-2940.647) * (-2940.384) (-2943.266) [-2942.741] (-2944.816) -- 0:00:56 633000 -- (-2945.650) [-2934.094] (-2938.967) (-2939.134) * [-2935.595] (-2937.192) (-2935.761) (-2938.068) -- 0:00:56 633500 -- (-2937.052) (-2939.074) [-2940.291] (-2943.787) * (-2937.189) (-2939.612) (-2935.857) [-2938.202] -- 0:00:56 634000 -- (-2939.092) (-2939.308) (-2942.884) [-2947.093] * [-2942.478] (-2938.215) (-2955.290) (-2941.183) -- 0:00:55 634500 -- (-2941.459) [-2939.416] (-2939.978) (-2942.678) * (-2937.868) (-2944.081) [-2941.779] (-2945.420) -- 0:00:55 635000 -- (-2941.684) (-2941.098) (-2934.730) [-2938.986] * (-2938.966) (-2935.267) (-2947.414) [-2937.568] -- 0:00:55 Average standard deviation of split frequencies: 0.005930 635500 -- (-2937.198) [-2945.882] (-2946.669) (-2942.501) * [-2941.455] (-2937.479) (-2947.219) (-2935.457) -- 0:00:55 636000 -- (-2937.016) (-2939.323) (-2942.255) [-2936.930] * (-2938.789) (-2939.992) (-2940.779) [-2935.242] -- 0:00:55 636500 -- (-2936.473) (-2937.492) [-2942.435] (-2940.133) * (-2940.392) (-2941.343) (-2936.898) [-2938.263] -- 0:00:55 637000 -- (-2941.225) (-2938.002) (-2938.151) [-2944.913] * [-2939.563] (-2937.933) (-2944.534) (-2934.638) -- 0:00:55 637500 -- (-2945.929) (-2943.622) (-2942.383) [-2939.557] * (-2946.369) (-2943.099) [-2938.458] (-2946.275) -- 0:00:55 638000 -- (-2936.702) (-2940.736) (-2938.558) [-2937.138] * (-2935.637) [-2937.994] (-2943.690) (-2938.558) -- 0:00:55 638500 -- (-2942.076) (-2939.538) [-2936.842] (-2941.538) * [-2937.727] (-2937.364) (-2940.343) (-2936.981) -- 0:00:55 639000 -- (-2941.750) [-2941.578] (-2936.579) (-2943.827) * [-2942.152] (-2938.720) (-2936.509) (-2939.522) -- 0:00:55 639500 -- (-2937.814) (-2942.938) [-2941.504] (-2946.231) * (-2938.515) [-2943.367] (-2940.283) (-2939.453) -- 0:00:55 640000 -- [-2944.825] (-2940.165) (-2941.452) (-2940.018) * (-2937.795) (-2941.396) (-2943.680) [-2939.764] -- 0:00:55 Average standard deviation of split frequencies: 0.005886 640500 -- (-2937.737) (-2939.240) (-2938.247) [-2937.408] * (-2940.180) (-2944.012) [-2936.188] (-2938.337) -- 0:00:55 641000 -- (-2940.998) (-2935.076) [-2939.127] (-2940.278) * (-2944.279) [-2938.675] (-2944.526) (-2940.307) -- 0:00:54 641500 -- (-2933.028) (-2934.229) [-2938.491] (-2945.607) * (-2939.894) (-2940.542) [-2940.879] (-2939.431) -- 0:00:54 642000 -- (-2937.732) (-2947.554) [-2939.433] (-2947.006) * (-2938.185) [-2934.213] (-2939.176) (-2938.324) -- 0:00:54 642500 -- (-2946.752) (-2936.403) (-2946.036) [-2937.278] * (-2941.720) (-2936.299) [-2937.197] (-2948.389) -- 0:00:54 643000 -- (-2947.252) (-2938.541) (-2940.938) [-2938.843] * (-2938.811) (-2936.365) [-2936.444] (-2942.093) -- 0:00:54 643500 -- (-2939.572) [-2933.530] (-2943.598) (-2941.184) * (-2938.768) (-2944.190) (-2940.056) [-2934.424] -- 0:00:54 644000 -- (-2939.346) [-2940.545] (-2944.496) (-2942.453) * (-2938.660) (-2936.125) (-2936.414) [-2939.557] -- 0:00:54 644500 -- (-2936.518) (-2945.015) [-2940.246] (-2942.704) * (-2941.524) (-2938.499) [-2939.581] (-2946.734) -- 0:00:54 645000 -- (-2943.515) [-2939.303] (-2936.839) (-2942.896) * (-2940.640) (-2936.696) (-2944.213) [-2945.581] -- 0:00:54 Average standard deviation of split frequencies: 0.007297 645500 -- (-2937.520) [-2937.708] (-2935.589) (-2938.248) * (-2939.347) [-2937.365] (-2937.692) (-2944.572) -- 0:00:54 646000 -- (-2936.359) (-2941.505) [-2937.939] (-2943.725) * (-2937.873) (-2935.638) [-2941.464] (-2934.719) -- 0:00:54 646500 -- [-2935.596] (-2941.021) (-2939.735) (-2938.670) * [-2940.766] (-2941.466) (-2935.331) (-2944.538) -- 0:00:54 647000 -- (-2938.840) (-2935.456) (-2944.149) [-2934.221] * (-2945.020) (-2934.566) (-2941.095) [-2940.279] -- 0:00:54 647500 -- [-2950.955] (-2938.050) (-2940.403) (-2935.318) * (-2937.215) (-2943.881) (-2936.858) [-2939.731] -- 0:00:53 648000 -- (-2941.525) (-2942.258) [-2934.044] (-2936.281) * (-2935.837) (-2945.467) (-2942.490) [-2938.511] -- 0:00:53 648500 -- (-2934.800) (-2936.314) [-2936.755] (-2939.149) * (-2941.068) (-2938.248) (-2951.636) [-2939.363] -- 0:00:53 649000 -- (-2939.489) [-2934.959] (-2942.648) (-2944.338) * (-2940.032) [-2942.926] (-2946.330) (-2936.342) -- 0:00:53 649500 -- [-2939.887] (-2934.944) (-2939.403) (-2942.392) * [-2941.767] (-2939.856) (-2947.479) (-2940.486) -- 0:00:53 650000 -- (-2942.117) (-2938.664) [-2941.429] (-2934.781) * [-2939.116] (-2940.245) (-2939.329) (-2936.333) -- 0:00:53 Average standard deviation of split frequencies: 0.008694 650500 -- (-2947.137) (-2936.996) [-2935.411] (-2941.348) * [-2942.346] (-2938.171) (-2945.573) (-2943.649) -- 0:00:53 651000 -- (-2941.290) (-2932.761) [-2937.118] (-2942.263) * (-2943.512) (-2934.316) [-2936.349] (-2948.876) -- 0:00:53 651500 -- (-2938.354) [-2934.296] (-2934.769) (-2938.672) * (-2938.365) [-2937.110] (-2943.273) (-2937.355) -- 0:00:53 652000 -- (-2940.565) [-2939.445] (-2940.289) (-2939.177) * (-2936.851) [-2940.731] (-2940.447) (-2938.614) -- 0:00:53 652500 -- [-2938.329] (-2939.938) (-2938.872) (-2949.359) * (-2937.284) (-2943.159) [-2939.301] (-2938.595) -- 0:00:53 653000 -- (-2937.436) (-2937.970) (-2944.300) [-2935.824] * (-2937.892) [-2936.002] (-2940.968) (-2952.869) -- 0:00:53 653500 -- (-2937.043) [-2936.884] (-2938.305) (-2942.755) * (-2937.264) (-2940.598) (-2941.175) [-2940.304] -- 0:00:53 654000 -- (-2943.860) (-2936.404) [-2938.741] (-2939.136) * [-2944.208] (-2940.655) (-2941.140) (-2932.729) -- 0:00:52 654500 -- (-2942.284) (-2934.764) [-2935.561] (-2938.519) * (-2934.867) (-2938.913) (-2939.964) [-2947.191] -- 0:00:52 655000 -- (-2936.876) (-2935.105) [-2939.157] (-2949.554) * [-2939.335] (-2941.436) (-2937.079) (-2940.583) -- 0:00:52 Average standard deviation of split frequencies: 0.008623 655500 -- (-2937.909) (-2937.772) [-2934.860] (-2935.375) * (-2937.703) [-2936.983] (-2941.248) (-2939.088) -- 0:00:52 656000 -- (-2938.171) [-2937.616] (-2939.299) (-2940.024) * (-2938.384) (-2937.022) (-2939.921) [-2936.157] -- 0:00:52 656500 -- (-2938.632) [-2942.760] (-2941.342) (-2941.519) * (-2943.197) [-2937.518] (-2939.024) (-2937.033) -- 0:00:52 657000 -- (-2943.114) (-2941.901) [-2939.941] (-2934.374) * (-2948.623) (-2942.562) [-2947.310] (-2938.608) -- 0:00:52 657500 -- [-2937.658] (-2944.051) (-2939.980) (-2933.699) * (-2937.735) [-2935.587] (-2934.269) (-2939.814) -- 0:00:52 658000 -- [-2940.480] (-2946.342) (-2937.491) (-2937.343) * [-2938.822] (-2938.784) (-2943.789) (-2936.278) -- 0:00:52 658500 -- (-2937.274) (-2940.811) (-2945.067) [-2935.369] * (-2937.184) (-2943.003) [-2937.993] (-2943.029) -- 0:00:52 659000 -- [-2942.936] (-2943.483) (-2952.274) (-2941.173) * [-2933.454] (-2937.938) (-2942.231) (-2937.238) -- 0:00:52 659500 -- (-2935.920) (-2951.556) [-2947.854] (-2938.179) * (-2940.957) (-2945.223) (-2937.340) [-2936.956] -- 0:00:52 660000 -- (-2936.094) (-2943.492) (-2948.780) [-2941.571] * [-2937.029] (-2949.093) (-2946.386) (-2941.964) -- 0:00:52 Average standard deviation of split frequencies: 0.008562 660500 -- (-2935.680) (-2937.766) [-2939.002] (-2935.393) * (-2938.469) (-2945.201) (-2942.721) [-2941.688] -- 0:00:51 661000 -- (-2936.498) [-2933.254] (-2935.871) (-2934.274) * (-2938.381) [-2945.475] (-2942.782) (-2937.394) -- 0:00:51 661500 -- (-2938.347) (-2948.442) [-2933.998] (-2937.335) * (-2940.979) [-2935.502] (-2934.855) (-2939.725) -- 0:00:51 662000 -- (-2945.313) (-2937.758) [-2934.903] (-2938.519) * (-2941.581) (-2941.551) [-2935.170] (-2941.679) -- 0:00:51 662500 -- (-2940.085) (-2940.339) (-2937.913) [-2940.117] * (-2945.816) (-2940.180) [-2943.362] (-2940.706) -- 0:00:51 663000 -- (-2939.863) [-2935.388] (-2946.890) (-2944.992) * (-2944.524) (-2956.447) [-2943.054] (-2938.351) -- 0:00:51 663500 -- (-2937.856) (-2939.688) [-2937.903] (-2945.146) * (-2945.163) (-2939.997) (-2937.820) [-2943.285] -- 0:00:51 664000 -- [-2944.277] (-2941.145) (-2942.033) (-2939.770) * [-2937.752] (-2938.234) (-2935.939) (-2941.210) -- 0:00:51 664500 -- (-2939.030) [-2933.666] (-2937.255) (-2939.873) * [-2945.656] (-2945.600) (-2940.201) (-2939.745) -- 0:00:51 665000 -- (-2941.497) (-2939.133) (-2941.448) [-2942.096] * (-2936.460) [-2943.961] (-2947.330) (-2937.856) -- 0:00:51 Average standard deviation of split frequencies: 0.008494 665500 -- (-2936.469) [-2938.685] (-2944.382) (-2937.518) * [-2937.959] (-2938.887) (-2941.527) (-2940.544) -- 0:00:51 666000 -- (-2938.581) (-2948.754) (-2944.251) [-2941.685] * (-2938.626) (-2942.435) (-2940.262) [-2937.136] -- 0:00:51 666500 -- (-2938.941) (-2935.944) (-2946.260) [-2938.050] * (-2940.683) [-2941.135] (-2939.590) (-2939.663) -- 0:00:51 667000 -- (-2948.250) (-2948.088) (-2941.538) [-2944.320] * (-2935.497) (-2939.075) (-2943.139) [-2939.392] -- 0:00:50 667500 -- [-2935.546] (-2941.288) (-2939.044) (-2937.116) * (-2937.587) (-2945.404) (-2939.202) [-2937.641] -- 0:00:50 668000 -- (-2939.913) (-2942.957) (-2936.169) [-2938.240] * (-2937.699) (-2938.729) [-2939.389] (-2942.667) -- 0:00:50 668500 -- [-2934.981] (-2945.927) (-2936.666) (-2941.774) * (-2939.272) (-2940.810) [-2941.863] (-2941.375) -- 0:00:50 669000 -- (-2935.412) (-2942.211) (-2940.285) [-2933.947] * (-2937.570) (-2940.658) [-2939.841] (-2942.601) -- 0:00:50 669500 -- (-2939.387) (-2936.545) (-2938.689) [-2941.583] * (-2937.111) (-2936.753) [-2936.423] (-2942.636) -- 0:00:50 670000 -- (-2939.651) (-2940.613) (-2938.655) [-2936.629] * (-2940.258) (-2939.434) (-2949.330) [-2938.986] -- 0:00:50 Average standard deviation of split frequencies: 0.009138 670500 -- [-2942.037] (-2936.636) (-2936.180) (-2942.538) * [-2940.212] (-2940.967) (-2942.187) (-2936.615) -- 0:00:50 671000 -- (-2940.593) (-2941.013) [-2941.355] (-2938.400) * (-2934.625) [-2941.635] (-2939.465) (-2936.099) -- 0:00:50 671500 -- (-2940.367) [-2934.824] (-2941.049) (-2943.766) * (-2939.654) [-2936.915] (-2936.413) (-2944.037) -- 0:00:50 672000 -- [-2943.451] (-2944.482) (-2936.567) (-2938.878) * (-2941.023) [-2938.817] (-2937.504) (-2940.555) -- 0:00:50 672500 -- (-2943.334) (-2937.752) [-2944.499] (-2944.167) * (-2945.434) (-2934.952) [-2938.308] (-2940.839) -- 0:00:50 673000 -- (-2943.787) [-2941.092] (-2941.259) (-2938.564) * (-2938.885) (-2937.431) (-2935.909) [-2936.598] -- 0:00:50 673500 -- (-2947.122) [-2944.848] (-2937.435) (-2942.089) * (-2939.370) (-2939.509) [-2937.288] (-2940.850) -- 0:00:49 674000 -- (-2942.777) (-2937.935) [-2937.777] (-2939.344) * (-2951.528) [-2937.961] (-2942.263) (-2937.660) -- 0:00:49 674500 -- [-2936.488] (-2940.095) (-2939.838) (-2938.879) * (-2949.264) (-2946.185) (-2935.479) [-2937.309] -- 0:00:49 675000 -- (-2942.150) (-2944.997) [-2935.068] (-2941.172) * (-2943.908) (-2944.162) [-2937.833] (-2946.134) -- 0:00:49 Average standard deviation of split frequencies: 0.009065 675500 -- (-2935.346) (-2944.338) [-2944.179] (-2939.190) * (-2941.172) (-2941.342) [-2940.782] (-2936.665) -- 0:00:49 676000 -- (-2937.132) (-2940.020) (-2941.909) [-2939.837] * (-2951.441) (-2944.438) (-2940.746) [-2935.123] -- 0:00:49 676500 -- (-2936.344) [-2937.708] (-2940.950) (-2937.164) * (-2945.001) (-2942.508) [-2942.267] (-2933.402) -- 0:00:49 677000 -- (-2946.141) [-2936.588] (-2944.914) (-2938.758) * [-2942.423] (-2954.683) (-2943.329) (-2939.195) -- 0:00:49 677500 -- (-2944.599) [-2932.475] (-2937.898) (-2938.868) * (-2935.697) (-2942.679) (-2935.489) [-2939.707] -- 0:00:49 678000 -- (-2943.308) (-2940.303) [-2937.612] (-2938.329) * (-2940.618) [-2939.601] (-2948.340) (-2936.215) -- 0:00:49 678500 -- (-2939.333) [-2939.715] (-2936.663) (-2954.014) * (-2940.587) (-2940.740) (-2945.333) [-2936.765] -- 0:00:49 679000 -- (-2937.116) [-2939.174] (-2935.701) (-2938.990) * (-2938.555) (-2939.319) (-2947.869) [-2943.005] -- 0:00:49 679500 -- (-2939.646) (-2939.783) [-2938.203] (-2942.055) * (-2941.407) (-2944.193) [-2940.347] (-2933.775) -- 0:00:49 680000 -- (-2937.975) (-2939.171) [-2938.531] (-2937.525) * (-2940.470) [-2942.012] (-2937.885) (-2940.265) -- 0:00:48 Average standard deviation of split frequencies: 0.009003 680500 -- [-2936.168] (-2945.119) (-2941.048) (-2940.963) * (-2943.871) [-2940.175] (-2942.420) (-2947.557) -- 0:00:48 681000 -- (-2944.396) (-2943.199) [-2935.373] (-2936.289) * [-2940.123] (-2939.998) (-2937.595) (-2947.448) -- 0:00:48 681500 -- [-2939.791] (-2945.151) (-2941.290) (-2936.584) * (-2941.455) (-2945.553) (-2935.745) [-2939.591] -- 0:00:48 682000 -- (-2940.545) [-2940.158] (-2937.610) (-2935.375) * [-2940.283] (-2935.436) (-2943.358) (-2937.055) -- 0:00:48 682500 -- (-2936.423) (-2944.587) (-2945.186) [-2938.660] * [-2938.320] (-2955.082) (-2940.476) (-2939.110) -- 0:00:48 683000 -- [-2941.409] (-2951.880) (-2942.907) (-2939.055) * [-2940.238] (-2937.117) (-2949.679) (-2944.908) -- 0:00:48 683500 -- (-2940.178) (-2938.378) [-2941.193] (-2940.446) * (-2941.921) [-2939.606] (-2945.410) (-2941.424) -- 0:00:48 684000 -- (-2938.297) (-2939.411) [-2939.817] (-2942.221) * (-2942.154) (-2936.517) [-2940.709] (-2939.610) -- 0:00:48 684500 -- (-2936.155) (-2946.948) [-2940.845] (-2934.681) * [-2940.907] (-2938.709) (-2936.236) (-2942.398) -- 0:00:48 685000 -- [-2937.972] (-2937.153) (-2940.546) (-2936.166) * (-2944.225) (-2939.871) (-2935.681) [-2941.055] -- 0:00:48 Average standard deviation of split frequencies: 0.008933 685500 -- [-2942.591] (-2940.024) (-2939.825) (-2943.374) * (-2939.735) (-2944.970) [-2936.666] (-2940.744) -- 0:00:48 686000 -- [-2940.952] (-2937.402) (-2945.148) (-2939.385) * (-2940.721) (-2948.726) (-2943.078) [-2946.172] -- 0:00:48 686500 -- (-2942.691) (-2938.660) [-2936.668] (-2943.139) * (-2939.483) [-2942.036] (-2935.645) (-2939.816) -- 0:00:47 687000 -- [-2936.976] (-2937.312) (-2936.574) (-2941.099) * (-2937.875) [-2941.334] (-2946.964) (-2947.237) -- 0:00:47 687500 -- [-2940.764] (-2941.359) (-2944.165) (-2938.755) * (-2938.415) [-2938.404] (-2940.072) (-2938.403) -- 0:00:47 688000 -- (-2940.191) [-2939.984] (-2937.733) (-2941.305) * [-2938.288] (-2941.592) (-2938.687) (-2937.163) -- 0:00:47 688500 -- (-2946.217) (-2941.079) (-2940.655) [-2937.426] * [-2945.787] (-2938.432) (-2937.707) (-2949.361) -- 0:00:47 689000 -- (-2944.892) (-2940.627) (-2939.906) [-2937.787] * (-2943.056) (-2942.805) (-2942.503) [-2941.320] -- 0:00:47 689500 -- (-2941.040) [-2937.928] (-2944.001) (-2940.938) * [-2931.986] (-2941.563) (-2941.127) (-2937.907) -- 0:00:47 690000 -- (-2939.988) [-2944.123] (-2945.711) (-2935.348) * (-2938.283) (-2942.175) [-2938.519] (-2937.205) -- 0:00:47 Average standard deviation of split frequencies: 0.008873 690500 -- (-2937.656) (-2939.259) [-2937.208] (-2936.506) * (-2936.237) (-2941.143) (-2939.999) [-2938.940] -- 0:00:47 691000 -- (-2936.328) (-2938.057) [-2941.280] (-2939.433) * (-2941.122) (-2941.477) (-2943.221) [-2940.183] -- 0:00:47 691500 -- (-2932.747) (-2938.186) (-2937.421) [-2940.878] * [-2940.175] (-2942.275) (-2941.383) (-2947.995) -- 0:00:47 692000 -- (-2940.118) (-2939.282) (-2939.455) [-2939.828] * [-2940.102] (-2935.885) (-2937.903) (-2942.218) -- 0:00:47 692500 -- (-2939.154) (-2943.440) (-2937.557) [-2937.744] * (-2943.211) (-2942.543) (-2940.364) [-2942.941] -- 0:00:47 693000 -- (-2938.613) [-2940.416] (-2941.780) (-2939.618) * [-2946.091] (-2940.372) (-2936.403) (-2937.864) -- 0:00:46 693500 -- (-2943.918) [-2936.651] (-2941.846) (-2940.206) * [-2935.545] (-2936.663) (-2941.721) (-2938.739) -- 0:00:46 694000 -- (-2952.755) (-2942.025) [-2946.057] (-2947.141) * (-2940.205) (-2940.694) (-2943.474) [-2944.261] -- 0:00:46 694500 -- [-2938.362] (-2940.452) (-2938.574) (-2941.684) * [-2937.518] (-2933.651) (-2938.190) (-2937.235) -- 0:00:46 695000 -- [-2938.020] (-2940.458) (-2948.599) (-2935.594) * [-2934.597] (-2939.917) (-2942.949) (-2939.775) -- 0:00:46 Average standard deviation of split frequencies: 0.010160 695500 -- (-2936.501) (-2944.678) [-2937.795] (-2936.879) * (-2940.383) [-2943.795] (-2945.969) (-2947.174) -- 0:00:46 696000 -- (-2940.068) [-2944.210] (-2942.257) (-2937.924) * (-2944.553) (-2944.400) [-2936.810] (-2945.846) -- 0:00:46 696500 -- (-2937.199) (-2943.321) [-2937.781] (-2937.607) * [-2938.880] (-2938.213) (-2934.462) (-2958.210) -- 0:00:46 697000 -- (-2936.806) (-2944.358) [-2940.917] (-2938.460) * (-2939.267) (-2941.506) [-2936.322] (-2950.811) -- 0:00:46 697500 -- (-2940.690) (-2943.696) (-2939.397) [-2939.040] * [-2934.202] (-2940.489) (-2936.874) (-2942.424) -- 0:00:46 698000 -- (-2943.227) (-2942.118) (-2933.172) [-2937.619] * [-2940.933] (-2941.232) (-2937.379) (-2949.739) -- 0:00:46 698500 -- (-2945.521) (-2940.408) [-2934.871] (-2939.259) * (-2945.687) [-2941.075] (-2940.861) (-2940.519) -- 0:00:46 699000 -- (-2949.703) [-2943.945] (-2938.444) (-2943.760) * (-2942.682) (-2936.402) [-2942.657] (-2940.372) -- 0:00:46 699500 -- (-2938.283) (-2942.143) [-2939.084] (-2940.266) * (-2943.625) (-2942.044) [-2939.422] (-2937.733) -- 0:00:45 700000 -- [-2946.637] (-2944.479) (-2940.678) (-2937.753) * (-2938.635) (-2941.110) (-2936.788) [-2934.501] -- 0:00:45 Average standard deviation of split frequencies: 0.010092 700500 -- (-2940.157) (-2936.793) [-2939.815] (-2939.250) * [-2940.006] (-2940.419) (-2941.068) (-2936.498) -- 0:00:45 701000 -- (-2940.146) (-2940.971) [-2938.495] (-2939.428) * (-2937.671) (-2942.193) (-2946.231) [-2936.814] -- 0:00:45 701500 -- [-2932.688] (-2936.423) (-2933.327) (-2936.616) * [-2937.353] (-2938.265) (-2936.888) (-2938.366) -- 0:00:45 702000 -- (-2934.289) (-2936.120) [-2938.522] (-2936.593) * (-2935.774) (-2938.508) [-2940.278] (-2936.371) -- 0:00:45 702500 -- (-2940.196) [-2936.765] (-2936.908) (-2938.426) * [-2934.076] (-2938.945) (-2939.940) (-2939.055) -- 0:00:45 703000 -- (-2935.555) (-2937.796) (-2937.844) [-2942.457] * [-2935.735] (-2939.027) (-2935.344) (-2942.638) -- 0:00:45 703500 -- [-2933.985] (-2941.307) (-2939.057) (-2940.480) * (-2936.234) [-2940.056] (-2940.524) (-2942.294) -- 0:00:45 704000 -- [-2940.763] (-2938.440) (-2935.501) (-2940.167) * (-2941.505) (-2937.702) [-2948.029] (-2939.031) -- 0:00:45 704500 -- [-2944.636] (-2940.290) (-2942.670) (-2941.035) * [-2944.216] (-2942.554) (-2938.424) (-2941.750) -- 0:00:45 705000 -- [-2941.206] (-2936.893) (-2940.306) (-2948.118) * (-2939.163) (-2937.559) [-2937.124] (-2941.707) -- 0:00:45 Average standard deviation of split frequencies: 0.010683 705500 -- (-2944.932) [-2939.359] (-2945.641) (-2938.183) * (-2942.416) [-2940.194] (-2937.560) (-2950.629) -- 0:00:45 706000 -- (-2939.170) (-2933.713) [-2932.200] (-2949.712) * [-2943.555] (-2941.617) (-2938.664) (-2939.914) -- 0:00:44 706500 -- (-2947.376) (-2942.291) [-2938.873] (-2940.026) * (-2937.814) (-2933.992) (-2940.640) [-2941.645] -- 0:00:44 707000 -- [-2948.168] (-2940.668) (-2939.192) (-2939.116) * [-2939.959] (-2935.623) (-2948.807) (-2940.017) -- 0:00:44 707500 -- (-2942.232) (-2951.553) (-2939.202) [-2939.337] * (-2941.161) (-2940.264) [-2939.654] (-2937.645) -- 0:00:44 708000 -- [-2939.226] (-2938.140) (-2942.602) (-2937.623) * (-2940.359) (-2938.162) (-2939.911) [-2938.003] -- 0:00:44 708500 -- (-2938.297) [-2933.392] (-2942.671) (-2938.618) * (-2933.894) (-2939.983) (-2940.005) [-2939.500] -- 0:00:44 709000 -- (-2938.548) (-2936.143) (-2943.927) [-2935.957] * (-2939.388) [-2937.343] (-2939.634) (-2934.834) -- 0:00:44 709500 -- (-2947.052) (-2937.201) [-2947.823] (-2941.840) * (-2937.842) (-2940.572) (-2940.959) [-2940.541] -- 0:00:44 710000 -- (-2938.258) [-2935.375] (-2937.650) (-2937.234) * [-2940.031] (-2941.919) (-2944.666) (-2936.801) -- 0:00:44 Average standard deviation of split frequencies: 0.009950 710500 -- (-2936.106) (-2941.473) [-2936.533] (-2940.067) * [-2941.090] (-2938.377) (-2937.522) (-2940.003) -- 0:00:44 711000 -- [-2937.281] (-2937.071) (-2937.727) (-2940.934) * (-2939.372) (-2942.582) (-2941.457) [-2935.481] -- 0:00:44 711500 -- (-2938.508) (-2935.924) [-2938.010] (-2935.716) * [-2936.745] (-2938.551) (-2938.729) (-2939.428) -- 0:00:44 712000 -- [-2936.903] (-2938.745) (-2938.046) (-2943.630) * (-2938.295) [-2939.643] (-2936.469) (-2941.495) -- 0:00:44 712500 -- [-2937.486] (-2947.419) (-2942.184) (-2937.957) * (-2936.462) (-2940.917) [-2935.832] (-2946.178) -- 0:00:43 713000 -- (-2938.767) (-2941.942) [-2934.231] (-2945.245) * (-2958.467) (-2942.670) [-2944.681] (-2939.172) -- 0:00:43 713500 -- (-2939.448) (-2934.208) (-2936.234) [-2940.468] * [-2936.389] (-2941.256) (-2943.372) (-2938.471) -- 0:00:43 714000 -- (-2942.167) (-2944.845) (-2936.294) [-2936.833] * (-2943.376) [-2940.201] (-2940.804) (-2945.146) -- 0:00:43 714500 -- (-2944.408) (-2942.132) [-2941.116] (-2933.619) * (-2938.976) [-2935.799] (-2940.834) (-2940.420) -- 0:00:43 715000 -- (-2939.993) (-2934.435) [-2934.888] (-2936.551) * (-2941.212) [-2936.559] (-2943.067) (-2935.808) -- 0:00:43 Average standard deviation of split frequencies: 0.009217 715500 -- [-2936.874] (-2937.512) (-2935.867) (-2942.111) * (-2945.096) (-2940.809) (-2935.346) [-2937.340] -- 0:00:43 716000 -- (-2942.324) [-2940.862] (-2945.052) (-2938.161) * [-2942.631] (-2940.804) (-2943.110) (-2935.149) -- 0:00:43 716500 -- (-2936.527) (-2943.906) [-2939.787] (-2935.784) * (-2939.934) (-2945.242) [-2935.890] (-2941.772) -- 0:00:43 717000 -- (-2938.637) (-2943.484) (-2935.266) [-2939.682] * (-2941.675) [-2938.245] (-2939.016) (-2944.313) -- 0:00:43 717500 -- (-2945.768) (-2944.436) [-2938.809] (-2940.101) * (-2936.305) (-2940.962) (-2936.916) [-2943.523] -- 0:00:43 718000 -- (-2941.182) (-2944.540) (-2939.320) [-2947.405] * (-2939.704) (-2939.450) (-2947.701) [-2934.265] -- 0:00:43 718500 -- (-2938.564) (-2943.115) [-2945.507] (-2941.847) * (-2936.168) (-2938.528) (-2944.826) [-2937.611] -- 0:00:43 719000 -- (-2938.077) [-2937.499] (-2944.466) (-2944.695) * [-2935.610] (-2941.860) (-2940.134) (-2942.120) -- 0:00:42 719500 -- (-2944.559) (-2939.838) (-2946.038) [-2940.618] * (-2944.589) (-2937.451) [-2941.078] (-2938.082) -- 0:00:42 720000 -- [-2940.877] (-2941.866) (-2939.157) (-2944.405) * [-2938.578] (-2936.601) (-2936.331) (-2935.600) -- 0:00:42 Average standard deviation of split frequencies: 0.009158 720500 -- (-2935.990) (-2942.334) (-2938.249) [-2933.978] * (-2936.607) (-2935.256) (-2940.611) [-2940.519] -- 0:00:42 721000 -- (-2936.295) (-2955.720) (-2939.360) [-2935.146] * (-2939.134) (-2938.365) (-2943.585) [-2938.704] -- 0:00:42 721500 -- (-2937.716) (-2947.074) [-2937.882] (-2935.695) * [-2936.487] (-2938.519) (-2946.058) (-2937.061) -- 0:00:42 722000 -- (-2942.772) (-2939.260) (-2941.371) [-2939.473] * (-2941.543) [-2934.917] (-2943.579) (-2942.813) -- 0:00:42 722500 -- [-2941.580] (-2942.315) (-2943.309) (-2947.493) * (-2939.081) [-2938.842] (-2935.013) (-2940.022) -- 0:00:42 723000 -- [-2933.748] (-2935.987) (-2942.747) (-2940.304) * (-2934.562) (-2941.416) (-2935.332) [-2936.748] -- 0:00:42 723500 -- [-2934.784] (-2944.790) (-2938.277) (-2937.856) * (-2942.225) (-2940.695) (-2943.260) [-2940.903] -- 0:00:42 724000 -- [-2941.004] (-2941.452) (-2946.661) (-2936.672) * (-2941.905) (-2937.834) (-2937.106) [-2934.227] -- 0:00:42 724500 -- (-2939.677) [-2941.849] (-2949.451) (-2944.684) * (-2943.588) (-2939.257) [-2937.449] (-2939.131) -- 0:00:42 725000 -- (-2937.053) [-2941.030] (-2935.931) (-2943.096) * [-2939.016] (-2951.593) (-2942.180) (-2945.777) -- 0:00:42 Average standard deviation of split frequencies: 0.006493 725500 -- (-2939.020) (-2939.519) [-2942.021] (-2941.304) * (-2939.009) [-2943.945] (-2945.060) (-2935.885) -- 0:00:41 726000 -- (-2938.916) (-2941.423) (-2947.464) [-2939.281] * [-2938.652] (-2938.355) (-2939.598) (-2938.210) -- 0:00:41 726500 -- (-2945.942) [-2943.065] (-2940.762) (-2943.339) * (-2934.122) (-2944.472) (-2943.268) [-2937.229] -- 0:00:41 727000 -- (-2937.321) [-2936.968] (-2938.568) (-2941.493) * (-2943.063) (-2937.586) (-2942.251) [-2936.947] -- 0:00:41 727500 -- (-2939.597) [-2938.462] (-2941.252) (-2936.073) * (-2940.180) (-2941.027) [-2939.684] (-2935.995) -- 0:00:41 728000 -- (-2935.946) (-2935.327) (-2939.747) [-2941.530] * (-2942.051) [-2939.132] (-2940.736) (-2933.395) -- 0:00:41 728500 -- [-2939.373] (-2939.319) (-2935.966) (-2941.032) * (-2940.529) (-2942.392) (-2952.311) [-2938.133] -- 0:00:41 729000 -- [-2945.776] (-2942.305) (-2946.218) (-2943.500) * (-2942.290) (-2940.191) [-2937.609] (-2941.757) -- 0:00:41 729500 -- (-2941.954) (-2936.167) [-2935.316] (-2940.932) * (-2944.934) (-2944.654) (-2940.017) [-2943.058] -- 0:00:41 730000 -- [-2937.395] (-2942.231) (-2934.176) (-2936.946) * (-2941.112) [-2934.419] (-2939.798) (-2952.389) -- 0:00:41 Average standard deviation of split frequencies: 0.007097 730500 -- (-2939.757) (-2936.892) (-2941.278) [-2943.216] * (-2938.464) (-2946.844) [-2940.893] (-2941.644) -- 0:00:41 731000 -- (-2944.432) (-2938.837) [-2939.238] (-2940.151) * [-2935.527] (-2942.922) (-2942.585) (-2946.999) -- 0:00:41 731500 -- (-2951.792) [-2939.297] (-2940.674) (-2942.019) * [-2941.082] (-2935.167) (-2937.864) (-2947.798) -- 0:00:41 732000 -- (-2943.730) (-2937.215) [-2940.925] (-2946.710) * [-2934.512] (-2941.020) (-2937.786) (-2936.539) -- 0:00:41 732500 -- [-2943.182] (-2940.684) (-2940.041) (-2936.971) * (-2937.018) [-2939.003] (-2939.724) (-2941.894) -- 0:00:40 733000 -- (-2940.327) [-2934.601] (-2936.109) (-2939.795) * (-2939.494) (-2943.392) [-2942.268] (-2947.797) -- 0:00:40 733500 -- (-2945.150) (-2932.810) (-2935.784) [-2939.948] * (-2940.638) (-2941.671) [-2934.711] (-2944.531) -- 0:00:40 734000 -- [-2940.995] (-2938.285) (-2937.276) (-2943.907) * (-2938.370) [-2935.993] (-2937.860) (-2935.797) -- 0:00:40 734500 -- (-2939.465) [-2938.885] (-2940.299) (-2942.015) * (-2938.328) (-2938.295) [-2939.135] (-2945.414) -- 0:00:40 735000 -- (-2935.868) (-2940.288) [-2939.356] (-2940.549) * (-2949.932) [-2937.053] (-2936.173) (-2936.087) -- 0:00:40 Average standard deviation of split frequencies: 0.007045 735500 -- [-2935.383] (-2933.320) (-2941.251) (-2938.276) * (-2942.159) (-2946.027) (-2936.833) [-2942.881] -- 0:00:40 736000 -- [-2933.939] (-2940.931) (-2937.104) (-2937.198) * [-2940.735] (-2937.116) (-2943.464) (-2940.601) -- 0:00:40 736500 -- [-2938.049] (-2937.070) (-2943.090) (-2944.627) * (-2932.182) [-2939.032] (-2944.544) (-2941.872) -- 0:00:40 737000 -- (-2939.835) [-2943.240] (-2939.801) (-2938.142) * (-2943.045) (-2937.223) [-2946.869] (-2941.947) -- 0:00:40 737500 -- (-2944.917) [-2936.976] (-2938.866) (-2933.635) * (-2950.378) (-2942.647) [-2939.577] (-2944.337) -- 0:00:40 738000 -- (-2938.760) (-2941.404) (-2936.883) [-2937.625] * (-2935.561) (-2944.553) (-2946.024) [-2935.304] -- 0:00:40 738500 -- [-2941.651] (-2935.059) (-2938.783) (-2945.722) * [-2938.031] (-2936.561) (-2939.587) (-2934.917) -- 0:00:40 739000 -- [-2944.724] (-2936.561) (-2942.958) (-2938.538) * (-2941.164) (-2945.240) [-2941.103] (-2936.824) -- 0:00:39 739500 -- (-2945.005) (-2936.507) (-2939.223) [-2933.595] * (-2936.833) (-2939.383) [-2942.052] (-2936.786) -- 0:00:39 740000 -- (-2948.550) (-2938.803) (-2944.985) [-2941.157] * (-2946.478) [-2945.386] (-2941.987) (-2937.387) -- 0:00:39 Average standard deviation of split frequencies: 0.007638 740500 -- [-2941.997] (-2949.879) (-2940.065) (-2938.957) * (-2943.137) (-2944.264) (-2943.486) [-2933.452] -- 0:00:39 741000 -- (-2939.186) (-2944.771) (-2940.483) [-2938.848] * [-2937.019] (-2939.660) (-2937.435) (-2942.979) -- 0:00:39 741500 -- (-2945.833) [-2940.095] (-2937.957) (-2935.601) * (-2940.548) (-2940.265) (-2935.140) [-2936.758] -- 0:00:39 742000 -- (-2940.278) [-2943.186] (-2944.091) (-2935.396) * [-2938.443] (-2948.388) (-2945.290) (-2945.525) -- 0:00:39 742500 -- (-2938.161) (-2942.216) (-2936.315) [-2937.159] * (-2935.487) [-2940.444] (-2938.729) (-2941.711) -- 0:00:39 743000 -- (-2947.006) (-2940.372) [-2938.343] (-2939.879) * (-2941.202) (-2938.907) [-2943.109] (-2939.234) -- 0:00:39 743500 -- [-2937.640] (-2938.769) (-2936.632) (-2939.459) * (-2940.937) (-2941.876) [-2942.505] (-2937.535) -- 0:00:39 744000 -- (-2937.646) (-2937.666) [-2946.507] (-2941.035) * [-2946.340] (-2941.568) (-2933.721) (-2937.329) -- 0:00:39 744500 -- [-2938.280] (-2940.286) (-2939.704) (-2940.118) * [-2933.455] (-2936.854) (-2944.156) (-2939.871) -- 0:00:39 745000 -- (-2937.251) [-2939.793] (-2940.405) (-2936.170) * (-2941.708) (-2940.653) (-2943.015) [-2944.640] -- 0:00:39 Average standard deviation of split frequencies: 0.007583 745500 -- (-2941.495) (-2947.847) (-2942.161) [-2938.054] * (-2939.634) [-2940.108] (-2946.016) (-2935.782) -- 0:00:38 746000 -- (-2937.945) (-2937.880) [-2934.671] (-2941.776) * [-2934.396] (-2939.248) (-2941.855) (-2943.149) -- 0:00:38 746500 -- (-2942.025) [-2937.856] (-2939.141) (-2940.416) * (-2945.659) (-2940.392) [-2944.938] (-2935.177) -- 0:00:38 747000 -- (-2943.195) [-2936.959] (-2943.399) (-2935.549) * [-2942.125] (-2940.006) (-2947.104) (-2945.851) -- 0:00:38 747500 -- (-2943.791) [-2938.135] (-2941.882) (-2938.297) * [-2935.948] (-2941.213) (-2947.634) (-2934.384) -- 0:00:38 748000 -- (-2937.393) (-2939.143) (-2946.833) [-2937.038] * (-2935.044) (-2935.225) [-2942.406] (-2937.813) -- 0:00:38 748500 -- (-2938.180) (-2940.602) (-2936.915) [-2942.203] * (-2936.989) (-2936.546) [-2938.029] (-2937.788) -- 0:00:38 749000 -- (-2935.545) [-2936.896] (-2941.555) (-2942.735) * (-2935.883) (-2935.996) [-2940.379] (-2948.358) -- 0:00:38 749500 -- (-2935.560) (-2941.494) (-2939.301) [-2934.871] * (-2937.968) [-2937.212] (-2939.622) (-2942.746) -- 0:00:38 750000 -- (-2942.666) (-2940.486) [-2936.827] (-2935.550) * (-2942.446) (-2936.417) [-2936.477] (-2938.521) -- 0:00:38 Average standard deviation of split frequencies: 0.007536 750500 -- (-2935.899) (-2939.770) [-2937.058] (-2938.838) * (-2934.500) (-2937.100) [-2936.913] (-2939.300) -- 0:00:38 751000 -- (-2937.856) [-2943.697] (-2939.102) (-2951.258) * (-2941.800) (-2947.421) (-2936.433) [-2939.055] -- 0:00:38 751500 -- (-2936.436) [-2938.354] (-2938.835) (-2945.399) * [-2938.180] (-2936.064) (-2941.081) (-2940.929) -- 0:00:38 752000 -- (-2942.770) (-2935.734) (-2947.595) [-2940.253] * (-2936.119) (-2939.200) (-2943.187) [-2941.747] -- 0:00:37 752500 -- (-2939.808) (-2935.742) (-2943.003) [-2942.062] * (-2938.350) (-2944.156) [-2938.721] (-2938.345) -- 0:00:37 753000 -- (-2940.228) [-2936.592] (-2944.774) (-2937.645) * [-2939.171] (-2939.777) (-2950.082) (-2939.470) -- 0:00:37 753500 -- (-2938.883) (-2934.985) [-2939.551] (-2942.042) * (-2936.071) (-2942.125) [-2938.204] (-2947.521) -- 0:00:37 754000 -- (-2945.274) (-2937.853) [-2943.721] (-2955.885) * (-2939.414) (-2940.992) (-2943.890) [-2937.962] -- 0:00:37 754500 -- (-2943.295) (-2944.152) [-2941.426] (-2938.217) * (-2935.674) (-2940.329) (-2939.709) [-2942.617] -- 0:00:37 755000 -- (-2942.722) [-2940.073] (-2941.299) (-2938.713) * (-2938.995) (-2942.555) (-2935.411) [-2940.641] -- 0:00:37 Average standard deviation of split frequencies: 0.006859 755500 -- (-2938.672) (-2942.806) (-2938.445) [-2937.411] * (-2946.191) (-2939.867) [-2941.837] (-2940.077) -- 0:00:37 756000 -- [-2940.680] (-2938.057) (-2943.009) (-2942.416) * (-2942.261) (-2942.569) [-2939.836] (-2936.834) -- 0:00:37 756500 -- [-2939.184] (-2940.386) (-2943.783) (-2937.704) * (-2937.946) [-2944.993] (-2944.095) (-2942.146) -- 0:00:37 757000 -- (-2937.794) [-2940.073] (-2937.065) (-2951.012) * (-2942.400) (-2935.649) (-2938.478) [-2935.061] -- 0:00:37 757500 -- (-2938.779) [-2940.724] (-2945.990) (-2938.535) * (-2942.444) [-2938.493] (-2941.643) (-2937.982) -- 0:00:37 758000 -- (-2940.151) (-2934.663) [-2935.514] (-2939.083) * (-2937.351) (-2942.236) (-2936.085) [-2940.344] -- 0:00:37 758500 -- (-2944.213) (-2934.488) [-2937.168] (-2938.918) * (-2945.036) [-2939.893] (-2944.495) (-2936.142) -- 0:00:36 759000 -- (-2937.942) (-2943.693) (-2937.882) [-2940.230] * (-2951.006) (-2935.346) [-2943.324] (-2937.849) -- 0:00:36 759500 -- (-2937.033) (-2939.648) [-2938.526] (-2940.121) * [-2944.391] (-2945.904) (-2941.764) (-2941.844) -- 0:00:36 760000 -- (-2940.099) (-2944.406) [-2937.167] (-2939.138) * [-2936.322] (-2937.084) (-2937.207) (-2938.469) -- 0:00:36 Average standard deviation of split frequencies: 0.007437 760500 -- (-2942.495) (-2941.974) [-2936.616] (-2940.970) * (-2936.932) (-2939.890) [-2941.674] (-2941.375) -- 0:00:36 761000 -- (-2935.830) [-2937.354] (-2945.706) (-2940.233) * (-2940.815) [-2939.781] (-2930.839) (-2941.271) -- 0:00:36 761500 -- [-2947.020] (-2937.024) (-2937.926) (-2936.510) * (-2940.663) (-2944.326) (-2955.787) [-2943.151] -- 0:00:36 762000 -- (-2941.764) (-2945.695) [-2936.700] (-2939.020) * (-2942.022) [-2938.193] (-2941.999) (-2942.227) -- 0:00:36 762500 -- (-2940.939) [-2936.111] (-2936.165) (-2939.632) * (-2942.022) (-2950.844) (-2937.538) [-2934.679] -- 0:00:36 763000 -- (-2936.766) [-2946.075] (-2935.245) (-2948.717) * (-2936.190) (-2939.644) (-2939.358) [-2937.690] -- 0:00:36 763500 -- [-2933.774] (-2936.256) (-2942.484) (-2949.841) * (-2944.866) (-2938.835) (-2938.693) [-2945.823] -- 0:00:36 764000 -- (-2946.009) (-2941.338) (-2939.225) [-2941.998] * [-2936.296] (-2945.652) (-2935.316) (-2944.562) -- 0:00:36 764500 -- (-2939.042) (-2939.788) [-2936.819] (-2938.028) * (-2940.691) (-2938.748) [-2940.657] (-2947.472) -- 0:00:36 765000 -- (-2934.758) (-2936.434) [-2939.433] (-2947.078) * [-2945.564] (-2935.753) (-2946.496) (-2938.169) -- 0:00:35 Average standard deviation of split frequencies: 0.008616 765500 -- (-2939.381) (-2946.646) (-2936.045) [-2941.927] * (-2938.862) [-2936.418] (-2937.565) (-2942.893) -- 0:00:35 766000 -- [-2941.770] (-2944.625) (-2936.361) (-2944.039) * (-2943.476) (-2946.102) [-2938.379] (-2937.929) -- 0:00:35 766500 -- (-2938.369) (-2940.851) [-2933.493] (-2941.475) * [-2942.627] (-2938.498) (-2938.995) (-2936.328) -- 0:00:35 767000 -- (-2938.650) (-2938.651) (-2937.934) [-2934.866] * (-2940.290) [-2936.612] (-2944.832) (-2936.977) -- 0:00:35 767500 -- (-2935.391) (-2945.900) [-2935.530] (-2938.466) * (-2941.113) [-2936.309] (-2944.234) (-2939.800) -- 0:00:35 768000 -- (-2941.994) (-2945.317) [-2940.985] (-2939.982) * (-2940.212) [-2941.356] (-2940.381) (-2940.276) -- 0:00:35 768500 -- (-2941.656) [-2940.955] (-2945.729) (-2946.190) * (-2940.308) [-2938.696] (-2938.078) (-2939.686) -- 0:00:35 769000 -- (-2938.246) [-2940.431] (-2943.811) (-2939.456) * (-2938.284) (-2935.681) (-2944.289) [-2935.306] -- 0:00:35 769500 -- (-2933.945) (-2937.465) [-2938.414] (-2943.560) * [-2937.273] (-2949.327) (-2938.493) (-2941.143) -- 0:00:35 770000 -- (-2945.227) (-2937.666) [-2943.604] (-2942.822) * (-2942.071) [-2942.013] (-2947.953) (-2942.211) -- 0:00:35 Average standard deviation of split frequencies: 0.008564 770500 -- [-2938.618] (-2940.752) (-2945.065) (-2937.664) * (-2948.323) (-2951.506) (-2939.193) [-2936.930] -- 0:00:35 771000 -- (-2936.661) (-2941.992) (-2940.307) [-2940.739] * (-2939.968) (-2941.233) (-2945.074) [-2947.518] -- 0:00:35 771500 -- (-2944.485) [-2940.448] (-2943.467) (-2937.351) * [-2943.813] (-2942.439) (-2934.694) (-2939.399) -- 0:00:34 772000 -- (-2942.329) (-2942.943) (-2948.780) [-2939.699] * (-2937.172) (-2949.689) [-2937.707] (-2947.172) -- 0:00:34 772500 -- (-2946.602) (-2940.881) (-2940.308) [-2935.305] * (-2947.373) [-2939.284] (-2945.816) (-2947.177) -- 0:00:34 773000 -- [-2942.030] (-2946.399) (-2944.139) (-2942.772) * (-2939.184) [-2940.525] (-2936.677) (-2941.427) -- 0:00:34 773500 -- (-2945.008) (-2952.304) (-2938.631) [-2948.218] * [-2937.289] (-2943.349) (-2936.752) (-2940.395) -- 0:00:34 774000 -- (-2940.183) (-2941.215) (-2938.842) [-2942.125] * [-2942.042] (-2943.022) (-2939.701) (-2942.168) -- 0:00:34 774500 -- (-2937.916) (-2938.432) (-2934.827) [-2942.154] * [-2942.631] (-2940.882) (-2938.994) (-2939.919) -- 0:00:34 775000 -- (-2940.866) [-2934.551] (-2940.718) (-2942.603) * (-2943.939) [-2938.790] (-2940.585) (-2943.737) -- 0:00:34 Average standard deviation of split frequencies: 0.008505 775500 -- (-2941.920) (-2938.515) (-2943.836) [-2940.541] * (-2936.801) [-2946.241] (-2953.366) (-2940.901) -- 0:00:34 776000 -- (-2936.474) [-2940.200] (-2947.129) (-2940.640) * [-2941.323] (-2942.717) (-2941.809) (-2942.237) -- 0:00:34 776500 -- (-2935.775) [-2936.467] (-2945.587) (-2940.002) * (-2940.582) (-2937.218) (-2943.578) [-2937.846] -- 0:00:34 777000 -- (-2948.993) (-2939.389) (-2948.540) [-2942.541] * [-2943.063] (-2950.456) (-2940.278) (-2939.534) -- 0:00:34 777500 -- (-2941.129) [-2936.653] (-2937.845) (-2941.452) * [-2937.172] (-2939.533) (-2937.749) (-2948.049) -- 0:00:34 778000 -- (-2938.549) [-2945.421] (-2936.764) (-2950.589) * (-2943.595) [-2935.585] (-2937.506) (-2946.183) -- 0:00:33 778500 -- [-2937.114] (-2948.661) (-2936.227) (-2948.490) * (-2944.833) (-2938.748) (-2936.911) [-2939.817] -- 0:00:33 779000 -- (-2940.285) (-2940.633) (-2942.609) [-2934.804] * (-2937.096) (-2936.986) (-2937.125) [-2934.370] -- 0:00:33 779500 -- [-2944.584] (-2940.898) (-2939.833) (-2935.094) * (-2936.415) [-2942.061] (-2940.964) (-2943.231) -- 0:00:33 780000 -- (-2949.122) [-2936.221] (-2947.516) (-2938.121) * (-2937.926) [-2941.004] (-2939.766) (-2945.723) -- 0:00:33 Average standard deviation of split frequencies: 0.008454 780500 -- (-2936.623) (-2941.274) (-2942.400) [-2940.158] * [-2940.380] (-2949.714) (-2942.706) (-2940.688) -- 0:00:33 781000 -- (-2938.569) [-2942.669] (-2939.564) (-2935.953) * (-2948.991) (-2945.749) (-2937.548) [-2936.580] -- 0:00:33 781500 -- [-2936.903] (-2942.002) (-2937.078) (-2943.495) * [-2936.167] (-2939.518) (-2934.822) (-2937.519) -- 0:00:33 782000 -- (-2938.097) (-2934.629) (-2943.919) [-2939.901] * (-2936.470) (-2939.973) [-2941.598] (-2941.229) -- 0:00:33 782500 -- (-2938.895) (-2949.525) (-2943.170) [-2937.053] * (-2935.241) [-2943.443] (-2940.473) (-2937.603) -- 0:00:33 783000 -- (-2937.485) (-2946.585) (-2936.013) [-2946.330] * (-2940.947) [-2940.432] (-2944.486) (-2940.435) -- 0:00:33 783500 -- (-2939.802) (-2939.524) (-2952.328) [-2936.003] * [-2937.513] (-2946.177) (-2941.576) (-2939.411) -- 0:00:33 784000 -- (-2936.645) (-2942.609) (-2942.689) [-2943.083] * (-2937.529) [-2951.024] (-2941.104) (-2941.796) -- 0:00:33 784500 -- (-2938.313) [-2938.015] (-2947.488) (-2942.858) * [-2936.123] (-2940.212) (-2944.685) (-2934.354) -- 0:00:32 785000 -- [-2934.730] (-2934.660) (-2943.162) (-2950.921) * (-2937.084) [-2943.611] (-2938.139) (-2940.346) -- 0:00:32 Average standard deviation of split frequencies: 0.008996 785500 -- (-2937.297) (-2936.886) (-2948.153) [-2946.076] * (-2943.429) (-2942.370) [-2940.849] (-2942.567) -- 0:00:32 786000 -- (-2942.475) [-2942.184] (-2943.262) (-2942.047) * (-2937.608) [-2933.083] (-2935.947) (-2938.069) -- 0:00:32 786500 -- [-2937.691] (-2943.675) (-2939.245) (-2944.061) * (-2942.186) (-2940.823) (-2941.331) [-2938.784] -- 0:00:32 787000 -- (-2938.303) (-2942.221) [-2937.081] (-2941.389) * (-2944.324) (-2938.913) (-2943.952) [-2943.653] -- 0:00:32 787500 -- (-2946.922) (-2948.232) (-2942.348) [-2938.431] * (-2939.353) [-2938.782] (-2936.781) (-2938.939) -- 0:00:32 788000 -- (-2937.431) [-2934.134] (-2941.886) (-2940.681) * (-2934.967) (-2940.248) [-2940.439] (-2946.950) -- 0:00:32 788500 -- (-2936.928) (-2934.325) [-2938.353] (-2939.107) * (-2940.427) (-2941.130) [-2939.714] (-2939.746) -- 0:00:32 789000 -- (-2945.638) [-2941.399] (-2939.643) (-2937.665) * [-2941.311] (-2935.289) (-2945.671) (-2939.661) -- 0:00:32 789500 -- (-2939.168) (-2939.629) [-2939.865] (-2936.110) * (-2936.637) (-2944.207) [-2939.759] (-2944.370) -- 0:00:32 790000 -- (-2940.779) (-2943.858) [-2944.235] (-2938.077) * [-2938.058] (-2941.313) (-2938.877) (-2948.234) -- 0:00:32 Average standard deviation of split frequencies: 0.008943 790500 -- (-2942.771) (-2944.907) [-2939.446] (-2945.526) * (-2934.366) [-2941.863] (-2933.821) (-2939.013) -- 0:00:32 791000 -- (-2943.223) (-2944.528) [-2942.123] (-2937.976) * [-2934.749] (-2939.302) (-2937.641) (-2939.845) -- 0:00:31 791500 -- (-2935.533) (-2942.010) [-2935.614] (-2937.764) * (-2935.885) [-2938.969] (-2935.028) (-2944.964) -- 0:00:31 792000 -- (-2942.913) [-2934.798] (-2939.149) (-2933.487) * (-2939.895) (-2935.521) (-2942.798) [-2947.059] -- 0:00:31 792500 -- (-2938.956) (-2933.002) [-2934.744] (-2934.459) * (-2936.758) [-2935.446] (-2948.840) (-2945.007) -- 0:00:31 793000 -- (-2940.552) (-2937.712) (-2935.399) [-2936.048] * (-2938.934) (-2945.012) (-2946.845) [-2948.253] -- 0:00:31 793500 -- (-2943.880) (-2941.899) (-2941.135) [-2943.807] * [-2937.529] (-2950.516) (-2942.675) (-2943.293) -- 0:00:31 794000 -- (-2941.032) (-2946.349) (-2940.635) [-2934.918] * [-2939.382] (-2950.361) (-2943.247) (-2938.855) -- 0:00:31 794500 -- [-2936.751] (-2949.340) (-2937.280) (-2941.656) * (-2938.733) (-2948.768) (-2939.997) [-2936.658] -- 0:00:31 795000 -- (-2937.894) (-2940.795) [-2939.120] (-2938.546) * (-2943.399) [-2941.166] (-2939.680) (-2941.368) -- 0:00:31 Average standard deviation of split frequencies: 0.008883 795500 -- (-2937.423) (-2938.803) (-2942.110) [-2936.877] * [-2943.089] (-2935.795) (-2943.031) (-2940.870) -- 0:00:31 796000 -- (-2936.322) (-2939.674) (-2938.197) [-2940.311] * (-2938.963) (-2937.319) [-2937.912] (-2941.547) -- 0:00:31 796500 -- (-2940.326) (-2939.679) (-2941.736) [-2937.735] * (-2935.790) [-2938.759] (-2938.806) (-2939.543) -- 0:00:31 797000 -- [-2936.072] (-2937.491) (-2940.039) (-2935.960) * (-2939.586) [-2943.971] (-2940.129) (-2936.273) -- 0:00:31 797500 -- (-2939.275) (-2947.617) (-2937.194) [-2939.247] * [-2938.579] (-2937.757) (-2946.584) (-2939.468) -- 0:00:30 798000 -- (-2940.217) (-2946.169) [-2937.086] (-2946.391) * (-2942.483) (-2940.324) [-2939.203] (-2939.178) -- 0:00:30 798500 -- [-2939.724] (-2943.249) (-2937.322) (-2940.792) * (-2943.296) (-2943.440) [-2938.221] (-2944.824) -- 0:00:30 799000 -- (-2939.219) (-2951.290) (-2938.317) [-2936.838] * [-2942.317] (-2944.615) (-2941.867) (-2943.209) -- 0:00:30 799500 -- (-2946.692) (-2942.398) [-2936.797] (-2938.260) * (-2947.267) (-2953.057) [-2945.536] (-2945.699) -- 0:00:30 800000 -- (-2942.441) (-2938.946) [-2941.253] (-2936.900) * (-2940.845) [-2934.833] (-2942.868) (-2939.430) -- 0:00:30 Average standard deviation of split frequencies: 0.008831 800500 -- (-2940.404) [-2934.978] (-2938.475) (-2939.187) * (-2937.259) (-2933.878) [-2938.472] (-2940.053) -- 0:00:30 801000 -- [-2937.180] (-2947.551) (-2944.117) (-2938.073) * [-2936.958] (-2941.083) (-2938.129) (-2944.575) -- 0:00:30 801500 -- (-2938.299) (-2933.798) [-2936.209] (-2938.251) * (-2941.377) (-2945.583) (-2938.673) [-2939.576] -- 0:00:30 802000 -- (-2944.245) (-2943.848) (-2943.570) [-2933.882] * (-2939.725) (-2950.827) (-2937.160) [-2937.545] -- 0:00:30 802500 -- (-2944.203) [-2939.248] (-2935.355) (-2940.868) * (-2943.976) (-2944.949) (-2937.049) [-2942.560] -- 0:00:30 803000 -- (-2939.676) [-2938.985] (-2945.900) (-2937.459) * (-2943.349) (-2935.841) (-2936.374) [-2947.317] -- 0:00:30 803500 -- (-2939.181) [-2936.091] (-2940.257) (-2938.456) * (-2940.118) [-2933.011] (-2943.198) (-2942.778) -- 0:00:30 804000 -- (-2941.200) [-2943.874] (-2940.911) (-2941.934) * [-2943.346] (-2947.168) (-2938.323) (-2942.658) -- 0:00:29 804500 -- [-2941.233] (-2939.612) (-2936.824) (-2941.554) * (-2942.068) (-2934.671) (-2940.610) [-2935.216] -- 0:00:29 805000 -- (-2948.239) [-2939.844] (-2935.816) (-2940.788) * (-2939.998) (-2948.280) [-2939.737] (-2943.693) -- 0:00:29 Average standard deviation of split frequencies: 0.008773 805500 -- (-2942.617) (-2937.613) [-2940.033] (-2936.975) * (-2944.795) (-2938.961) [-2936.531] (-2942.394) -- 0:00:29 806000 -- [-2936.082] (-2937.941) (-2943.457) (-2942.650) * (-2946.030) (-2938.362) (-2938.354) [-2937.844] -- 0:00:29 806500 -- (-2935.242) (-2942.046) [-2942.787] (-2936.404) * (-2942.085) (-2935.908) [-2938.412] (-2936.915) -- 0:00:29 807000 -- (-2940.287) [-2936.264] (-2940.692) (-2940.608) * (-2938.714) [-2936.560] (-2934.425) (-2944.654) -- 0:00:29 807500 -- [-2940.049] (-2939.082) (-2942.553) (-2940.807) * (-2940.789) (-2940.942) [-2936.820] (-2940.542) -- 0:00:29 808000 -- (-2945.574) [-2943.016] (-2941.095) (-2940.678) * [-2938.252] (-2935.856) (-2937.468) (-2944.199) -- 0:00:29 808500 -- (-2949.429) [-2940.168] (-2941.514) (-2936.766) * [-2941.780] (-2940.499) (-2944.976) (-2943.701) -- 0:00:29 809000 -- [-2941.935] (-2938.504) (-2947.462) (-2942.523) * (-2937.049) [-2940.935] (-2938.852) (-2942.539) -- 0:00:29 809500 -- (-2945.068) (-2948.613) [-2940.615] (-2945.568) * (-2939.335) [-2945.418] (-2939.258) (-2941.234) -- 0:00:29 810000 -- (-2937.079) [-2949.429] (-2946.484) (-2943.152) * (-2945.958) [-2936.233] (-2937.890) (-2940.886) -- 0:00:29 Average standard deviation of split frequencies: 0.008141 810500 -- [-2937.296] (-2946.075) (-2941.685) (-2940.423) * (-2943.775) (-2944.592) [-2935.611] (-2937.938) -- 0:00:28 811000 -- (-2935.368) (-2947.087) (-2944.449) [-2940.049] * (-2939.252) (-2944.288) [-2933.884] (-2945.829) -- 0:00:28 811500 -- [-2941.440] (-2938.813) (-2943.977) (-2940.613) * (-2937.002) [-2942.051] (-2938.622) (-2942.682) -- 0:00:28 812000 -- [-2939.140] (-2935.070) (-2946.121) (-2941.495) * [-2944.814] (-2942.106) (-2935.175) (-2942.693) -- 0:00:28 812500 -- [-2941.161] (-2952.126) (-2937.738) (-2937.913) * (-2934.106) (-2937.419) [-2937.760] (-2939.078) -- 0:00:28 813000 -- [-2938.876] (-2944.864) (-2950.956) (-2944.362) * (-2941.435) (-2941.375) (-2936.715) [-2939.971] -- 0:00:28 813500 -- (-2941.498) (-2936.694) [-2942.672] (-2945.765) * (-2942.131) (-2946.147) (-2943.292) [-2938.894] -- 0:00:28 814000 -- (-2942.595) (-2939.380) [-2944.416] (-2942.881) * (-2946.494) (-2941.694) (-2943.386) [-2939.976] -- 0:00:28 814500 -- (-2948.414) (-2939.610) (-2947.339) [-2941.772] * [-2938.930] (-2941.011) (-2941.597) (-2933.930) -- 0:00:28 815000 -- (-2941.556) (-2934.591) (-2939.882) [-2942.201] * (-2944.348) [-2939.411] (-2943.353) (-2947.376) -- 0:00:28 Average standard deviation of split frequencies: 0.009243 815500 -- (-2948.250) (-2938.195) (-2941.821) [-2937.864] * [-2945.593] (-2941.315) (-2937.518) (-2948.013) -- 0:00:28 816000 -- [-2941.030] (-2943.323) (-2940.339) (-2940.258) * [-2941.337] (-2936.978) (-2936.468) (-2935.500) -- 0:00:28 816500 -- (-2936.928) (-2947.304) (-2943.618) [-2938.316] * [-2937.774] (-2937.409) (-2938.514) (-2942.883) -- 0:00:28 817000 -- (-2937.013) [-2938.524] (-2940.482) (-2935.283) * [-2944.103] (-2950.940) (-2940.299) (-2941.140) -- 0:00:27 817500 -- (-2945.407) [-2937.503] (-2941.883) (-2951.020) * (-2942.332) [-2939.379] (-2940.264) (-2935.554) -- 0:00:27 818000 -- (-2940.387) (-2936.307) (-2949.687) [-2942.988] * (-2941.508) (-2939.822) [-2941.406] (-2936.786) -- 0:00:27 818500 -- (-2942.537) (-2940.253) [-2937.931] (-2942.554) * (-2941.703) (-2939.634) [-2937.630] (-2941.939) -- 0:00:27 819000 -- (-2935.337) (-2931.380) [-2938.392] (-2941.123) * (-2938.266) (-2942.626) [-2939.034] (-2941.814) -- 0:00:27 819500 -- [-2940.237] (-2938.447) (-2936.854) (-2939.179) * (-2940.050) [-2938.965] (-2940.575) (-2942.168) -- 0:00:27 820000 -- (-2947.702) [-2937.478] (-2938.337) (-2940.141) * (-2936.981) (-2935.679) (-2936.474) [-2935.611] -- 0:00:27 Average standard deviation of split frequencies: 0.009191 820500 -- (-2952.699) (-2936.833) [-2939.489] (-2950.881) * [-2941.073] (-2945.464) (-2939.248) (-2939.429) -- 0:00:27 821000 -- (-2940.907) [-2940.158] (-2936.745) (-2936.115) * (-2940.378) (-2952.675) [-2939.204] (-2940.320) -- 0:00:27 821500 -- (-2941.928) (-2942.915) [-2936.486] (-2937.043) * (-2941.893) (-2941.835) (-2934.148) [-2936.802] -- 0:00:27 822000 -- (-2936.764) (-2936.016) [-2945.629] (-2935.150) * [-2942.494] (-2937.969) (-2942.443) (-2936.970) -- 0:00:27 822500 -- (-2937.475) (-2940.199) (-2942.247) [-2936.996] * (-2939.302) (-2935.296) [-2934.050] (-2940.360) -- 0:00:27 823000 -- (-2942.301) (-2935.510) [-2941.052] (-2935.728) * (-2935.675) [-2941.610] (-2940.243) (-2939.467) -- 0:00:27 823500 -- (-2940.307) [-2940.824] (-2936.302) (-2947.727) * [-2933.906] (-2939.250) (-2943.156) (-2945.473) -- 0:00:27 824000 -- (-2931.999) [-2938.898] (-2944.896) (-2945.414) * (-2939.451) (-2940.624) [-2938.631] (-2940.631) -- 0:00:26 824500 -- [-2935.756] (-2940.365) (-2940.171) (-2947.792) * [-2938.762] (-2937.884) (-2939.248) (-2941.627) -- 0:00:26 825000 -- (-2941.698) [-2938.916] (-2943.113) (-2938.773) * (-2937.970) (-2952.862) [-2934.628] (-2941.031) -- 0:00:26 Average standard deviation of split frequencies: 0.008561 825500 -- (-2938.629) (-2938.300) (-2940.249) [-2940.015] * (-2940.605) (-2939.313) (-2940.974) [-2937.698] -- 0:00:26 826000 -- (-2937.037) [-2933.086] (-2937.185) (-2938.268) * (-2950.087) [-2944.450] (-2936.775) (-2937.784) -- 0:00:26 826500 -- (-2942.498) (-2941.871) [-2938.567] (-2945.646) * (-2939.678) (-2947.224) [-2934.945] (-2939.273) -- 0:00:26 827000 -- (-2944.911) [-2942.030] (-2938.916) (-2939.011) * (-2948.593) (-2940.529) (-2944.116) [-2941.102] -- 0:00:26 827500 -- (-2940.526) (-2939.684) (-2939.945) [-2935.806] * (-2942.667) (-2935.434) [-2937.919] (-2942.405) -- 0:00:26 828000 -- [-2936.243] (-2944.528) (-2945.455) (-2936.157) * (-2941.409) (-2933.359) (-2943.898) [-2941.462] -- 0:00:26 828500 -- (-2943.024) (-2938.817) (-2938.568) [-2941.149] * (-2942.672) [-2940.055] (-2940.470) (-2936.228) -- 0:00:26 829000 -- (-2941.341) (-2937.153) [-2941.778] (-2945.402) * (-2948.359) (-2936.366) [-2931.783] (-2941.091) -- 0:00:26 829500 -- [-2947.100] (-2939.575) (-2937.648) (-2939.077) * (-2944.530) (-2944.218) (-2938.737) [-2941.900] -- 0:00:26 830000 -- (-2944.980) [-2937.512] (-2940.460) (-2945.952) * [-2943.386] (-2936.974) (-2942.829) (-2946.195) -- 0:00:26 Average standard deviation of split frequencies: 0.008513 830500 -- (-2942.772) (-2943.871) (-2934.444) [-2937.800] * (-2936.785) [-2937.841] (-2938.863) (-2937.144) -- 0:00:25 831000 -- [-2935.884] (-2939.668) (-2941.809) (-2945.825) * [-2938.399] (-2938.300) (-2940.578) (-2936.261) -- 0:00:25 831500 -- (-2943.983) (-2941.296) [-2938.933] (-2939.798) * (-2945.892) [-2937.773] (-2936.114) (-2936.754) -- 0:00:25 832000 -- [-2938.867] (-2939.182) (-2942.170) (-2939.097) * (-2933.214) (-2946.060) (-2938.698) [-2938.537] -- 0:00:25 832500 -- (-2942.876) (-2945.625) (-2936.797) [-2942.316] * (-2939.564) [-2943.910] (-2939.964) (-2940.510) -- 0:00:25 833000 -- (-2938.619) (-2946.866) [-2938.513] (-2947.091) * (-2942.587) (-2935.525) (-2941.784) [-2937.094] -- 0:00:25 833500 -- [-2948.538] (-2952.050) (-2936.949) (-2942.200) * [-2934.381] (-2938.392) (-2939.233) (-2936.235) -- 0:00:25 834000 -- [-2944.143] (-2940.893) (-2939.004) (-2940.969) * (-2944.719) [-2943.514] (-2939.742) (-2935.954) -- 0:00:25 834500 -- [-2939.618] (-2942.056) (-2938.540) (-2940.098) * (-2946.369) (-2942.372) [-2938.598] (-2941.341) -- 0:00:25 835000 -- [-2940.427] (-2942.446) (-2944.011) (-2942.240) * (-2938.432) [-2938.814] (-2939.768) (-2938.033) -- 0:00:25 Average standard deviation of split frequencies: 0.007894 835500 -- (-2946.033) [-2944.753] (-2941.821) (-2937.734) * (-2939.525) (-2937.712) [-2945.428] (-2942.752) -- 0:00:25 836000 -- (-2940.017) (-2945.784) (-2940.103) [-2937.795] * (-2940.998) [-2938.816] (-2936.544) (-2939.685) -- 0:00:25 836500 -- (-2940.815) (-2933.805) [-2938.071] (-2940.892) * (-2937.275) (-2938.073) [-2939.799] (-2945.517) -- 0:00:25 837000 -- (-2941.921) [-2939.221] (-2939.679) (-2944.465) * (-2937.300) (-2935.098) [-2942.408] (-2946.698) -- 0:00:24 837500 -- (-2941.458) (-2941.247) (-2942.130) [-2934.090] * (-2940.014) [-2935.897] (-2941.586) (-2948.081) -- 0:00:24 838000 -- (-2946.395) [-2945.104] (-2936.330) (-2934.372) * [-2934.902] (-2938.715) (-2946.052) (-2946.882) -- 0:00:24 838500 -- (-2940.051) (-2939.489) [-2935.820] (-2937.626) * (-2935.900) (-2946.253) (-2942.200) [-2940.839] -- 0:00:24 839000 -- (-2937.950) (-2938.034) (-2944.130) [-2941.610] * [-2935.793] (-2939.465) (-2941.935) (-2937.324) -- 0:00:24 839500 -- [-2936.124] (-2936.652) (-2940.766) (-2940.886) * (-2944.709) (-2934.599) (-2936.544) [-2936.595] -- 0:00:24 840000 -- (-2951.356) [-2937.765] (-2938.418) (-2939.257) * (-2938.471) (-2936.245) (-2936.810) [-2938.502] -- 0:00:24 Average standard deviation of split frequencies: 0.007851 840500 -- (-2939.931) [-2946.545] (-2937.657) (-2940.422) * (-2934.834) (-2942.354) [-2938.915] (-2936.209) -- 0:00:24 841000 -- (-2943.278) (-2944.251) (-2939.746) [-2937.879] * [-2943.023] (-2944.533) (-2937.351) (-2936.137) -- 0:00:24 841500 -- (-2944.159) (-2944.684) [-2940.317] (-2935.668) * [-2941.122] (-2944.068) (-2941.059) (-2942.905) -- 0:00:24 842000 -- (-2945.814) (-2938.879) [-2942.455] (-2940.210) * (-2944.022) (-2936.618) (-2945.585) [-2941.015] -- 0:00:24 842500 -- [-2936.798] (-2941.836) (-2942.799) (-2941.461) * (-2935.533) (-2939.663) [-2939.248] (-2934.119) -- 0:00:24 843000 -- [-2942.715] (-2939.634) (-2939.564) (-2940.911) * (-2938.630) (-2938.113) [-2939.143] (-2942.324) -- 0:00:24 843500 -- [-2941.419] (-2937.271) (-2939.892) (-2932.909) * (-2939.956) [-2939.589] (-2940.733) (-2942.596) -- 0:00:23 844000 -- (-2941.557) (-2942.853) (-2939.120) [-2941.939] * (-2935.460) [-2935.690] (-2946.500) (-2938.630) -- 0:00:23 844500 -- (-2938.122) (-2939.684) (-2936.014) [-2934.821] * [-2933.600] (-2941.382) (-2944.652) (-2934.957) -- 0:00:23 845000 -- (-2942.034) [-2941.049] (-2936.634) (-2937.303) * [-2932.770] (-2941.017) (-2944.741) (-2938.892) -- 0:00:23 Average standard deviation of split frequencies: 0.006687 845500 -- (-2938.332) (-2938.602) (-2934.181) [-2942.842] * [-2941.355] (-2948.016) (-2939.869) (-2934.831) -- 0:00:23 846000 -- (-2944.121) [-2935.472] (-2941.648) (-2944.093) * (-2940.897) (-2936.877) [-2939.101] (-2949.163) -- 0:00:23 846500 -- (-2939.021) (-2935.485) (-2940.398) [-2938.761] * (-2942.465) (-2937.424) [-2944.383] (-2940.397) -- 0:00:23 847000 -- (-2938.048) [-2939.029] (-2941.733) (-2940.409) * (-2937.447) (-2937.537) [-2937.791] (-2939.157) -- 0:00:23 847500 -- (-2942.968) (-2942.102) [-2943.976] (-2940.704) * [-2939.874] (-2937.742) (-2934.593) (-2941.723) -- 0:00:23 848000 -- (-2943.622) (-2937.356) [-2940.346] (-2944.207) * (-2936.988) [-2939.116] (-2938.408) (-2938.538) -- 0:00:23 848500 -- [-2940.447] (-2943.371) (-2936.145) (-2939.716) * (-2943.192) (-2948.231) (-2936.607) [-2939.644] -- 0:00:23 849000 -- (-2943.113) (-2936.533) [-2933.999] (-2947.411) * (-2935.558) (-2939.424) (-2942.973) [-2937.355] -- 0:00:23 849500 -- (-2945.642) [-2936.439] (-2939.302) (-2937.232) * [-2941.250] (-2942.937) (-2938.947) (-2938.146) -- 0:00:23 850000 -- (-2948.528) [-2943.820] (-2943.038) (-2943.963) * [-2945.245] (-2942.360) (-2935.832) (-2937.024) -- 0:00:22 Average standard deviation of split frequencies: 0.006096 850500 -- (-2935.618) (-2937.001) [-2936.132] (-2938.057) * (-2933.142) (-2949.682) [-2935.439] (-2942.856) -- 0:00:22 851000 -- [-2940.394] (-2943.233) (-2941.000) (-2935.299) * [-2940.456] (-2936.696) (-2931.375) (-2940.963) -- 0:00:22 851500 -- [-2936.633] (-2940.451) (-2942.899) (-2938.190) * (-2938.166) (-2938.482) (-2945.941) [-2940.582] -- 0:00:22 852000 -- (-2942.093) [-2937.972] (-2939.903) (-2938.503) * (-2941.178) (-2942.257) (-2939.659) [-2937.545] -- 0:00:22 852500 -- (-2941.398) [-2937.202] (-2935.445) (-2937.735) * (-2938.215) (-2941.989) [-2934.180] (-2937.172) -- 0:00:22 853000 -- (-2940.758) (-2933.967) (-2938.135) [-2934.753] * (-2945.034) [-2944.510] (-2937.822) (-2941.391) -- 0:00:22 853500 -- (-2940.708) (-2948.180) [-2940.909] (-2939.194) * (-2943.923) (-2944.291) (-2943.707) [-2939.776] -- 0:00:22 854000 -- (-2946.519) (-2936.697) (-2944.933) [-2937.417] * (-2939.928) (-2947.759) (-2942.811) [-2942.749] -- 0:00:22 854500 -- (-2943.544) (-2947.409) (-2945.604) [-2938.380] * [-2939.258] (-2945.229) (-2940.513) (-2940.568) -- 0:00:22 855000 -- (-2941.944) (-2937.291) [-2938.249] (-2941.583) * (-2939.489) (-2942.368) [-2952.269] (-2943.553) -- 0:00:22 Average standard deviation of split frequencies: 0.005507 855500 -- (-2937.805) (-2940.635) [-2939.083] (-2940.960) * [-2940.251] (-2938.933) (-2937.563) (-2941.205) -- 0:00:22 856000 -- [-2943.070] (-2950.546) (-2941.288) (-2941.354) * (-2942.274) (-2947.276) [-2937.742] (-2941.138) -- 0:00:22 856500 -- [-2943.100] (-2935.644) (-2935.944) (-2940.853) * (-2939.887) (-2945.746) (-2934.228) [-2941.698] -- 0:00:21 857000 -- (-2936.721) (-2941.374) [-2936.238] (-2938.579) * (-2940.541) [-2936.720] (-2939.330) (-2937.014) -- 0:00:21 857500 -- (-2940.226) (-2949.374) (-2946.402) [-2938.214] * [-2936.645] (-2942.305) (-2935.393) (-2940.317) -- 0:00:21 858000 -- [-2941.091] (-2945.893) (-2944.207) (-2942.169) * (-2937.995) (-2947.060) (-2938.109) [-2946.776] -- 0:00:21 858500 -- (-2938.451) (-2948.517) [-2937.713] (-2942.068) * (-2939.961) (-2946.188) [-2941.650] (-2937.048) -- 0:00:21 859000 -- [-2936.375] (-2941.378) (-2936.719) (-2940.627) * (-2943.699) (-2936.179) (-2939.611) [-2942.682] -- 0:00:21 859500 -- (-2935.727) (-2943.485) (-2944.118) [-2942.719] * [-2940.921] (-2940.424) (-2938.406) (-2941.008) -- 0:00:21 860000 -- [-2937.061] (-2939.841) (-2939.378) (-2945.472) * (-2940.625) [-2940.335] (-2939.829) (-2939.289) -- 0:00:21 Average standard deviation of split frequencies: 0.004929 860500 -- [-2937.825] (-2936.111) (-2938.565) (-2938.249) * (-2935.497) (-2940.509) [-2938.074] (-2941.257) -- 0:00:21 861000 -- (-2946.331) (-2932.922) (-2940.156) [-2938.741] * (-2936.129) [-2935.350] (-2943.187) (-2941.729) -- 0:00:21 861500 -- (-2934.628) (-2935.645) (-2939.016) [-2937.088] * (-2939.612) (-2941.719) [-2940.097] (-2943.428) -- 0:00:21 862000 -- (-2937.013) [-2938.127] (-2938.207) (-2946.294) * (-2941.330) (-2939.348) [-2936.907] (-2935.936) -- 0:00:21 862500 -- (-2938.633) (-2941.852) (-2938.743) [-2934.606] * [-2939.817] (-2938.303) (-2939.534) (-2947.555) -- 0:00:21 863000 -- (-2938.137) [-2938.643] (-2936.649) (-2939.394) * (-2940.350) (-2938.195) [-2941.513] (-2953.706) -- 0:00:20 863500 -- [-2939.945] (-2941.097) (-2934.919) (-2941.161) * (-2937.755) (-2939.099) (-2940.320) [-2934.500] -- 0:00:20 864000 -- (-2934.499) (-2943.623) [-2939.090] (-2943.829) * [-2942.554] (-2941.546) (-2940.527) (-2942.585) -- 0:00:20 864500 -- (-2941.123) (-2939.549) [-2935.906] (-2940.656) * (-2935.392) [-2940.783] (-2945.359) (-2937.136) -- 0:00:20 865000 -- (-2940.303) [-2934.504] (-2936.089) (-2943.961) * (-2943.632) [-2940.624] (-2942.994) (-2937.273) -- 0:00:20 Average standard deviation of split frequencies: 0.005988 865500 -- (-2937.307) (-2943.843) [-2945.991] (-2945.773) * (-2942.499) (-2942.198) (-2945.225) [-2935.827] -- 0:00:20 866000 -- (-2941.533) [-2941.114] (-2944.440) (-2940.590) * (-2952.345) (-2938.937) (-2943.812) [-2938.624] -- 0:00:20 866500 -- (-2944.235) (-2934.654) [-2934.557] (-2936.254) * (-2942.820) (-2948.137) (-2940.326) [-2937.779] -- 0:00:20 867000 -- (-2943.299) (-2942.977) [-2936.710] (-2937.747) * (-2945.135) (-2948.453) [-2935.563] (-2935.057) -- 0:00:20 867500 -- (-2944.001) [-2945.262] (-2944.869) (-2939.407) * (-2940.192) (-2940.510) (-2937.230) [-2949.234] -- 0:00:20 868000 -- [-2937.729] (-2945.868) (-2942.433) (-2936.881) * (-2940.674) (-2946.348) [-2940.692] (-2944.879) -- 0:00:20 868500 -- (-2937.957) (-2939.231) (-2937.948) [-2941.101] * (-2938.698) (-2945.804) [-2933.084] (-2941.653) -- 0:00:20 869000 -- (-2942.352) [-2937.464] (-2938.542) (-2943.102) * (-2948.788) (-2935.400) [-2937.873] (-2938.300) -- 0:00:20 869500 -- [-2934.383] (-2936.820) (-2940.611) (-2941.357) * [-2938.387] (-2942.322) (-2946.694) (-2936.868) -- 0:00:19 870000 -- (-2939.785) (-2940.223) [-2943.661] (-2942.072) * (-2935.360) (-2939.085) (-2940.567) [-2941.971] -- 0:00:19 Average standard deviation of split frequencies: 0.006497 870500 -- (-2952.398) [-2937.090] (-2940.958) (-2941.972) * [-2943.960] (-2947.706) (-2939.192) (-2939.668) -- 0:00:19 871000 -- (-2942.189) (-2937.664) [-2941.257] (-2938.554) * (-2935.340) [-2944.099] (-2934.501) (-2941.068) -- 0:00:19 871500 -- (-2941.480) [-2939.506] (-2943.006) (-2937.285) * (-2941.589) (-2944.139) (-2936.679) [-2942.087] -- 0:00:19 872000 -- (-2939.460) [-2938.589] (-2938.814) (-2941.174) * (-2942.634) (-2940.895) [-2940.105] (-2940.806) -- 0:00:19 872500 -- (-2937.796) (-2936.549) [-2936.931] (-2941.864) * (-2940.848) [-2942.283] (-2936.622) (-2939.694) -- 0:00:19 873000 -- [-2935.437] (-2941.499) (-2938.391) (-2943.883) * (-2937.503) [-2938.273] (-2936.447) (-2941.786) -- 0:00:19 873500 -- (-2937.911) (-2940.135) (-2943.983) [-2941.708] * (-2935.890) (-2935.977) (-2939.029) [-2935.255] -- 0:00:19 874000 -- [-2944.978] (-2936.976) (-2940.081) (-2938.513) * (-2943.188) (-2940.310) (-2943.084) [-2939.892] -- 0:00:19 874500 -- (-2940.431) [-2937.645] (-2940.550) (-2936.583) * [-2934.571] (-2944.590) (-2941.351) (-2937.614) -- 0:00:19 875000 -- [-2934.676] (-2938.231) (-2939.230) (-2945.693) * [-2941.779] (-2939.980) (-2939.780) (-2938.235) -- 0:00:19 Average standard deviation of split frequencies: 0.005919 875500 -- (-2937.641) [-2934.455] (-2938.420) (-2941.594) * [-2939.160] (-2941.135) (-2945.830) (-2947.217) -- 0:00:19 876000 -- (-2935.494) [-2943.662] (-2938.780) (-2936.605) * (-2937.983) [-2933.304] (-2933.843) (-2943.046) -- 0:00:18 876500 -- [-2940.161] (-2937.536) (-2939.697) (-2946.108) * [-2944.378] (-2940.888) (-2936.127) (-2939.193) -- 0:00:18 877000 -- (-2939.573) (-2944.717) [-2939.489] (-2943.519) * (-2943.660) (-2942.605) (-2941.331) [-2940.916] -- 0:00:18 877500 -- [-2939.064] (-2940.565) (-2942.615) (-2936.991) * (-2943.810) (-2934.776) [-2937.198] (-2939.898) -- 0:00:18 878000 -- (-2939.085) [-2943.177] (-2941.869) (-2940.941) * (-2945.629) (-2934.901) [-2936.256] (-2948.546) -- 0:00:18 878500 -- (-2936.644) (-2939.382) [-2939.726] (-2936.784) * (-2937.420) (-2937.070) [-2940.631] (-2935.427) -- 0:00:18 879000 -- [-2932.948] (-2941.226) (-2939.451) (-2936.949) * (-2940.349) [-2933.180] (-2936.227) (-2939.934) -- 0:00:18 879500 -- [-2934.099] (-2939.751) (-2938.012) (-2942.404) * (-2941.483) (-2935.338) [-2938.500] (-2945.094) -- 0:00:18 880000 -- [-2937.474] (-2946.894) (-2939.502) (-2939.099) * [-2940.138] (-2941.035) (-2937.417) (-2944.135) -- 0:00:18 Average standard deviation of split frequencies: 0.006423 880500 -- (-2942.099) (-2940.657) (-2946.066) [-2934.250] * [-2935.283] (-2939.904) (-2946.106) (-2941.006) -- 0:00:18 881000 -- (-2943.918) (-2937.141) (-2940.555) [-2939.556] * [-2940.132] (-2944.532) (-2938.714) (-2947.851) -- 0:00:18 881500 -- (-2941.301) (-2932.709) [-2945.140] (-2935.768) * [-2939.829] (-2939.754) (-2938.333) (-2938.826) -- 0:00:18 882000 -- (-2936.453) (-2942.057) (-2937.159) [-2941.340] * (-2946.326) [-2943.232] (-2938.792) (-2941.069) -- 0:00:18 882500 -- (-2937.447) (-2939.925) [-2941.526] (-2937.706) * (-2939.071) [-2941.356] (-2941.547) (-2941.361) -- 0:00:17 883000 -- (-2939.412) [-2937.088] (-2944.711) (-2937.315) * [-2940.770] (-2941.662) (-2937.277) (-2939.510) -- 0:00:17 883500 -- (-2938.155) [-2936.461] (-2934.029) (-2941.087) * (-2940.100) [-2933.318] (-2946.462) (-2940.952) -- 0:00:17 884000 -- (-2939.065) [-2935.777] (-2940.250) (-2936.468) * (-2945.406) (-2940.303) (-2939.645) [-2936.234] -- 0:00:17 884500 -- (-2941.536) (-2937.499) (-2937.032) [-2938.434] * (-2940.310) [-2937.610] (-2942.744) (-2938.876) -- 0:00:17 885000 -- (-2943.590) [-2934.613] (-2943.365) (-2933.978) * (-2942.480) (-2944.010) (-2935.900) [-2940.658] -- 0:00:17 Average standard deviation of split frequencies: 0.005853 885500 -- (-2937.317) (-2938.365) (-2942.726) [-2936.973] * (-2940.237) [-2939.538] (-2940.125) (-2943.388) -- 0:00:17 886000 -- (-2936.319) (-2942.066) (-2937.610) [-2939.983] * (-2940.932) [-2940.068] (-2943.582) (-2936.129) -- 0:00:17 886500 -- (-2940.465) [-2940.153] (-2936.342) (-2942.788) * [-2934.588] (-2936.814) (-2937.937) (-2937.773) -- 0:00:17 887000 -- (-2940.192) (-2941.414) [-2942.103] (-2940.013) * [-2946.792] (-2937.294) (-2940.280) (-2941.062) -- 0:00:17 887500 -- (-2945.912) (-2941.499) [-2937.456] (-2939.322) * [-2941.428] (-2936.960) (-2937.605) (-2937.404) -- 0:00:17 888000 -- (-2938.898) (-2940.861) (-2944.903) [-2937.467] * (-2942.960) [-2939.655] (-2935.449) (-2943.556) -- 0:00:17 888500 -- [-2938.880] (-2940.244) (-2940.671) (-2938.949) * (-2938.255) [-2938.087] (-2940.850) (-2941.070) -- 0:00:17 889000 -- (-2943.266) [-2936.929] (-2942.255) (-2939.744) * (-2939.126) [-2939.281] (-2939.283) (-2936.886) -- 0:00:16 889500 -- [-2942.730] (-2937.162) (-2940.527) (-2936.890) * [-2941.823] (-2940.374) (-2943.193) (-2940.403) -- 0:00:16 890000 -- (-2942.605) (-2941.232) (-2936.176) [-2935.548] * (-2940.955) [-2940.161] (-2937.715) (-2939.965) -- 0:00:16 Average standard deviation of split frequencies: 0.005822 890500 -- [-2936.406] (-2940.050) (-2939.704) (-2938.597) * (-2942.003) (-2942.000) (-2941.903) [-2938.721] -- 0:00:16 891000 -- (-2940.681) (-2938.691) (-2939.628) [-2943.386] * (-2937.466) (-2939.393) (-2936.279) [-2934.800] -- 0:00:16 891500 -- (-2941.781) (-2937.344) [-2940.121] (-2941.183) * (-2945.771) [-2940.410] (-2943.034) (-2937.502) -- 0:00:16 892000 -- (-2932.928) [-2940.247] (-2940.380) (-2941.125) * (-2939.267) [-2933.627] (-2936.968) (-2936.700) -- 0:00:16 892500 -- [-2937.089] (-2940.424) (-2944.920) (-2942.831) * [-2941.465] (-2938.335) (-2940.950) (-2941.696) -- 0:00:16 893000 -- (-2938.945) (-2937.397) (-2946.415) [-2939.933] * [-2935.566] (-2940.136) (-2945.618) (-2946.238) -- 0:00:16 893500 -- (-2943.069) (-2938.447) [-2940.980] (-2942.230) * (-2945.620) (-2932.440) [-2940.039] (-2944.144) -- 0:00:16 894000 -- (-2939.678) [-2943.220] (-2949.241) (-2934.978) * (-2938.858) [-2938.360] (-2941.556) (-2936.741) -- 0:00:16 894500 -- [-2934.615] (-2935.332) (-2946.512) (-2941.339) * (-2940.675) [-2936.304] (-2940.472) (-2934.827) -- 0:00:16 895000 -- (-2944.224) (-2943.218) [-2935.595] (-2936.088) * (-2940.349) [-2937.786] (-2939.019) (-2938.567) -- 0:00:16 Average standard deviation of split frequencies: 0.005261 895500 -- [-2939.779] (-2938.489) (-2943.444) (-2945.492) * (-2935.706) (-2935.827) (-2945.295) [-2945.308] -- 0:00:15 896000 -- [-2940.935] (-2946.970) (-2943.758) (-2942.090) * (-2943.152) [-2938.155] (-2947.553) (-2940.279) -- 0:00:15 896500 -- [-2941.334] (-2936.775) (-2943.954) (-2944.293) * (-2941.725) (-2941.567) [-2939.358] (-2936.886) -- 0:00:15 897000 -- (-2939.855) (-2937.007) (-2938.566) [-2941.456] * (-2935.096) (-2947.500) (-2946.755) [-2935.366] -- 0:00:15 897500 -- [-2945.920] (-2933.712) (-2937.373) (-2942.844) * (-2941.372) (-2939.857) (-2941.552) [-2937.881] -- 0:00:15 898000 -- (-2937.677) (-2941.465) [-2940.536] (-2942.622) * [-2940.855] (-2945.446) (-2933.723) (-2939.722) -- 0:00:15 898500 -- (-2946.735) (-2937.336) [-2942.649] (-2933.608) * (-2938.370) (-2942.357) (-2937.194) [-2940.459] -- 0:00:15 899000 -- [-2936.357] (-2937.980) (-2934.608) (-2935.311) * (-2939.430) (-2937.940) (-2941.434) [-2939.349] -- 0:00:15 899500 -- (-2939.083) [-2937.811] (-2937.809) (-2937.999) * (-2952.977) [-2942.249] (-2940.783) (-2937.715) -- 0:00:15 900000 -- (-2941.158) (-2940.797) [-2931.745] (-2947.606) * [-2944.896] (-2941.545) (-2937.708) (-2942.225) -- 0:00:15 Average standard deviation of split frequencies: 0.005234 900500 -- (-2937.959) (-2944.467) (-2940.421) [-2938.856] * (-2947.673) [-2937.347] (-2937.636) (-2944.167) -- 0:00:15 901000 -- (-2935.173) (-2935.116) (-2943.393) [-2935.478] * (-2944.510) (-2934.492) (-2943.036) [-2936.759] -- 0:00:15 901500 -- [-2937.428] (-2933.562) (-2936.644) (-2936.797) * [-2939.484] (-2937.964) (-2945.295) (-2939.109) -- 0:00:15 902000 -- (-2938.505) [-2941.356] (-2939.610) (-2936.339) * [-2938.443] (-2937.210) (-2949.181) (-2940.160) -- 0:00:14 902500 -- [-2935.983] (-2939.438) (-2941.864) (-2941.788) * [-2938.407] (-2939.596) (-2943.705) (-2937.566) -- 0:00:14 903000 -- (-2947.199) (-2942.346) [-2941.262] (-2935.031) * [-2941.414] (-2942.984) (-2940.592) (-2939.933) -- 0:00:14 903500 -- (-2938.643) (-2934.940) [-2942.198] (-2940.474) * [-2937.942] (-2944.132) (-2939.797) (-2946.391) -- 0:00:14 904000 -- [-2938.417] (-2941.695) (-2940.672) (-2937.174) * (-2937.125) [-2936.903] (-2941.088) (-2941.719) -- 0:00:14 904500 -- (-2939.401) [-2941.252] (-2941.873) (-2937.987) * (-2945.097) [-2935.109] (-2942.055) (-2938.951) -- 0:00:14 905000 -- (-2939.920) (-2944.312) (-2935.352) [-2938.086] * (-2942.794) (-2939.853) (-2936.963) [-2947.697] -- 0:00:14 Average standard deviation of split frequencies: 0.005203 905500 -- (-2943.882) [-2941.980] (-2937.733) (-2937.999) * (-2939.395) (-2937.150) [-2939.496] (-2943.918) -- 0:00:14 906000 -- (-2938.501) (-2943.713) [-2938.340] (-2949.101) * (-2936.889) (-2944.362) [-2936.360] (-2935.059) -- 0:00:14 906500 -- (-2941.323) [-2944.982] (-2941.489) (-2936.489) * (-2940.213) [-2940.586] (-2938.513) (-2939.886) -- 0:00:14 907000 -- [-2937.093] (-2944.952) (-2942.531) (-2936.578) * (-2941.553) (-2946.521) (-2936.520) [-2946.859] -- 0:00:14 907500 -- [-2934.083] (-2943.376) (-2945.951) (-2935.726) * [-2941.164] (-2943.916) (-2939.747) (-2940.700) -- 0:00:14 908000 -- (-2940.809) (-2948.337) (-2942.911) [-2933.246] * (-2941.560) [-2937.678] (-2937.800) (-2938.782) -- 0:00:14 908500 -- (-2941.468) (-2935.461) (-2945.429) [-2946.915] * (-2939.205) (-2939.042) (-2941.077) [-2937.027] -- 0:00:13 909000 -- (-2938.841) [-2939.393] (-2938.794) (-2941.604) * (-2946.422) [-2935.852] (-2940.115) (-2941.827) -- 0:00:13 909500 -- (-2941.417) (-2941.977) [-2944.156] (-2940.124) * (-2936.337) (-2941.029) [-2937.551] (-2933.605) -- 0:00:13 910000 -- (-2940.263) (-2949.759) (-2948.913) [-2941.438] * (-2941.873) (-2941.546) [-2935.419] (-2945.895) -- 0:00:13 Average standard deviation of split frequencies: 0.005176 910500 -- (-2942.113) [-2936.445] (-2938.228) (-2940.668) * [-2941.705] (-2941.418) (-2937.289) (-2938.641) -- 0:00:13 911000 -- (-2937.760) (-2936.291) [-2943.479] (-2936.012) * (-2940.585) (-2951.011) [-2935.498] (-2945.067) -- 0:00:13 911500 -- (-2939.081) [-2937.819] (-2940.591) (-2938.271) * (-2934.213) (-2936.679) (-2939.071) [-2938.522] -- 0:00:13 912000 -- (-2935.298) [-2941.846] (-2944.560) (-2936.430) * (-2939.829) (-2936.636) [-2936.616] (-2944.596) -- 0:00:13 912500 -- (-2942.395) [-2943.654] (-2936.502) (-2944.100) * (-2937.470) (-2939.544) [-2933.667] (-2942.225) -- 0:00:13 913000 -- (-2946.284) (-2942.869) (-2937.311) [-2934.468] * (-2933.191) [-2937.306] (-2935.224) (-2942.379) -- 0:00:13 913500 -- (-2944.870) (-2943.309) [-2935.922] (-2935.388) * (-2941.213) (-2939.176) [-2937.804] (-2936.799) -- 0:00:13 914000 -- [-2940.150] (-2944.528) (-2937.079) (-2940.415) * (-2946.032) [-2937.550] (-2937.062) (-2935.124) -- 0:00:13 914500 -- (-2938.417) [-2941.945] (-2936.389) (-2940.931) * (-2939.902) [-2936.719] (-2940.856) (-2939.897) -- 0:00:13 915000 -- (-2945.711) [-2936.245] (-2946.311) (-2940.895) * (-2948.104) [-2940.671] (-2935.459) (-2941.166) -- 0:00:13 Average standard deviation of split frequencies: 0.005146 915500 -- [-2943.701] (-2935.360) (-2942.017) (-2941.260) * (-2941.932) (-2940.079) [-2934.985] (-2934.926) -- 0:00:12 916000 -- [-2942.407] (-2945.402) (-2935.146) (-2947.223) * [-2938.841] (-2937.255) (-2940.198) (-2938.048) -- 0:00:12 916500 -- (-2940.292) (-2940.848) (-2938.190) [-2933.160] * (-2950.101) (-2937.200) [-2937.160] (-2940.421) -- 0:00:12 917000 -- (-2939.369) (-2940.848) (-2938.511) [-2939.037] * (-2941.769) (-2936.719) (-2940.355) [-2937.589] -- 0:00:12 917500 -- (-2936.302) (-2937.884) [-2939.239] (-2941.159) * (-2949.141) (-2940.008) (-2938.923) [-2937.886] -- 0:00:12 918000 -- [-2941.169] (-2943.352) (-2942.715) (-2946.665) * [-2941.428] (-2940.591) (-2937.266) (-2936.542) -- 0:00:12 918500 -- (-2936.079) [-2938.623] (-2939.245) (-2940.483) * (-2938.822) [-2941.891] (-2936.491) (-2940.932) -- 0:00:12 919000 -- (-2937.214) (-2940.025) [-2934.337] (-2936.981) * (-2940.447) (-2940.853) [-2938.907] (-2942.874) -- 0:00:12 919500 -- (-2943.920) (-2939.869) [-2932.219] (-2937.491) * (-2939.899) [-2937.682] (-2938.058) (-2939.754) -- 0:00:12 920000 -- [-2943.496] (-2938.543) (-2947.689) (-2940.226) * (-2938.539) (-2937.455) (-2943.771) [-2936.196] -- 0:00:12 Average standard deviation of split frequencies: 0.005120 920500 -- [-2941.424] (-2940.060) (-2947.776) (-2940.090) * (-2937.887) (-2935.998) (-2942.635) [-2940.024] -- 0:00:12 921000 -- [-2942.713] (-2942.279) (-2935.315) (-2940.055) * (-2936.581) [-2939.208] (-2935.499) (-2937.689) -- 0:00:12 921500 -- (-2948.622) [-2938.611] (-2938.020) (-2939.549) * (-2939.694) (-2935.779) (-2937.709) [-2937.446] -- 0:00:12 922000 -- (-2941.370) (-2937.976) (-2942.858) [-2937.817] * (-2943.166) (-2941.708) (-2938.985) [-2939.221] -- 0:00:11 922500 -- [-2940.923] (-2940.538) (-2948.675) (-2936.973) * (-2938.818) (-2946.135) (-2936.731) [-2936.874] -- 0:00:11 923000 -- [-2937.254] (-2941.729) (-2935.887) (-2940.675) * [-2935.359] (-2945.469) (-2937.640) (-2938.759) -- 0:00:11 923500 -- (-2937.483) [-2935.232] (-2944.205) (-2939.702) * (-2947.415) (-2937.312) (-2945.343) [-2941.970] -- 0:00:11 924000 -- (-2943.776) [-2941.781] (-2937.157) (-2938.333) * (-2944.917) (-2940.237) [-2939.694] (-2935.987) -- 0:00:11 924500 -- [-2939.050] (-2941.727) (-2939.758) (-2941.268) * (-2941.797) [-2941.165] (-2938.060) (-2933.610) -- 0:00:11 925000 -- [-2936.847] (-2942.496) (-2941.241) (-2939.160) * (-2946.602) (-2941.962) [-2936.601] (-2942.209) -- 0:00:11 Average standard deviation of split frequencies: 0.003564 925500 -- (-2942.305) [-2945.043] (-2940.023) (-2940.502) * (-2938.949) (-2942.345) (-2938.268) [-2941.038] -- 0:00:11 926000 -- (-2939.741) (-2940.395) [-2942.621] (-2943.449) * (-2940.172) (-2941.421) (-2938.271) [-2944.686] -- 0:00:11 926500 -- [-2942.210] (-2938.206) (-2941.622) (-2940.258) * (-2939.903) [-2937.760] (-2939.385) (-2936.618) -- 0:00:11 927000 -- (-2939.439) (-2940.475) [-2938.556] (-2941.659) * (-2938.853) (-2949.832) [-2937.203] (-2940.964) -- 0:00:11 927500 -- (-2943.912) (-2942.896) (-2940.634) [-2938.403] * [-2935.960] (-2944.237) (-2947.731) (-2940.235) -- 0:00:11 928000 -- [-2942.754] (-2936.653) (-2939.245) (-2939.579) * [-2939.024] (-2944.303) (-2945.481) (-2944.527) -- 0:00:11 928500 -- (-2942.366) (-2942.473) [-2942.859] (-2942.250) * [-2943.249] (-2937.670) (-2940.789) (-2946.510) -- 0:00:10 929000 -- (-2940.026) [-2942.677] (-2941.490) (-2938.769) * (-2933.860) [-2947.619] (-2944.235) (-2940.804) -- 0:00:10 929500 -- [-2938.438] (-2936.977) (-2939.406) (-2943.963) * (-2935.076) [-2937.331] (-2937.692) (-2940.739) -- 0:00:10 930000 -- (-2936.613) [-2942.185] (-2936.673) (-2938.112) * (-2937.361) (-2941.155) (-2935.833) [-2938.832] -- 0:00:10 Average standard deviation of split frequencies: 0.003546 930500 -- (-2950.507) [-2934.203] (-2939.673) (-2944.483) * [-2942.627] (-2944.332) (-2939.647) (-2939.643) -- 0:00:10 931000 -- (-2938.437) [-2936.980] (-2939.825) (-2942.759) * (-2942.549) [-2936.996] (-2942.583) (-2938.722) -- 0:00:10 931500 -- (-2939.882) (-2944.777) [-2940.791] (-2940.515) * (-2937.701) (-2939.559) [-2936.818] (-2933.849) -- 0:00:10 932000 -- (-2936.503) (-2941.816) [-2938.659] (-2946.111) * (-2938.052) (-2940.682) [-2939.000] (-2937.994) -- 0:00:10 932500 -- (-2941.398) (-2936.363) (-2943.816) [-2938.650] * (-2937.916) [-2945.824] (-2942.496) (-2944.784) -- 0:00:10 933000 -- (-2940.937) (-2935.909) (-2939.997) [-2937.915] * [-2939.865] (-2937.542) (-2944.822) (-2943.276) -- 0:00:10 933500 -- (-2937.902) (-2945.217) [-2944.010] (-2939.806) * [-2951.665] (-2937.382) (-2943.111) (-2945.512) -- 0:00:10 934000 -- (-2944.840) (-2938.978) (-2945.279) [-2939.089] * (-2942.314) [-2938.582] (-2939.232) (-2938.028) -- 0:00:10 934500 -- (-2940.823) [-2938.160] (-2940.631) (-2949.845) * (-2937.706) [-2937.391] (-2947.369) (-2938.672) -- 0:00:10 935000 -- (-2940.236) (-2938.674) (-2942.829) [-2939.956] * (-2937.896) [-2934.853] (-2934.523) (-2941.930) -- 0:00:09 Average standard deviation of split frequencies: 0.002518 935500 -- [-2933.528] (-2939.488) (-2935.481) (-2937.348) * (-2938.969) (-2937.520) [-2942.898] (-2939.243) -- 0:00:09 936000 -- (-2940.647) [-2937.816] (-2945.562) (-2945.686) * [-2940.846] (-2939.200) (-2950.206) (-2939.963) -- 0:00:09 936500 -- (-2940.801) [-2938.214] (-2941.286) (-2936.788) * (-2942.890) [-2937.921] (-2943.170) (-2937.804) -- 0:00:09 937000 -- [-2934.852] (-2946.998) (-2939.273) (-2939.741) * (-2934.090) [-2942.167] (-2938.561) (-2939.682) -- 0:00:09 937500 -- (-2950.657) (-2939.519) (-2947.506) [-2933.906] * (-2941.128) (-2941.030) [-2938.307] (-2940.371) -- 0:00:09 938000 -- (-2945.081) (-2943.818) (-2939.881) [-2941.061] * [-2938.959] (-2938.549) (-2948.955) (-2937.633) -- 0:00:09 938500 -- (-2948.058) [-2941.164] (-2940.602) (-2932.097) * (-2946.103) (-2941.109) (-2946.090) [-2939.380] -- 0:00:09 939000 -- (-2935.658) (-2936.651) [-2934.307] (-2943.601) * (-2942.616) (-2937.732) (-2949.816) [-2942.562] -- 0:00:09 939500 -- (-2941.754) [-2941.703] (-2936.573) (-2941.344) * (-2945.453) [-2939.007] (-2947.295) (-2940.857) -- 0:00:09 940000 -- (-2937.425) (-2943.608) (-2940.437) [-2936.012] * (-2949.924) [-2936.004] (-2944.279) (-2933.875) -- 0:00:09 Average standard deviation of split frequencies: 0.004009 940500 -- (-2945.782) (-2936.537) (-2937.490) [-2936.551] * (-2938.752) [-2939.778] (-2946.343) (-2940.021) -- 0:00:09 941000 -- (-2941.277) [-2938.299] (-2940.620) (-2935.824) * [-2941.871] (-2943.746) (-2952.116) (-2936.664) -- 0:00:09 941500 -- (-2941.326) [-2939.279] (-2940.405) (-2940.979) * (-2935.630) [-2941.306] (-2938.257) (-2939.171) -- 0:00:08 942000 -- (-2945.575) (-2940.801) [-2937.376] (-2943.118) * (-2934.366) [-2940.630] (-2936.901) (-2940.685) -- 0:00:08 942500 -- (-2941.880) [-2937.852] (-2935.702) (-2940.567) * (-2937.542) (-2945.294) (-2940.362) [-2935.748] -- 0:00:08 943000 -- (-2935.325) (-2938.202) (-2936.213) [-2943.862] * (-2934.594) (-2940.733) (-2940.941) [-2936.378] -- 0:00:08 943500 -- (-2941.420) (-2944.027) (-2938.750) [-2944.942] * (-2943.366) (-2943.267) [-2943.570] (-2944.455) -- 0:00:08 944000 -- [-2939.593] (-2935.565) (-2940.703) (-2941.659) * [-2936.939] (-2944.137) (-2938.788) (-2939.132) -- 0:00:08 944500 -- (-2940.800) [-2935.688] (-2945.121) (-2940.887) * (-2945.060) [-2939.496] (-2941.293) (-2938.236) -- 0:00:08 945000 -- (-2946.522) (-2942.653) (-2945.549) [-2939.613] * (-2940.053) [-2941.938] (-2938.721) (-2941.975) -- 0:00:08 Average standard deviation of split frequencies: 0.003987 945500 -- (-2939.976) (-2945.005) [-2939.287] (-2941.828) * (-2938.313) [-2939.454] (-2935.990) (-2944.302) -- 0:00:08 946000 -- [-2936.310] (-2938.958) (-2937.969) (-2936.859) * (-2942.173) [-2938.308] (-2943.688) (-2941.755) -- 0:00:08 946500 -- (-2933.710) (-2944.010) [-2937.949] (-2946.764) * (-2935.372) [-2938.538] (-2939.640) (-2940.823) -- 0:00:08 947000 -- (-2936.766) (-2937.730) [-2935.323] (-2943.497) * (-2941.260) (-2938.820) [-2937.568] (-2937.780) -- 0:00:08 947500 -- (-2943.962) (-2939.706) [-2937.926] (-2939.185) * (-2939.174) (-2947.484) [-2941.158] (-2949.021) -- 0:00:08 948000 -- (-2938.855) (-2948.552) [-2939.131] (-2937.107) * (-2939.269) (-2934.718) [-2936.558] (-2942.676) -- 0:00:07 948500 -- (-2942.825) [-2934.822] (-2944.310) (-2939.678) * [-2938.433] (-2945.821) (-2935.721) (-2948.507) -- 0:00:07 949000 -- [-2937.371] (-2938.054) (-2943.142) (-2939.512) * [-2936.174] (-2945.380) (-2936.081) (-2944.046) -- 0:00:07 949500 -- (-2949.807) (-2950.174) [-2941.215] (-2939.466) * [-2937.669] (-2947.116) (-2939.447) (-2946.135) -- 0:00:07 950000 -- (-2945.840) (-2946.518) [-2935.808] (-2938.128) * [-2934.026] (-2953.240) (-2939.048) (-2933.865) -- 0:00:07 Average standard deviation of split frequencies: 0.003967 950500 -- [-2942.755] (-2935.805) (-2942.596) (-2939.164) * [-2939.527] (-2944.953) (-2939.113) (-2937.877) -- 0:00:07 951000 -- [-2941.748] (-2938.571) (-2941.664) (-2937.663) * (-2940.825) (-2942.907) (-2937.251) [-2942.205] -- 0:00:07 951500 -- (-2942.746) (-2938.139) [-2937.087] (-2944.528) * (-2945.251) (-2941.665) [-2943.676] (-2942.491) -- 0:00:07 952000 -- [-2938.171] (-2936.343) (-2936.875) (-2940.217) * [-2939.670] (-2945.047) (-2950.195) (-2936.368) -- 0:00:07 952500 -- (-2936.651) (-2939.054) [-2936.618] (-2939.012) * (-2943.662) (-2941.419) [-2937.675] (-2941.540) -- 0:00:07 953000 -- [-2939.089] (-2939.099) (-2945.565) (-2939.147) * (-2946.106) (-2947.582) [-2938.004] (-2934.845) -- 0:00:07 953500 -- (-2938.972) (-2945.719) [-2943.907] (-2941.018) * [-2939.550] (-2939.823) (-2941.056) (-2945.640) -- 0:00:07 954000 -- (-2942.562) (-2937.681) [-2940.434] (-2938.484) * (-2936.286) [-2938.219] (-2937.974) (-2940.234) -- 0:00:07 954500 -- [-2939.039] (-2938.089) (-2941.264) (-2947.403) * (-2944.418) (-2936.801) (-2938.467) [-2939.306] -- 0:00:06 955000 -- (-2940.274) [-2935.231] (-2936.237) (-2943.603) * (-2940.154) [-2945.395] (-2938.276) (-2935.830) -- 0:00:06 Average standard deviation of split frequencies: 0.003945 955500 -- (-2941.214) [-2939.897] (-2943.809) (-2939.675) * [-2939.592] (-2937.212) (-2937.402) (-2940.680) -- 0:00:06 956000 -- [-2935.729] (-2945.607) (-2949.105) (-2945.927) * (-2937.299) (-2940.680) (-2936.929) [-2934.869] -- 0:00:06 956500 -- [-2935.568] (-2936.512) (-2937.919) (-2942.200) * (-2939.226) [-2937.700] (-2939.269) (-2939.909) -- 0:00:06 957000 -- (-2941.227) (-2937.041) [-2933.642] (-2937.887) * [-2942.784] (-2936.576) (-2936.186) (-2946.193) -- 0:00:06 957500 -- (-2939.663) [-2940.154] (-2937.474) (-2945.883) * (-2959.115) (-2937.013) (-2937.707) [-2940.835] -- 0:00:06 958000 -- [-2938.613] (-2942.951) (-2943.377) (-2937.253) * (-2948.039) (-2940.195) [-2939.690] (-2940.423) -- 0:00:06 958500 -- (-2937.777) (-2939.955) (-2940.736) [-2939.733] * (-2938.600) (-2938.603) [-2940.585] (-2941.482) -- 0:00:06 959000 -- (-2940.717) [-2939.572] (-2943.873) (-2938.086) * (-2938.390) [-2937.278] (-2934.756) (-2941.788) -- 0:00:06 959500 -- (-2943.227) (-2938.341) [-2945.592] (-2936.019) * (-2941.854) [-2948.015] (-2942.864) (-2947.287) -- 0:00:06 960000 -- (-2935.138) [-2938.401] (-2938.394) (-2941.033) * [-2944.571] (-2937.743) (-2942.953) (-2944.349) -- 0:00:06 Average standard deviation of split frequencies: 0.002944 960500 -- (-2938.913) [-2935.696] (-2936.428) (-2944.520) * (-2937.453) (-2937.022) [-2935.595] (-2944.197) -- 0:00:06 961000 -- (-2945.154) [-2941.179] (-2940.936) (-2938.045) * [-2941.824] (-2942.818) (-2944.134) (-2938.162) -- 0:00:05 961500 -- (-2948.196) [-2934.246] (-2938.890) (-2936.157) * (-2938.050) (-2939.314) (-2940.874) [-2937.221] -- 0:00:05 962000 -- (-2939.778) (-2937.490) (-2937.433) [-2936.234] * (-2942.157) [-2936.068] (-2943.306) (-2933.817) -- 0:00:05 962500 -- (-2944.242) [-2940.334] (-2939.716) (-2938.399) * (-2941.719) [-2934.788] (-2943.912) (-2936.505) -- 0:00:05 963000 -- (-2936.871) (-2944.600) [-2934.820] (-2940.093) * (-2938.703) (-2944.191) [-2942.388] (-2944.957) -- 0:00:05 963500 -- [-2940.957] (-2940.136) (-2934.412) (-2941.843) * (-2936.445) (-2941.660) [-2940.836] (-2939.433) -- 0:00:05 964000 -- (-2941.133) (-2935.982) (-2933.026) [-2939.661] * (-2939.020) [-2936.467] (-2942.177) (-2939.023) -- 0:00:05 964500 -- [-2936.534] (-2940.258) (-2936.879) (-2943.285) * (-2936.983) (-2939.025) (-2937.213) [-2939.812] -- 0:00:05 965000 -- (-2944.433) (-2942.229) (-2937.439) [-2942.135] * [-2939.265] (-2940.748) (-2941.927) (-2939.809) -- 0:00:05 Average standard deviation of split frequencies: 0.001952 965500 -- (-2942.662) (-2940.030) [-2940.755] (-2939.616) * (-2941.836) (-2940.119) [-2942.907] (-2938.366) -- 0:00:05 966000 -- (-2944.473) (-2939.785) [-2936.263] (-2943.496) * (-2936.618) (-2939.256) (-2936.044) [-2934.354] -- 0:00:05 966500 -- (-2941.893) [-2941.684] (-2935.673) (-2941.065) * [-2934.758] (-2944.572) (-2938.715) (-2942.993) -- 0:00:05 967000 -- (-2942.106) [-2936.734] (-2937.321) (-2943.401) * (-2940.951) (-2938.439) [-2937.358] (-2941.023) -- 0:00:05 967500 -- (-2944.100) (-2940.996) [-2939.453] (-2939.078) * (-2936.998) (-2940.006) [-2936.437] (-2938.406) -- 0:00:04 968000 -- (-2938.955) (-2940.243) (-2939.777) [-2941.048] * (-2937.933) [-2937.292] (-2945.580) (-2939.641) -- 0:00:04 968500 -- (-2937.403) (-2937.968) (-2941.840) [-2935.580] * (-2937.484) (-2938.587) [-2932.464] (-2939.349) -- 0:00:04 969000 -- [-2939.597] (-2937.889) (-2937.193) (-2943.327) * (-2936.087) (-2939.954) (-2957.732) [-2943.412] -- 0:00:04 969500 -- (-2944.636) (-2941.124) (-2936.988) [-2935.441] * (-2936.920) [-2943.482] (-2943.631) (-2944.701) -- 0:00:04 970000 -- (-2950.704) [-2937.625] (-2942.078) (-2938.953) * [-2940.558] (-2941.193) (-2938.726) (-2937.856) -- 0:00:04 Average standard deviation of split frequencies: 0.001943 970500 -- (-2942.996) (-2934.150) [-2945.764] (-2942.096) * [-2936.669] (-2944.078) (-2948.939) (-2940.860) -- 0:00:04 971000 -- (-2939.044) [-2939.482] (-2943.166) (-2937.522) * (-2936.271) [-2941.060] (-2938.874) (-2942.228) -- 0:00:04 971500 -- (-2941.930) (-2946.029) [-2940.788] (-2946.252) * [-2940.508] (-2943.250) (-2938.718) (-2947.733) -- 0:00:04 972000 -- (-2941.886) (-2936.390) [-2934.273] (-2943.491) * [-2936.928] (-2938.465) (-2942.535) (-2937.765) -- 0:00:04 972500 -- (-2946.986) (-2938.884) [-2933.875] (-2945.104) * (-2952.079) (-2940.552) (-2938.305) [-2940.904] -- 0:00:04 973000 -- (-2947.819) [-2935.819] (-2943.318) (-2940.666) * (-2951.569) [-2936.171] (-2936.164) (-2936.630) -- 0:00:04 973500 -- (-2938.774) [-2936.723] (-2937.547) (-2942.071) * [-2938.520] (-2942.696) (-2939.750) (-2935.945) -- 0:00:04 974000 -- (-2941.975) (-2936.098) [-2935.504] (-2940.744) * (-2934.053) [-2942.191] (-2946.069) (-2938.502) -- 0:00:03 974500 -- [-2939.616] (-2935.155) (-2940.583) (-2941.799) * (-2942.461) (-2944.807) [-2943.223] (-2945.401) -- 0:00:03 975000 -- (-2945.934) (-2933.672) (-2947.654) [-2940.463] * (-2940.806) (-2938.575) (-2935.702) [-2938.225] -- 0:00:03 Average standard deviation of split frequencies: 0.002415 975500 -- (-2940.012) (-2939.559) [-2936.696] (-2940.192) * (-2940.745) (-2942.300) (-2947.166) [-2940.683] -- 0:00:03 976000 -- [-2944.739] (-2942.528) (-2939.455) (-2943.004) * (-2938.673) (-2941.616) (-2938.839) [-2938.492] -- 0:00:03 976500 -- [-2937.181] (-2939.874) (-2939.975) (-2941.727) * (-2936.317) [-2938.008] (-2940.597) (-2937.731) -- 0:00:03 977000 -- (-2940.127) (-2946.023) [-2937.918] (-2941.674) * [-2935.796] (-2944.922) (-2939.220) (-2958.627) -- 0:00:03 977500 -- [-2937.205] (-2938.400) (-2931.768) (-2940.228) * (-2936.869) (-2952.871) (-2940.071) [-2940.206] -- 0:00:03 978000 -- (-2947.271) (-2936.572) [-2937.396] (-2939.798) * (-2936.785) (-2940.891) (-2942.554) [-2937.134] -- 0:00:03 978500 -- [-2936.171] (-2940.449) (-2939.585) (-2944.270) * (-2939.914) [-2937.166] (-2940.040) (-2939.360) -- 0:00:03 979000 -- (-2934.842) (-2944.374) (-2939.669) [-2939.071] * [-2938.422] (-2940.623) (-2942.091) (-2936.851) -- 0:00:03 979500 -- [-2935.326] (-2939.394) (-2941.496) (-2941.911) * [-2936.789] (-2939.508) (-2954.304) (-2942.636) -- 0:00:03 980000 -- [-2939.293] (-2940.537) (-2940.115) (-2941.475) * (-2944.253) [-2947.232] (-2940.948) (-2936.729) -- 0:00:03 Average standard deviation of split frequencies: 0.002403 980500 -- (-2940.323) [-2937.217] (-2940.930) (-2939.612) * (-2942.377) [-2935.973] (-2941.313) (-2936.112) -- 0:00:02 981000 -- (-2936.728) [-2945.213] (-2943.236) (-2943.952) * [-2937.717] (-2942.111) (-2939.807) (-2942.243) -- 0:00:02 981500 -- (-2934.698) (-2936.926) (-2941.764) [-2933.727] * [-2938.471] (-2938.808) (-2941.070) (-2938.332) -- 0:00:02 982000 -- (-2940.595) (-2937.954) (-2936.074) [-2944.851] * [-2943.901] (-2946.418) (-2939.971) (-2938.208) -- 0:00:02 982500 -- (-2938.943) [-2938.351] (-2942.442) (-2949.669) * [-2938.269] (-2944.192) (-2942.405) (-2937.813) -- 0:00:02 983000 -- [-2936.037] (-2939.614) (-2937.445) (-2943.055) * [-2936.936] (-2941.636) (-2943.619) (-2933.583) -- 0:00:02 983500 -- (-2945.240) (-2941.418) (-2938.896) [-2940.923] * (-2940.064) (-2941.117) (-2943.793) [-2936.020] -- 0:00:02 984000 -- (-2940.590) (-2951.849) [-2936.292] (-2943.804) * (-2939.065) [-2934.655] (-2935.460) (-2943.812) -- 0:00:02 984500 -- (-2934.727) (-2942.927) (-2939.931) [-2940.030] * (-2944.817) [-2938.136] (-2937.810) (-2943.402) -- 0:00:02 985000 -- (-2942.927) [-2941.629] (-2942.848) (-2938.606) * [-2936.916] (-2942.660) (-2952.259) (-2944.604) -- 0:00:02 Average standard deviation of split frequencies: 0.001912 985500 -- [-2943.809] (-2944.075) (-2939.988) (-2937.023) * [-2937.456] (-2941.473) (-2945.274) (-2947.096) -- 0:00:02 986000 -- (-2945.413) (-2939.967) (-2945.569) [-2941.309] * (-2942.826) [-2937.975] (-2941.520) (-2934.014) -- 0:00:02 986500 -- (-2947.049) (-2936.530) (-2937.613) [-2939.269] * (-2944.661) [-2946.128] (-2942.873) (-2938.773) -- 0:00:02 987000 -- (-2942.223) (-2939.638) (-2941.362) [-2941.405] * (-2938.699) [-2939.623] (-2935.168) (-2948.677) -- 0:00:01 987500 -- (-2935.974) [-2935.373] (-2944.165) (-2946.950) * (-2932.695) [-2938.178] (-2940.273) (-2941.170) -- 0:00:01 988000 -- [-2940.737] (-2941.705) (-2937.616) (-2934.570) * (-2942.552) (-2945.154) [-2936.953] (-2939.878) -- 0:00:01 988500 -- [-2935.323] (-2938.818) (-2942.867) (-2939.965) * (-2936.906) [-2938.437] (-2939.381) (-2941.888) -- 0:00:01 989000 -- (-2938.041) [-2947.107] (-2941.431) (-2935.845) * (-2938.788) (-2940.172) (-2942.176) [-2943.533] -- 0:00:01 989500 -- (-2944.354) (-2947.064) (-2943.808) [-2935.426] * (-2938.304) (-2937.025) (-2937.904) [-2940.021] -- 0:00:01 990000 -- [-2937.215] (-2940.756) (-2936.959) (-2938.655) * [-2937.728] (-2937.533) (-2942.191) (-2939.235) -- 0:00:01 Average standard deviation of split frequencies: 0.002379 990500 -- [-2940.468] (-2944.640) (-2937.931) (-2940.294) * [-2934.887] (-2948.396) (-2940.556) (-2942.281) -- 0:00:01 991000 -- (-2937.728) [-2937.622] (-2936.515) (-2934.704) * (-2943.623) [-2937.358] (-2944.782) (-2945.068) -- 0:00:01 991500 -- (-2941.992) (-2937.034) (-2940.642) [-2937.137] * (-2948.419) (-2935.812) [-2934.715] (-2939.356) -- 0:00:01 992000 -- (-2939.621) (-2939.241) (-2948.471) [-2937.738] * (-2941.163) (-2941.731) (-2939.311) [-2938.213] -- 0:00:01 992500 -- (-2936.534) [-2935.696] (-2945.902) (-2941.445) * (-2950.624) [-2936.552] (-2939.049) (-2938.298) -- 0:00:01 993000 -- (-2939.025) (-2942.659) (-2944.680) [-2944.147] * (-2948.042) [-2940.645] (-2940.922) (-2937.972) -- 0:00:01 993500 -- (-2934.502) [-2942.629] (-2937.820) (-2940.962) * [-2945.232] (-2934.979) (-2934.395) (-2941.805) -- 0:00:00 994000 -- (-2948.920) (-2942.502) (-2938.548) [-2938.335] * (-2946.352) (-2940.300) [-2939.099] (-2943.512) -- 0:00:00 994500 -- [-2939.561] (-2938.963) (-2935.569) (-2943.413) * (-2935.608) (-2934.244) [-2937.197] (-2941.517) -- 0:00:00 995000 -- [-2935.679] (-2935.984) (-2939.658) (-2942.819) * [-2939.775] (-2936.651) (-2938.189) (-2941.235) -- 0:00:00 Average standard deviation of split frequencies: 0.001893 995500 -- (-2937.961) (-2943.354) [-2938.781] (-2941.674) * (-2937.052) [-2934.333] (-2937.386) (-2936.646) -- 0:00:00 996000 -- (-2945.171) (-2947.441) [-2943.123] (-2940.452) * (-2940.050) [-2935.974] (-2940.955) (-2938.302) -- 0:00:00 996500 -- (-2939.785) [-2947.760] (-2938.518) (-2949.330) * (-2943.715) (-2944.691) [-2942.393] (-2940.537) -- 0:00:00 997000 -- [-2935.350] (-2942.694) (-2939.506) (-2939.140) * (-2935.962) (-2941.929) [-2943.088] (-2936.542) -- 0:00:00 997500 -- (-2937.956) (-2943.438) (-2935.906) [-2939.578] * [-2932.532] (-2942.964) (-2943.355) (-2936.117) -- 0:00:00 998000 -- (-2937.482) (-2943.717) [-2938.134] (-2941.656) * (-2942.656) (-2939.599) [-2934.775] (-2940.439) -- 0:00:00 998500 -- [-2942.669] (-2945.404) (-2940.857) (-2942.117) * [-2934.026] (-2940.959) (-2936.216) (-2937.153) -- 0:00:00 999000 -- [-2942.588] (-2943.815) (-2940.971) (-2950.442) * [-2941.950] (-2941.354) (-2940.138) (-2939.161) -- 0:00:00 999500 -- (-2932.604) (-2939.964) (-2937.678) [-2944.153] * (-2946.318) (-2937.364) [-2937.824] (-2942.781) -- 0:00:00 1000000 -- [-2937.931] (-2935.407) (-2934.716) (-2939.586) * [-2937.741] (-2935.608) (-2946.768) (-2943.478) -- 0:00:00 Average standard deviation of split frequencies: 0.001884 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2937.930513 -- -2.778874 Chain 1 -- -2937.930513 -- -2.778874 Chain 2 -- -2935.406985 -- -1.007027 Chain 2 -- -2935.406985 -- -1.007027 Chain 3 -- -2934.715559 -- 0.030423 Chain 3 -- -2934.715559 -- 0.030423 Chain 4 -- -2939.586034 -- 0.426410 Chain 4 -- -2939.586034 -- 0.426410 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2937.741313 -- 2.201499 Chain 1 -- -2937.741313 -- 2.201499 Chain 2 -- -2935.608453 -- -0.751675 Chain 2 -- -2935.608453 -- -0.751675 Chain 3 -- -2946.768051 -- 3.078088 Chain 3 -- -2946.768051 -- 3.078088 Chain 4 -- -2943.477857 -- 5.258125 Chain 4 -- -2943.477857 -- 5.258125 Analysis completed in 2 mins 33 seconds Analysis used 153.72 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2930.53 Likelihood of best state for "cold" chain of run 2 was -2930.33 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 43.7 % ( 29 %) Dirichlet(Revmat{all}) 60.9 % ( 49 %) Slider(Revmat{all}) 23.8 % ( 31 %) Dirichlet(Pi{all}) 26.0 % ( 22 %) Slider(Pi{all}) 56.1 % ( 29 %) Multiplier(Alpha{1,2}) 37.5 % ( 29 %) Multiplier(Alpha{3}) 39.1 % ( 29 %) Slider(Pinvar{all}) 5.4 % ( 13 %) NNI(Tau{all},V{all}) 3.9 % ( 2 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 28 %) Multiplier(V{all}) 31.5 % ( 33 %) Nodeslider(V{all}) 25.8 % ( 28 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 43.4 % ( 31 %) Dirichlet(Revmat{all}) 59.6 % ( 45 %) Slider(Revmat{all}) 23.6 % ( 20 %) Dirichlet(Pi{all}) 26.3 % ( 33 %) Slider(Pi{all}) 56.1 % ( 36 %) Multiplier(Alpha{1,2}) 37.0 % ( 27 %) Multiplier(Alpha{3}) 38.9 % ( 25 %) Slider(Pinvar{all}) 5.2 % ( 5 %) NNI(Tau{all},V{all}) 3.8 % ( 2 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 31 %) Multiplier(V{all}) 31.6 % ( 32 %) Nodeslider(V{all}) 25.4 % ( 32 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.85 0.72 0.61 2 | 167315 0.86 0.74 3 | 166773 166656 0.87 4 | 166151 166580 166525 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.85 0.72 0.60 2 | 166832 0.86 0.74 3 | 166937 166720 0.87 4 | 166288 166700 166523 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2938.00 | 2 * 1 2 1 | | 2 2 2| |2 2 1 1 111 | | 112 1 1 2 1 1 1 1 21 2 | | 1 1 1 2 1 2 | | 1 2 2 1 2 222 2 1 21 2221 2 | | 1 11 1 11 22 1 1 2 2 1 1 | | 2 2 22 2 1 1 2 12 1 1 21 1 1 | | 1 2 1 2 * 12 1 2 1| | 2 2 2 2* 11 2 | | 21 2 11 1 2 | | 1 1 2 2 2 2 2 | | 2 2 | | | |1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2940.89 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2935.96 -2944.93 2 -2936.07 -2946.00 -------------------------------------- TOTAL -2936.02 -2945.60 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.912159 0.015608 0.690897 1.174277 0.900269 1475.62 1488.31 1.000 r(A<->C){all} 0.125304 0.000816 0.068366 0.179000 0.123795 934.77 1145.14 1.000 r(A<->G){all} 0.373520 0.003134 0.265740 0.481918 0.370770 798.46 867.97 1.000 r(A<->T){all} 0.058165 0.000700 0.011073 0.111344 0.055579 835.86 959.69 1.000 r(C<->G){all} 0.012636 0.000087 0.000001 0.030822 0.010816 1318.22 1324.31 1.000 r(C<->T){all} 0.368232 0.002515 0.272497 0.467975 0.367262 844.67 945.65 1.000 r(G<->T){all} 0.062142 0.000382 0.026698 0.101515 0.060087 1227.71 1228.66 1.000 pi(A){all} 0.229834 0.000119 0.207942 0.250007 0.229575 1227.82 1261.00 1.000 pi(C){all} 0.275758 0.000125 0.254969 0.298191 0.275586 1501.00 1501.00 1.000 pi(G){all} 0.260222 0.000132 0.237722 0.282347 0.260090 895.06 1198.03 1.000 pi(T){all} 0.234186 0.000115 0.212297 0.254238 0.234397 1202.43 1265.64 1.000 alpha{1,2} 0.030872 0.000370 0.000153 0.063604 0.029572 1298.22 1344.84 1.000 alpha{3} 3.881736 1.109113 1.913491 5.866375 3.752311 1501.00 1501.00 1.000 pinvar{all} 0.446452 0.001438 0.371988 0.520269 0.446483 1411.94 1431.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 Key to taxon bipartitions (saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------- 1 -- .*** 2 -- .*.. 3 -- ..*. 4 -- ...* 5 -- .**. ---------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 5 2880 0.959360 0.001884 0.958028 0.960693 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.047669 0.000541 0.002817 0.091249 0.045927 1.000 2 length{all}[2] 0.071580 0.000211 0.043165 0.099459 0.070433 1.001 2 length{all}[3] 0.042776 0.000122 0.022594 0.064692 0.041965 1.000 2 length{all}[4] 0.704801 0.013628 0.493542 0.942873 0.693002 1.000 2 length{all}[5] 0.046826 0.000484 0.004090 0.088178 0.045172 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.001884 Maximum standard deviation of split frequencies = 0.001884 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C4 (4) + | /------------------------------------ C2 (2) \-----------------96----------------+ \------------------------------------ C3 (3) Phylogram (based on average branch lengths): /----- C1 (1) | |------------------------------------------------------------------------ C4 (4) + | /------- C2 (2) \----+ \---- C3 (3) |---------| 0.100 expected changes per site Calculating tree probabilities... Credible sets of trees (3 trees sampled): 99 % credible set contains 2 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 4 ls = 1302 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Sequences read.. Counting site patterns.. 0:00 221 patterns at 434 / 434 sites (100.0%), 0:00 Counting codons.. 48 bytes for distance 215696 bytes for conP 30056 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 4, (2, 3)); MP score: 265 0.073533 0.691147 0.061261 0.124912 0.049407 0.300000 1.300000 ntime & nrate & np: 5 2 7 Bounds (np=7): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 7 lnL0 = -3288.989733 Iterating by ming2 Initial: fx= 3288.989733 x= 0.07353 0.69115 0.06126 0.12491 0.04941 0.30000 1.30000 1 h-m-p 0.0000 0.0008 421.9851 +++CYCCC 3218.589350 4 0.0007 22 | 0/7 2 h-m-p 0.0000 0.0002 2804.0799 +YYCCCC 3155.759878 5 0.0001 41 | 0/7 3 h-m-p 0.0001 0.0005 3381.1341 YCCCCC 3061.602391 5 0.0003 60 | 0/7 4 h-m-p 0.0002 0.0008 951.6625 ++ 2802.354951 m 0.0008 70 | 0/7 5 h-m-p -0.0000 -0.0000 17662.4104 h-m-p: -1.31538436e-21 -6.57692178e-21 1.76624104e+04 2802.354951 .. | 0/7 6 h-m-p 0.0000 0.0001 1373.5197 ++ 2754.951045 m 0.0001 87 | 0/7 7 h-m-p 0.0000 0.0005 4247.2649 YYYYYY 2745.010605 5 0.0000 102 | 0/7 8 h-m-p 0.0001 0.0011 317.0137 +YCYCCC 2703.948436 5 0.0008 121 | 0/7 9 h-m-p 0.0018 0.0119 139.9144 CYCCC 2700.144507 4 0.0005 138 | 0/7 10 h-m-p 0.0010 0.0050 46.9565 CCC 2699.362581 2 0.0008 152 | 0/7 11 h-m-p 0.0020 0.0102 14.9443 CC 2699.011372 1 0.0021 164 | 0/7 12 h-m-p 0.0115 0.1433 2.6806 +CYYC 2682.192490 3 0.0955 180 | 0/7 13 h-m-p 0.9824 6.4371 0.2606 YCCC 2679.852478 3 1.7080 195 | 0/7 14 h-m-p 0.1565 0.7826 2.3039 CCYC 2678.872882 3 0.1534 217 | 0/7 15 h-m-p 1.6000 8.0000 0.0593 CYC 2678.050149 2 1.8337 230 | 0/7 16 h-m-p 0.6421 8.0000 0.1692 CYCC 2677.483310 3 0.8971 252 | 0/7 17 h-m-p 1.6000 8.0000 0.0443 YC 2675.978184 1 3.0799 270 | 0/7 18 h-m-p 1.6000 8.0000 0.0646 CCC 2674.797163 2 1.9024 291 | 0/7 19 h-m-p 0.9719 8.0000 0.1264 CCC 2673.535178 2 1.4760 312 | 0/7 20 h-m-p 1.4337 8.0000 0.1301 CC 2673.083916 1 1.3712 331 | 0/7 21 h-m-p 1.6000 8.0000 0.0295 CCC 2672.935479 2 1.9615 352 | 0/7 22 h-m-p 1.6000 8.0000 0.0070 CC 2672.908851 1 1.3504 371 | 0/7 23 h-m-p 1.3350 8.0000 0.0071 CC 2672.907878 1 1.1328 390 | 0/7 24 h-m-p 1.6000 8.0000 0.0004 Y 2672.907872 0 1.0541 407 | 0/7 25 h-m-p 1.6000 8.0000 0.0000 C 2672.907872 0 0.4370 424 | 0/7 26 h-m-p 0.8549 8.0000 0.0000 ----Y 2672.907872 0 0.0008 445 Out.. lnL = -2672.907872 446 lfun, 446 eigenQcodon, 2230 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 4, (2, 3)); MP score: 265 0.073533 0.691147 0.061261 0.124912 0.049407 1.960376 0.755520 0.234606 ntime & nrate & np: 5 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.301003 np = 8 lnL0 = -2891.477830 Iterating by ming2 Initial: fx= 2891.477830 x= 0.07353 0.69115 0.06126 0.12491 0.04941 1.96038 0.75552 0.23461 1 h-m-p 0.0000 0.0006 512.9959 +++ 2704.272023 m 0.0006 14 | 1/8 2 h-m-p 0.0000 0.0000 331051.2228 +YYYYCCC 2686.517412 6 0.0000 34 | 1/8 3 h-m-p 0.0002 0.0008 103.0745 CYCCC 2684.983162 4 0.0003 52 | 0/8 4 h-m-p 0.0000 0.0000 22713.0274 YCCC 2683.184448 3 0.0000 68 | 0/8 5 h-m-p 0.0002 0.0010 76.3994 +YYYCCC 2681.275401 5 0.0007 87 | 0/8 6 h-m-p 0.0006 0.0029 28.2154 YC 2681.181051 1 0.0003 99 | 0/8 7 h-m-p 0.0011 0.0137 7.4711 YC 2681.115623 1 0.0019 111 | 0/8 8 h-m-p 0.0008 0.1713 17.3273 +++YCCC 2678.542692 3 0.0392 130 | 0/8 9 h-m-p 1.0856 5.4282 0.4819 CCC 2678.187577 2 0.3410 145 | 0/8 10 h-m-p 1.2200 6.1000 0.0610 CYCC 2677.545789 3 0.8951 169 | 0/8 11 h-m-p 1.3335 8.0000 0.0410 +CC 2676.052287 1 5.4251 191 | 0/8 12 h-m-p 0.6355 3.1777 0.0395 YCCC 2675.284476 3 1.2946 215 | 0/8 13 h-m-p 0.3944 4.8838 0.1298 +CCC 2674.475015 2 2.0697 239 | 0/8 14 h-m-p 1.6000 8.0000 0.0297 YC 2672.750945 1 3.8676 259 | 0/8 15 h-m-p 0.5193 2.5965 0.0584 YCYCCC 2671.521112 5 1.3291 286 | 0/8 16 h-m-p 0.6261 3.1305 0.1148 CCCC 2671.216848 3 1.1199 311 | 0/8 17 h-m-p 1.6000 8.0000 0.0136 YC 2671.202966 1 0.9350 331 | 0/8 18 h-m-p 1.6000 8.0000 0.0013 YC 2671.202006 1 0.9380 351 | 0/8 19 h-m-p 1.6000 8.0000 0.0005 YC 2671.201956 1 0.8949 371 | 0/8 20 h-m-p 1.0392 8.0000 0.0004 C 2671.201950 0 1.0444 390 | 0/8 21 h-m-p 1.6000 8.0000 0.0001 Y 2671.201949 0 1.1200 409 | 0/8 22 h-m-p 1.6000 8.0000 0.0001 Y 2671.201949 0 0.6876 428 | 0/8 23 h-m-p 1.6000 8.0000 0.0000 Y 2671.201949 0 0.9077 447 | 0/8 24 h-m-p 1.6000 8.0000 0.0000 ----C 2671.201949 0 0.0019 470 Out.. lnL = -2671.201949 471 lfun, 1413 eigenQcodon, 4710 P(t) Time used: 0:03 Model 2: PositiveSelection TREE # 1 (1, 4, (2, 3)); MP score: 265 initial w for M2:NSpselection reset. 0.073533 0.691147 0.061261 0.124912 0.049407 1.979328 1.079469 0.409056 0.257593 2.430889 ntime & nrate & np: 5 3 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.259983 np = 10 lnL0 = -2982.299047 Iterating by ming2 Initial: fx= 2982.299047 x= 0.07353 0.69115 0.06126 0.12491 0.04941 1.97933 1.07947 0.40906 0.25759 2.43089 1 h-m-p 0.0000 0.0010 346.1449 ++++ 2885.454400 m 0.0010 17 | 1/10 2 h-m-p 0.0011 0.0636 221.5993 +CCCC 2815.122839 3 0.0041 37 | 1/10 3 h-m-p 0.0008 0.0041 134.2942 ++ 2786.421078 m 0.0041 50 | 1/10 4 h-m-p 0.0018 0.0088 54.9235 YCCC 2783.141741 3 0.0031 68 | 1/10 5 h-m-p 0.0015 0.0076 67.6670 CYCCC 2779.725671 4 0.0029 88 | 1/10 6 h-m-p 0.0111 0.0616 17.7993 YCCC 2778.894672 3 0.0061 106 | 1/10 7 h-m-p 0.0160 8.0000 8.2520 ++CYCC 2770.763973 3 0.2262 126 | 1/10 8 h-m-p 0.3359 1.6795 2.5117 YCYCCCC 2756.337084 6 0.7115 149 | 1/10 9 h-m-p 0.1222 0.6110 14.2287 YCCC 2734.614139 3 0.2205 167 | 1/10 10 h-m-p 0.0639 0.3193 8.7525 ++ 2703.058629 m 0.3193 180 | 1/10 11 h-m-p 0.1019 0.5094 10.0370 YCYCCC 2682.282193 5 0.2588 201 | 0/10 12 h-m-p 0.0000 0.0000 124763.5542 YYCCC 2681.283341 4 0.0000 220 | 0/10 13 h-m-p 0.0974 1.3274 1.7887 +CCC 2678.275679 2 0.4398 238 | 0/10 14 h-m-p 0.4044 2.0219 1.1322 CCCCC 2677.115001 4 0.4959 259 | 0/10 15 h-m-p 0.2936 2.5637 1.9120 CCCC 2675.563440 3 0.4784 278 | 0/10 16 h-m-p 0.8286 7.3624 1.1040 YCCC 2674.966205 3 0.4594 296 | 0/10 17 h-m-p 0.4964 8.0000 1.0217 +YCYC 2673.507234 3 1.3730 314 | 0/10 18 h-m-p 1.3324 6.6619 0.9126 YYCCC 2672.413727 4 1.0251 333 | 0/10 19 h-m-p 1.5370 7.6850 0.4189 YC 2672.140151 1 0.9831 357 | 0/10 20 h-m-p 0.8930 8.0000 0.4612 +YC 2671.978885 1 2.3495 382 | 0/10 21 h-m-p 1.6000 8.0000 0.4583 CC 2671.871346 1 2.0336 407 | 0/10 22 h-m-p 1.6000 8.0000 0.3188 CCC 2671.808489 2 2.0943 434 | 0/10 23 h-m-p 1.6000 8.0000 0.2562 YC 2671.728533 1 3.9171 458 | 0/10 24 h-m-p 1.6000 8.0000 0.2844 YC 2671.568729 1 3.3616 482 | 0/10 25 h-m-p 0.6569 8.0000 1.4552 CCCC 2671.351518 3 1.1444 511 | 0/10 26 h-m-p 1.6000 8.0000 0.3274 CC 2671.280586 1 1.4895 526 | 0/10 27 h-m-p 0.9460 8.0000 0.5155 YC 2671.259646 1 2.0619 550 | 0/10 28 h-m-p 1.1545 8.0000 0.9206 YC 2671.228078 1 2.7948 574 | 0/10 29 h-m-p 1.6000 8.0000 1.0284 CC 2671.212918 1 1.7694 599 | 0/10 30 h-m-p 1.6000 8.0000 0.8733 YCC 2671.207206 2 2.5377 615 | 0/10 31 h-m-p 1.6000 8.0000 1.2305 C 2671.204392 0 1.7177 638 | 0/10 32 h-m-p 1.6000 8.0000 0.9727 C 2671.203183 0 1.6000 651 | 0/10 33 h-m-p 1.3696 8.0000 1.1364 YC 2671.202432 1 2.5529 675 | 0/10 34 h-m-p 1.6000 8.0000 0.9736 C 2671.202153 0 2.0551 688 | 0/10 35 h-m-p 1.6000 8.0000 0.9224 Y 2671.202033 0 2.8828 711 | 0/10 36 h-m-p 1.6000 8.0000 0.9679 C 2671.201986 0 2.0521 734 | 0/10 37 h-m-p 1.6000 8.0000 0.9884 C 2671.201967 0 2.0790 757 | 0/10 38 h-m-p 1.6000 8.0000 1.0642 C 2671.201957 0 2.0165 780 | 0/10 39 h-m-p 1.6000 8.0000 0.1018 Y 2671.201956 0 0.9529 793 | 0/10 40 h-m-p 0.1202 8.0000 0.8072 +Y 2671.201955 0 0.9607 817 | 0/10 41 h-m-p 1.3780 8.0000 0.5628 +Y 2671.201951 0 6.6897 841 | 0/10 42 h-m-p 1.6000 8.0000 0.9612 C 2671.201950 0 1.8351 864 | 0/10 43 h-m-p 1.6000 8.0000 0.8855 Y 2671.201949 0 3.8462 887 | 0/10 44 h-m-p 1.6000 8.0000 0.9508 C 2671.201949 0 1.7837 910 | 0/10 45 h-m-p 1.5256 8.0000 1.1116 +Y 2671.201949 0 4.9686 934 | 0/10 46 h-m-p 1.0119 8.0000 5.4586 ----C 2671.201949 0 0.0010 951 | 0/10 47 h-m-p 0.0777 8.0000 0.0694 +Y 2671.201949 0 0.7019 965 | 0/10 48 h-m-p 1.6000 8.0000 0.0298 -Y 2671.201949 0 0.0740 989 | 0/10 49 h-m-p 0.1591 8.0000 0.0139 Y 2671.201949 0 0.0844 1012 | 0/10 50 h-m-p 0.0907 8.0000 0.0129 -Y 2671.201949 0 0.0057 1036 | 0/10 51 h-m-p 0.0160 8.0000 0.0110 -------------.. | 0/10 52 h-m-p 0.0160 8.0000 0.0690 -----------Y 2671.201949 0 0.0000 1104 | 0/10 53 h-m-p 0.0160 8.0000 0.0021 --C 2671.201949 0 0.0002 1129 | 0/10 54 h-m-p 0.0160 8.0000 0.0006 --Y 2671.201949 0 0.0002 1154 Out.. lnL = -2671.201949 1155 lfun, 4620 eigenQcodon, 17325 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2745.716442 S = -2702.600041 -35.152175 Calculating f(w|X), posterior probabilities of site classes. did 10 / 221 patterns 0:11 did 20 / 221 patterns 0:11 did 30 / 221 patterns 0:11 did 40 / 221 patterns 0:11 did 50 / 221 patterns 0:11 did 60 / 221 patterns 0:11 did 70 / 221 patterns 0:11 did 80 / 221 patterns 0:11 did 90 / 221 patterns 0:11 did 100 / 221 patterns 0:11 did 110 / 221 patterns 0:11 did 120 / 221 patterns 0:11 did 130 / 221 patterns 0:11 did 140 / 221 patterns 0:11 did 150 / 221 patterns 0:11 did 160 / 221 patterns 0:11 did 170 / 221 patterns 0:11 did 180 / 221 patterns 0:11 did 190 / 221 patterns 0:12 did 200 / 221 patterns 0:12 did 210 / 221 patterns 0:12 did 220 / 221 patterns 0:12 did 221 / 221 patterns 0:12 Time used: 0:12 Model 3: discrete TREE # 1 (1, 4, (2, 3)); MP score: 265 0.073533 0.691147 0.061261 0.124912 0.049407 1.979333 0.408838 0.998206 0.002797 0.006077 0.009194 ntime & nrate & np: 5 4 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 17.918922 np = 11 lnL0 = -2673.639023 Iterating by ming2 Initial: fx= 2673.639023 x= 0.07353 0.69115 0.06126 0.12491 0.04941 1.97933 0.40884 0.99821 0.00280 0.00608 0.00919 1 h-m-p 0.0000 0.0000 111.6212 ++ 2673.123610 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0003 1362.8994 CYC 2672.480658 2 0.0000 33 | 1/11 3 h-m-p 0.0000 0.0001 110.2251 ++ 2671.499641 m 0.0001 47 | 2/11 4 h-m-p 0.0002 0.0839 62.4902 -YC 2671.493000 1 0.0000 63 | 2/11 5 h-m-p 0.0003 0.0316 5.3894 +CC 2671.472644 1 0.0015 80 | 2/11 6 h-m-p 0.0010 0.0156 8.0924 YC 2671.464560 1 0.0005 95 | 2/11 7 h-m-p 0.0006 0.0800 7.3720 +CC 2671.442106 1 0.0021 112 | 2/11 8 h-m-p 0.0233 3.6578 0.6547 +YC 2671.392801 1 0.1629 128 | 2/11 9 h-m-p 0.2190 8.0000 0.4869 +CCC 2671.277521 2 0.9784 156 | 2/11 10 h-m-p 0.1521 8.0000 3.1324 CCCC 2671.100573 3 0.2276 185 | 1/11 11 h-m-p 0.0002 0.0059 4416.6010 CC 2671.096598 1 0.0000 201 | 1/11 12 h-m-p 0.0868 0.4338 0.3036 ++ 2671.022575 m 0.4338 215 | 1/11 13 h-m-p 0.0001 0.0024 2467.9626 C 2671.013223 0 0.0000 239 | 1/11 14 h-m-p 0.0167 0.0837 0.6763 ++ 2670.973327 m 0.0837 253 | 2/11 15 h-m-p 0.0181 3.8259 3.1243 +YC 2670.935760 1 0.0547 279 | 2/11 16 h-m-p 0.1820 8.0000 0.9387 +CCCC 2670.727899 3 0.8294 300 | 2/11 17 h-m-p 1.6000 8.0000 0.0390 YCCC 2670.619625 3 3.2420 328 | 2/11 18 h-m-p 0.4134 8.0000 0.3061 +YCC 2670.553708 2 1.3127 355 | 2/11 19 h-m-p 1.6000 8.0000 0.0980 CYC 2670.452034 2 1.9549 381 | 2/11 20 h-m-p 1.6000 8.0000 0.0745 CC 2670.420753 1 1.9771 406 | 2/11 21 h-m-p 1.6000 8.0000 0.0316 CYC 2670.406061 2 2.1090 432 | 2/11 22 h-m-p 0.6098 8.0000 0.1092 CC 2670.403605 1 0.7184 457 | 2/11 23 h-m-p 1.6000 8.0000 0.0095 YC 2670.402971 1 1.1540 481 | 2/11 24 h-m-p 1.6000 8.0000 0.0020 Y 2670.402957 0 1.2768 504 | 2/11 25 h-m-p 1.6000 8.0000 0.0002 Y 2670.402957 0 1.1880 527 | 2/11 26 h-m-p 1.6000 8.0000 0.0000 Y 2670.402957 0 1.0907 550 | 2/11 27 h-m-p 1.6000 8.0000 0.0000 --C 2670.402957 0 0.0250 575 Out.. lnL = -2670.402957 576 lfun, 2304 eigenQcodon, 8640 P(t) Time used: 0:15 Model 7: beta TREE # 1 (1, 4, (2, 3)); MP score: 265 0.073533 0.691147 0.061261 0.124912 0.049407 1.976206 0.996708 1.805788 ntime & nrate & np: 5 1 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 9.058435 np = 8 lnL0 = -2871.082976 Iterating by ming2 Initial: fx= 2871.082976 x= 0.07353 0.69115 0.06126 0.12491 0.04941 1.97621 0.99671 1.80579 1 h-m-p 0.0000 0.0050 188.4811 +++YYCCC 2861.095385 4 0.0008 22 | 0/8 2 h-m-p 0.0003 0.0017 336.2258 ++ 2794.301572 m 0.0017 33 | 0/8 3 h-m-p 0.0000 0.0000 10135.7102 + QuantileBeta(0.15, 0.00500, 2.24064) = 1.166975e-160 2000 rounds YYYCYYCCC 2746.637718 8 0.0000 56 | 0/8 4 h-m-p 0.0000 0.0001 956.4199 CYCCCC 2744.967512 5 0.0000 76 | 0/8 5 h-m-p 0.0004 0.0281 50.2281 ++YCYCCC 2726.135453 5 0.0153 97 | 0/8 6 h-m-p 0.0001 0.0007 2148.2255 +YYC 2704.140829 2 0.0006 111 | 0/8 7 h-m-p 0.0001 0.0005 637.0191 ++ 2695.800979 m 0.0005 122 | 0/8 8 h-m-p 0.0493 0.4643 6.1284 +YYCCC 2689.940894 4 0.1679 140 | 0/8 9 h-m-p 0.3047 1.5237 0.7242 +YCYCCC 2677.860042 5 0.8486 160 | 0/8 10 h-m-p 1.0250 5.1250 0.3426 YCCC 2673.418366 3 1.7494 184 | 0/8 11 h-m-p 1.3457 6.7285 0.4184 CCCC 2671.855886 3 1.3891 209 | 0/8 12 h-m-p 1.6000 8.0000 0.2854 CCC 2671.163332 2 1.2894 232 | 0/8 13 h-m-p 1.6000 8.0000 0.1630 CC 2671.039177 1 1.3366 253 | 0/8 14 h-m-p 1.6000 8.0000 0.0363 YC 2671.034360 1 1.1664 273 | 0/8 15 h-m-p 1.6000 8.0000 0.0059 CC 2671.033224 1 2.1828 294 | 0/8 16 h-m-p 1.6000 8.0000 0.0051 YC 2671.032869 1 3.2507 314 | 0/8 17 h-m-p 1.6000 8.0000 0.0047 +YC 2671.032294 1 4.0765 335 | 0/8 18 h-m-p 1.6000 8.0000 0.0032 +C 2671.031901 0 6.0442 355 | 0/8 19 h-m-p 1.1166 8.0000 0.0175 ++ 2671.027072 m 8.0000 374 | 0/8 20 h-m-p 0.0012 0.0581 118.7060 ++YYYYYYYYYC 2670.952621 9 0.0189 404 | 0/8 21 h-m-p 0.0493 0.2467 18.8913 YYCYCYC 2670.920870 6 0.0774 423 | 0/8 22 h-m-p 0.3792 1.8958 1.6874 YYCYCYC 2670.884626 6 0.7836 443 | 0/8 23 h-m-p 0.3477 1.7387 0.9423 YCCC 2670.869469 3 0.1755 459 | 0/8 24 h-m-p 0.3197 3.3098 0.5171 +YYYCC 2670.850451 4 1.1199 484 | 0/8 25 h-m-p 1.6000 8.0000 0.0817 YC 2670.834132 1 0.7815 504 | 0/8 26 h-m-p 0.1223 2.0675 0.5217 YCYC 2670.830774 3 0.2980 527 | 0/8 27 h-m-p 1.6000 8.0000 0.0751 YC 2670.830171 1 0.8877 547 | 0/8 28 h-m-p 1.6000 8.0000 0.0033 C 2670.829887 0 0.3708 566 | 0/8 29 h-m-p 0.0256 8.0000 0.0481 +++YYC 2670.829305 2 1.6596 590 | 0/8 30 h-m-p 0.8505 8.0000 0.0939 YY 2670.828959 1 0.6529 610 | 0/8 31 h-m-p 1.6000 8.0000 0.0367 YC 2670.828616 1 0.8923 630 | 0/8 32 h-m-p 0.4671 8.0000 0.0701 YC 2670.828450 1 0.4925 650 | 0/8 33 h-m-p 0.6193 8.0000 0.0557 Y 2670.828356 0 0.6193 669 | 0/8 34 h-m-p 1.6000 8.0000 0.0017 YC 2670.828272 1 0.8985 689 | 0/8 35 h-m-p 0.0886 8.0000 0.0177 ++C 2670.828159 0 1.6869 710 | 0/8 36 h-m-p 0.8230 8.0000 0.0363 Y 2670.828074 0 0.8230 729 | 0/8 37 h-m-p 1.6000 8.0000 0.0122 Y 2670.828032 0 0.7978 748 | 0/8 38 h-m-p 0.3262 8.0000 0.0298 +Y 2670.827971 0 0.8197 768 | 0/8 39 h-m-p 1.6000 8.0000 0.0039 C 2670.827948 0 1.9350 787 | 0/8 40 h-m-p 0.5074 8.0000 0.0147 Y 2670.827923 0 0.9303 806 | 0/8 41 h-m-p 1.6000 8.0000 0.0022 Y 2670.827917 0 0.7226 825 | 0/8 42 h-m-p 0.2684 8.0000 0.0059 ++Y 2670.827863 0 5.2919 846 | 0/8 43 h-m-p 1.6000 8.0000 0.0120 -C 2670.827863 0 0.1000 866 | 0/8 44 h-m-p 1.6000 8.0000 0.0007 Y 2670.827861 0 0.8873 885 | 0/8 45 h-m-p 1.0887 8.0000 0.0006 ----------Y 2670.827861 0 0.0000 914 Out.. lnL = -2670.827861 915 lfun, 10065 eigenQcodon, 45750 P(t) Time used: 0:35 Model 8: beta&w>1 TREE # 1 (1, 4, (2, 3)); MP score: 265 initial w for M8:NSbetaw>1 reset. 0.073533 0.691147 0.061261 0.124912 0.049407 1.965955 0.900000 0.709770 1.329016 2.821721 ntime & nrate & np: 5 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.772152 np = 10 lnL0 = -2899.913393 Iterating by ming2 Initial: fx= 2899.913393 x= 0.07353 0.69115 0.06126 0.12491 0.04941 1.96596 0.90000 0.70977 1.32902 2.82172 1 h-m-p 0.0000 0.0002 531.5122 +++ 2856.289378 m 0.0002 16 | 1/10 2 h-m-p 0.0002 0.0026 299.5320 ++ 2739.220733 m 0.0026 29 | 0/10 3 h-m-p 0.0000 0.0000 40130.6904 h-m-p: 2.46988210e-23 1.23494105e-22 4.01306904e+04 2739.220733 .. | 0/10 4 h-m-p 0.0000 0.0000 142346.1310 CYCYCCCC 2712.441266 7 0.0000 64 | 0/10 5 h-m-p 0.0000 0.0009 375.8765 YYCYCCC 2700.297797 6 0.0001 86 | 0/10 6 h-m-p 0.0001 0.0008 326.4546 +CYCCC 2683.024112 4 0.0005 107 | 0/10 7 h-m-p 0.0002 0.0009 149.0009 CYCCC 2680.361706 4 0.0003 127 | 0/10 8 h-m-p 0.0007 0.0041 62.5620 YCCC 2678.589022 3 0.0011 145 | 0/10 9 h-m-p 0.0009 0.0078 83.0423 YCC 2676.450383 2 0.0014 161 | 0/10 10 h-m-p 0.0015 0.0074 28.3512 YCC 2676.270099 2 0.0006 177 | 0/10 11 h-m-p 0.0250 3.2179 0.7334 +CCC 2676.149923 2 0.1379 195 | 0/10 12 h-m-p 0.2255 5.8770 0.4484 YCCC 2675.945068 3 0.4039 223 | 0/10 13 h-m-p 0.1865 1.9441 0.9710 +YCCC 2675.426480 3 1.0905 252 | 0/10 14 h-m-p 0.0497 0.2485 3.2672 ++ 2674.397098 m 0.2485 275 | 1/10 15 h-m-p 0.3813 5.0868 0.4653 CCC 2673.811509 2 0.3779 292 | 1/10 16 h-m-p 0.7684 8.0000 0.2288 YCCC 2673.084601 3 1.8108 319 | 1/10 17 h-m-p 1.6000 8.0000 0.0908 CCC 2672.928930 2 1.2889 345 | 1/10 18 h-m-p 1.6000 8.0000 0.0677 YCC 2672.868305 2 2.5463 370 | 1/10 19 h-m-p 1.6000 8.0000 0.0995 CC 2672.843998 1 2.3972 394 | 1/10 20 h-m-p 1.3652 8.0000 0.1747 ++ 2672.673900 m 8.0000 416 | 1/10 21 h-m-p 0.1794 2.7523 7.7928 +CYCCC 2671.912761 4 1.4343 447 | 1/10 22 h-m-p 0.4872 2.4358 4.2819 YCYCC 2671.518053 4 1.2492 466 | 1/10 23 h-m-p 1.3743 6.8713 3.0377 YCCC 2671.383272 3 0.6349 484 | 1/10 24 h-m-p 1.6000 8.0000 0.7936 YYC 2671.351301 2 1.4401 499 | 1/10 25 h-m-p 1.6000 8.0000 0.0085 ++ 2671.201401 m 8.0000 521 | 1/10 26 h-m-p 0.1630 8.0000 0.4195 +YCCC 2671.059135 3 1.3516 549 | 1/10 27 h-m-p 0.9202 6.6545 0.6161 YYC 2671.054179 2 0.7974 573 | 1/10 28 h-m-p 1.6000 8.0000 0.0417 YC 2671.053903 1 1.0217 596 | 1/10 29 h-m-p 1.6000 8.0000 0.0017 C 2671.053875 0 1.8825 618 | 1/10 30 h-m-p 0.5463 8.0000 0.0059 ++ 2671.053720 m 8.0000 640 | 1/10 31 h-m-p 0.0666 8.0000 0.7148 ++YC 2671.050629 1 2.3383 665 | 1/10 32 h-m-p 1.6000 8.0000 0.8791 ++ 2671.014190 m 8.0000 687 | 1/10 33 h-m-p 0.3522 4.3931 19.9652 ---------------.. | 1/10 34 h-m-p 0.0000 0.0001 29.5377 CCC 2671.006690 2 0.0000 739 | 1/10 35 h-m-p 0.0001 0.0289 4.2827 +YC 2671.003601 1 0.0003 754 | 1/10 36 h-m-p 0.0006 0.0427 2.3634 C 2671.002161 0 0.0006 767 | 1/10 37 h-m-p 0.0013 0.0923 1.2032 CC 2671.001902 1 0.0005 782 | 1/10 38 h-m-p 0.0015 0.2348 0.3851 C 2671.001865 0 0.0006 795 | 1/10 39 h-m-p 0.0004 0.1841 0.7357 +YC 2671.001547 1 0.0032 819 | 1/10 40 h-m-p 0.0018 0.2644 1.2865 C 2671.001252 0 0.0019 841 | 1/10 41 h-m-p 0.0082 4.0998 0.4829 +C 2670.999691 0 0.0340 855 | 1/10 42 h-m-p 1.6000 8.0000 0.0088 ++ 2670.999080 m 8.0000 877 | 1/10 43 h-m-p 0.0165 2.6178 4.2844 +++YYYYYYYYYY 2670.965712 9 1.0528 911 | 1/10 44 h-m-p 0.0443 0.2215 30.2771 YYYCYCYC 2670.952371 7 0.0742 933 | 1/10 45 h-m-p 0.1360 0.6801 6.5543 YYYYCCYC 2670.944286 7 0.1932 955 | 1/10 46 h-m-p 0.2157 1.0787 2.9587 YCYYYYYY 2670.918551 7 0.5393 976 | 1/10 47 h-m-p 1.3714 6.8568 0.2024 -YC 2670.912807 1 0.1411 991 | 1/10 48 h-m-p 0.0315 1.7913 0.9069 ++YYYYYYYYY 2670.874565 8 0.5040 1023 | 1/10 49 h-m-p 0.1351 0.6755 0.2087 +CC 2670.842544 1 0.5048 1048 | 1/10 50 h-m-p 0.0367 0.1836 1.7377 +YYC 2670.832823 2 0.1329 1073 | 1/10 51 h-m-p 0.0579 0.2895 0.0459 ++ 2670.832065 m 0.2895 1086 | 2/10 52 h-m-p 1.6000 8.0000 0.0041 YC 2670.831676 1 0.2189 1109 | 2/10 53 h-m-p 0.0160 8.0000 0.0602 +++YCYC 2670.830260 3 2.6411 1137 | 2/10 54 h-m-p 1.6000 8.0000 0.0604 YYY 2670.829437 2 1.6000 1160 | 2/10 55 h-m-p 1.6000 8.0000 0.0369 Y 2670.829176 0 0.3167 1181 | 2/10 56 h-m-p 0.0967 6.2776 0.1209 +C 2670.828836 0 0.3868 1203 | 2/10 57 h-m-p 0.2465 3.7542 0.1897 YY 2670.828675 1 0.2465 1225 | 2/10 58 h-m-p 1.6000 8.0000 0.0122 C 2670.828503 0 2.3146 1246 | 2/10 59 h-m-p 0.6516 8.0000 0.0434 Y 2670.828406 0 0.6516 1267 | 2/10 60 h-m-p 1.6000 8.0000 0.0109 C 2670.828298 0 1.4857 1288 | 2/10 61 h-m-p 1.1633 8.0000 0.0140 YC 2670.828193 1 2.3028 1310 | 2/10 62 h-m-p 1.6000 8.0000 0.0008 Y 2670.828168 0 0.3180 1331 | 2/10 63 h-m-p 0.0160 8.0000 0.0187 +++C 2670.828098 0 1.2537 1355 | 2/10 64 h-m-p 0.8886 8.0000 0.0264 Y 2670.828053 0 0.8886 1376 | 2/10 65 h-m-p 1.6000 8.0000 0.0013 Y 2670.828034 0 0.7696 1397 | 2/10 66 h-m-p 0.1023 8.0000 0.0098 ++C 2670.827997 0 1.7144 1420 | 2/10 67 h-m-p 1.6000 8.0000 0.0077 Y 2670.827960 0 2.7023 1441 | 2/10 68 h-m-p 1.6000 8.0000 0.0064 -C 2670.827960 0 0.1247 1463 | 2/10 69 h-m-p 1.6000 8.0000 0.0003 Y 2670.827957 0 0.9734 1484 | 2/10 70 h-m-p 0.1700 8.0000 0.0018 +++ 2670.827934 m 8.0000 1506 | 2/10 71 h-m-p 1.6000 8.0000 0.0090 ----------------.. | 2/10 72 h-m-p 0.0107 5.3475 0.3781 ------C 2670.827934 0 0.0000 1568 | 2/10 73 h-m-p 0.0104 5.2244 0.0499 -Y 2670.827933 0 0.0004 1590 | 2/10 74 h-m-p 0.0054 2.7004 0.0407 -C 2670.827933 0 0.0005 1612 | 2/10 75 h-m-p 0.0160 8.0000 0.0231 -Y 2670.827933 0 0.0006 1634 | 2/10 76 h-m-p 0.0160 8.0000 0.0157 -Y 2670.827933 0 0.0017 1656 | 2/10 77 h-m-p 0.0160 8.0000 0.0607 -Y 2670.827933 0 0.0006 1678 | 2/10 78 h-m-p 0.0179 8.0000 0.0020 +C 2670.827932 0 0.0807 1700 | 2/10 79 h-m-p 0.6309 8.0000 0.0003 --------C 2670.827932 0 0.0000 1729 Out.. lnL = -2670.827932 1730 lfun, 20760 eigenQcodon, 95150 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2766.088628 S = -2702.883485 -54.966480 Calculating f(w|X), posterior probabilities of site classes. did 10 / 221 patterns 1:16 did 20 / 221 patterns 1:16 did 30 / 221 patterns 1:16 did 40 / 221 patterns 1:16 did 50 / 221 patterns 1:17 did 60 / 221 patterns 1:17 did 70 / 221 patterns 1:17 did 80 / 221 patterns 1:17 did 90 / 221 patterns 1:17 did 100 / 221 patterns 1:18 did 110 / 221 patterns 1:18 did 120 / 221 patterns 1:18 did 130 / 221 patterns 1:18 did 140 / 221 patterns 1:18 did 150 / 221 patterns 1:19 did 160 / 221 patterns 1:19 did 170 / 221 patterns 1:19 did 180 / 221 patterns 1:19 did 190 / 221 patterns 1:19 did 200 / 221 patterns 1:20 did 210 / 221 patterns 1:20 did 220 / 221 patterns 1:20 did 221 / 221 patterns 1:20 Time used: 1:20 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=434 D_melanogaster_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS D_yakuba_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS D_erecta_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS D_elegans_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS ************************************************** D_melanogaster_Gfat1-PF LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD D_yakuba_Gfat1-PF LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD D_erecta_Gfat1-PF LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD D_elegans_Gfat1-PF LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD ************************************************** D_melanogaster_Gfat1-PF GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM D_yakuba_Gfat1-PF GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM D_erecta_Gfat1-PF GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM D_elegans_Gfat1-PF GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM ************************************************** D_melanogaster_Gfat1-PF VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT D_yakuba_Gfat1-PF VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT D_erecta_Gfat1-PF VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT D_elegans_Gfat1-PF VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT ************************************************** D_melanogaster_Gfat1-PF NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL D_yakuba_Gfat1-PF NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL D_erecta_Gfat1-PF NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL D_elegans_Gfat1-PF NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL ************************************************** D_melanogaster_Gfat1-PF SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY D_yakuba_Gfat1-PF SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY D_erecta_Gfat1-PF SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY D_elegans_Gfat1-PF SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY **************:****** **:**:**:******************* D_melanogaster_Gfat1-PF NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP D_yakuba_Gfat1-PF NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP D_erecta_Gfat1-PF NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP D_elegans_Gfat1-PF NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP ************************************************** D_melanogaster_Gfat1-PF VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI D_yakuba_Gfat1-PF VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI D_erecta_Gfat1-PF VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI D_elegans_Gfat1-PF VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI ******************************:******************* D_melanogaster_Gfat1-PF LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE D_yakuba_Gfat1-PF LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE D_erecta_Gfat1-PF LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE D_elegans_Gfat1-PF LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE **********************************
>D_melanogaster_Gfat1-PF ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTTTTCGCATCGGACGCCTC AGCCGTCATAGAGCACACTAACCGGGTCATCTATTTGGAGGACGACGATG TTGCTGCTGTTCGGGATGGAACTTTGAGTATACATCGCCTAAAGAAGAGC CTGGATGATCCGCACGCTCGCGAAATCACTACCCTAAAAATGGAAATTCA ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG AGCAGCCCGACTCCGTGGTGAACACAATGCGCGGTCGCGTCCGCTTCGAT GGTAACGCCATAGTGCTCGGCGGGATCAAAGACTACATTCCTGAAATCAA ACGCTGTCGACGCCTGATGTTGATTGGATGTGGCACATCTTACCACAGCG CTGTAGCCACTAGGCAGCTGCTCGAAGAACTCACAGAGCTTCCCGTGATG GTTGAGCTGGCTTCCGACTTTTTAGACCGAAACACTCCTATTTTTCGAGA CGACGTCTGCTTTTTTATATCGCAGTCCGGAGAGACTGCCGACACCCTGA TGGCCTTACGTTACTGTAAGCAGCGAGGAGCCCTGATTGTGGGCATTACG AATACCGTAGGCAGCAGCATATGTCGGGAATCGCATTGTGGAGTGCACAT TAATGCCGGACCAGAGATAGGCGTGGCCTCGACCAAGGCATACACCTCCC AATTCATTTCCCTGGTGATGTTCGCTCTAGTTATGTCCGAAGATCGACTG TCACTGCAACAGCGACGGCTTGAGATTCTGCAGGCGTTGTCCAAGCTCGC GGATCAAATCCGAGACGTTCTGCAGCTGGACTCCAAAGTTAAAGAACTGG CCAAAGACCTATACCAACACAAGTCGCTTCTGATAATGGGTAGGGGCTAC AACTTTGCCACTTGCCTAGAAGGTGCATTGAAAGTCAAAGAGTTGACTTA CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTGCGGGACCCC GTTTACGTAAAGTGCATGAACGCTCTACAGCAGGTCACATCCCGCAAAGG ATGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT CCTCCCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT CTCACCGTTATCCCAATGCAACTACTGTCTTATCATATTGCCGTGCTTCG CGGATGCGACGTTGACTGTCCTAGAAACTTAGCAAAGTCTGTGACAGTTG AG >D_yakuba_Gfat1-PF ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC AGCCGTCATAGAGCACACTAACAGGGTCATCTATTTGGAGGACGACGATG TTGCTGCTGTTCGGGATGGTACATTGAGTATCCATCGCCTGAAGAAGAGC CTGGATGATCCGCATGCTCGTGAAATCACTACCCTAAAGATGGAAATTCA ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTTG AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT GGGAACGCCATAGTGCTCGGCGGAATTAAGGACTACATTCCTGAAATCAA ACGCTGTCGACGCCTGATGTTGATAGGATGTGGCACATCCTACCACAGCG CTGTTGCCACTAGACAGCTTTTAGAAGAGCTCACGGAGCTCCCCGTGATG GTTGAGCTTGCTTCCGATTTCTTAGACCGGAACACGCCTATTTTCAGAGA CGACGTCTGCTTCTTCATATCGCAGTCTGGAGAGACTGCCGACACCCTAA TGGCCTTGCGCTACTGTAAGCAGCGGGGAGCTCTGATTGTGGGAATTACG AATACCGTAGGTAGCAGCATCTGTCGCGAATCGCATTGTGGAGTGCACAT AAACGCTGGGCCAGAGATAGGCGTAGCCTCGACCAAGGCCTACACCTCCC AGTTCATTTCTTTGGTGATGTTCGCTCTAGTTATGTCCGAGGATCGGCTG TCACTGCAGCAGCGACGGCTTGAAATTCTGCAGGCGTTGTCCAATCTCGC GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAGGTTCAAGAACTGG CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC AACTTTGCCACCTGCCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA CATGCACAGCGAGGGCATCATGGCCGGTGAATTGAAGCACGGCCCACTGG CTCTTGTAGACGACTCCATGCCCGTGCTGATGATTGTCTTGCGGGACCCC GTTTACGTAAAGTGCATGAACGCCTTACAACAGGTAACATCCCGCAAGGG CTGCCCGATTATTATCTGCGAGGAGGGAGACGAGGAGACCAAGGCTTTCT CCTCTCGCCATCTAGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT CTCACCGTTATACCAATGCAACTGCTGTCTTATCATATTGCCGTTCTCCG CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAGTCCGTCACAGTTG AG >D_erecta_Gfat1-PF ATGCCCTTGGAAGAGAAGGAAGTTGAGTACTTCTTCGCGTCGGATGCCTC AGCCGTCATAGAGCACACTAACCGAGTCATCTATTTGGAGGACGACGATG TTGCTGCTGTTCGGGATGGTACCTTGAGTATCCATCGCCTAAAGAAGAGC CTGGATGATCCGCACGCGCGCGAAATCACTACCCTGAAGATGGAAATTCA ACAGATCATGAAGGGAAACTATGACTATTTTATGCAAAAGGAGATTTTCG AGCAGCCCGACTCCGTGGTGAATACAATGCGCGGTCGCGTCCGCTTCGAT GGGAACGCCATAGTGCTCGGCGGAATCAAAGACTACATTCCTGAAATCAA ACGCTGTCGACGCCTGATGTTGATTGGCTGTGGCACATCTTACCACAGCG CTGTTGCCACTAGGCAGCTTCTGGAAGAGCTCACGGAGCTTCCCGTGATG GTCGAGCTGGCTTCCGATTTCTTAGACCGGAATACGCCTATTTTCCGAGA CGACGTCTGCTTCTTCATATCGCAGTCCGGAGAGACTGCCGACACCCTGA TGGCCTTGCGTTACTGTAAGCAGCGGGGAGCCCTAATTGTGGGCATTACG AATACCGTAGGCAGCAGCATCTGTCGCGAATCGCATTGTGGAGTTCACAT TAACGCCGGCCCAGAGATAGGCGTGGCCTCGACCAAGGCCTACACCTCCC AGTTCATTTCCCTGGTGATGTTCGCTCTGGTTATGTCCGAGGATCGGCTG TCATTGCAACAGCGACGGCTGGAGATTCTGCAGGCGTTGTCAAAGCTCGC GGATCAAATCCGAGCCGTTCTGCAGCTGGACTCCAAAGTTCAAGAACTGG CCAAAGACCTTTACCAACACAAGTCACTTCTGATAATGGGTAGAGGCTAC AACTTTGCCACCTGTCTGGAAGGTGCATTGAAAGTCAAGGAGTTGACTTA CATGCACAGTGAGGGCATCATGGCTGGTGAATTGAAGCACGGTCCACTGG CTCTCGTAGACGACTCCATGCCCGTGCTGATGATTGTTTTACGCGACCCC GTTTACGTAAAGTGCATGAACGCTCTACAACAGGTCACATCCCGCAAGGG CTGCCCGATTATTATCTGCGAGGAAGGCGACGAGGAGACCAAGGCTTTCT CTTCCCGCCATCTGGAGATTCCTCGCACCGTCGACTGCCTGCAAGGAATT CTCACTGTTATCCCAATGCAACTGCTGTCTTATCATATTGCCGTGCTCCG CGGATGCGACGTTGACTGTCCCAGAAACCTGGCAAAATCCGTGACAGTTG AG >D_elegans_Gfat1-PF ATGCCCTTGGAAGAAAAGGAAGTAGAATACTTCTTCGCATCGGATGCCTC GGCCGTCATTGAGCACACTAACCGGGTGATCTATTTGGAGGACGACGATG TGGCCGCAGTTCGGGACGGAACTCTGAGTATTCATCGTCTAAAGAAAAGT TTAGATGACCCGCATGCCCGTGAGATCACTACATTAAAGATGGAAATCCA ACAGATCATGAAGGGCAACTATGACTACTTCATGCAGAAGGAGATTTTTG AGCAGCCCGACTCTGTGGTCAACACGATGCGTGGTCGCGTTCGCTTCGAC GGTAACGCGATTGTGCTCGGCGGTATCAAGGACTACATTCCGGAAATCAA ACGTTGTCGCCGTCTCATGCTGATCGGGTGTGGCACGTCTTACCACAGCG CCGTAGCCACCAGGCAGCTGCTCGAAGAGCTCACTGAGCTTCCTGTCATG GTCGAGCTGGCGTCTGACTTCCTGGACCGCAACACACCAATCTTCCGCGA CGACGTCTGCTTCTTTATATCGCAGTCCGGCGAGACGGCGGACACCCTAA TGGCTTTGCGATACTGCAAACAGCGGGGAGCCCTGATTGTGGGCATTACA AACACTGTAGGCAGCAGTATCTGCCGGGAATCGCATTGTGGAGTCCACAT TAACGCTGGCCCCGAGATTGGAGTGGCCTCTACAAAGGCATACACCTCGC AGTTCATTTCCCTGGTGATGTTCGCACTGGTTATGTCAGAGGATCGTCTT TCACTGCAACAGCGACGGCTGGAGATCCTGCAAGCGCTGTCCAAGCTTGC TGACCAAATCCGCGAAGTTCTCAAGCTTGATACAAAAGTTCAAGAGCTGG CCAAAGACCTTTACCAACACAAGTCGCTACTTATCATGGGTCGCGGCTAC AATTTCGCAACCTGTCTGGAAGGTGCCCTGAAAGTCAAGGAGCTGACCTA CATGCACAGCGAGGGCATTATGGCCGGTGAACTAAAGCACGGCCCTCTGG CCCTCGTGGACGACTCCATGCCAGTTCTAATGATAGTCCTTCGGGACCCC GTTTATGTCAAGTGCATGAACGCTCTGCAGCAGGTCACATCGCGCAAGGG CTGCCCTATTATTATTTGTGAGGAGGGAGACGAGGAGACCCAGGCCTTCT CATCCCGGCACCTCGAGATCCCTCGCACCGTTGACTGTCTGCAGGGAATT CTCACCGTTATTCCCATGCAACTCTTATCCTATCATATTGCCGTGCTGCG CGGGTGCGATGTTGACTGTCCTAGAAACCTGGCCAAGTCCGTGACGGTTG AG
>D_melanogaster_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRDVLQLDSKVKELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >D_yakuba_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSNLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >D_erecta_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIRAVLQLDSKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETKAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE >D_elegans_Gfat1-PF MPLEEKEVEYFFASDASAVIEHTNRVIYLEDDDVAAVRDGTLSIHRLKKS LDDPHAREITTLKMEIQQIMKGNYDYFMQKEIFEQPDSVVNTMRGRVRFD GNAIVLGGIKDYIPEIKRCRRLMLIGCGTSYHSAVATRQLLEELTELPVM VELASDFLDRNTPIFRDDVCFFISQSGETADTLMALRYCKQRGALIVGIT NTVGSSICRESHCGVHINAGPEIGVASTKAYTSQFISLVMFALVMSEDRL SLQQRRLEILQALSKLADQIREVLKLDTKVQELAKDLYQHKSLLIMGRGY NFATCLEGALKVKELTYMHSEGIMAGELKHGPLALVDDSMPVLMIVLRDP VYVKCMNALQQVTSRKGCPIIICEEGDEETQAFSSRHLEIPRTVDCLQGI LTVIPMQLLSYHIAVLRGCDVDCPRNLAKSVTVE
#NEXUS [ID: 8654051536] begin taxa; dimensions ntax=4; taxlabels D_melanogaster_Gfat1-PF D_yakuba_Gfat1-PF D_erecta_Gfat1-PF D_elegans_Gfat1-PF ; end; begin trees; translate 1 D_melanogaster_Gfat1-PF, 2 D_yakuba_Gfat1-PF, 3 D_erecta_Gfat1-PF, 4 D_elegans_Gfat1-PF ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.04592701,4:0.6930024,(2:0.07043314,3:0.04196452)0.959:0.04517248); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.04592701,4:0.6930024,(2:0.07043314,3:0.04196452):0.04517248); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2935.96 -2944.93 2 -2936.07 -2946.00 -------------------------------------- TOTAL -2936.02 -2945.60 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/257/Gfat1-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.912159 0.015608 0.690897 1.174277 0.900269 1475.62 1488.31 1.000 r(A<->C){all} 0.125304 0.000816 0.068366 0.179000 0.123795 934.77 1145.14 1.000 r(A<->G){all} 0.373520 0.003134 0.265740 0.481918 0.370770 798.46 867.97 1.000 r(A<->T){all} 0.058165 0.000700 0.011073 0.111344 0.055579 835.86 959.69 1.000 r(C<->G){all} 0.012636 0.000087 0.000001 0.030822 0.010816 1318.22 1324.31 1.000 r(C<->T){all} 0.368232 0.002515 0.272497 0.467975 0.367262 844.67 945.65 1.000 r(G<->T){all} 0.062142 0.000382 0.026698 0.101515 0.060087 1227.71 1228.66 1.000 pi(A){all} 0.229834 0.000119 0.207942 0.250007 0.229575 1227.82 1261.00 1.000 pi(C){all} 0.275758 0.000125 0.254969 0.298191 0.275586 1501.00 1501.00 1.000 pi(G){all} 0.260222 0.000132 0.237722 0.282347 0.260090 895.06 1198.03 1.000 pi(T){all} 0.234186 0.000115 0.212297 0.254238 0.234397 1202.43 1265.64 1.000 alpha{1,2} 0.030872 0.000370 0.000153 0.063604 0.029572 1298.22 1344.84 1.000 alpha{3} 3.881736 1.109113 1.913491 5.866375 3.752311 1501.00 1501.00 1.000 pinvar{all} 0.446452 0.001438 0.371988 0.520269 0.446483 1411.94 1431.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/257/Gfat1-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 4 ls = 434 Codon usage in sequences ------------------------------------------------------------------------------------------------------ Phe TTT 7 3 2 2 | Ser TCT 3 4 3 4 | Tyr TAT 4 4 4 4 | Cys TGT 6 6 7 7 TTC 6 10 11 11 | TCC 12 11 11 7 | TAC 9 9 9 9 | TGC 7 7 6 6 Leu TTA 3 3 2 3 | TCA 2 3 4 3 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 9 11 10 3 | TCG 5 4 4 7 | TAG 0 0 0 0 | Trp TGG 0 0 0 0 ------------------------------------------------------------------------------------------------------ Leu CTT 4 6 4 7 | Pro CCT 4 3 3 5 | His CAT 4 5 4 4 | Arg CGT 1 1 1 6 CTC 6 6 6 9 | CCC 5 6 6 5 | CAC 7 6 7 7 | CGC 11 12 13 10 CTA 8 4 3 5 | CCA 3 3 3 2 | Gln CAA 8 8 9 7 | CGA 7 3 5 2 CTG 18 18 23 21 | CCG 2 2 2 2 | CAG 10 11 10 12 | CGG 5 6 5 7 ------------------------------------------------------------------------------------------------------ Ile ATT 16 15 16 17 | Thr ACT 8 5 6 5 | Asn AAT 2 3 3 1 | Ser AGT 1 1 2 3 ATC 9 9 11 13 | ACC 8 9 9 8 | AAC 8 8 7 9 | AGC 5 5 4 3 ATA 7 8 5 2 | ACA 5 5 4 6 | Lys AAA 9 3 6 6 | Arg AGA 1 4 2 1 Met ATG 17 17 17 17 | ACG 1 3 3 4 | AAG 13 17 15 15 | AGG 2 1 1 1 ------------------------------------------------------------------------------------------------------ Val GTT 12 13 13 11 | Ala GCT 9 10 9 4 | Asp GAT 7 9 9 6 | Gly GGT 5 6 6 6 GTC 7 8 8 10 | GCC 13 14 14 15 | GAC 21 18 18 21 | GGC 8 7 11 11 GTA 4 5 3 3 | GCA 4 2 2 5 | Glu GAA 12 11 11 11 | GGA 11 10 7 6 GTG 11 8 10 10 | GCG 2 3 4 4 | GAG 19 20 20 21 | GGG 1 2 1 2 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Gfat1-PF position 1: T:0.16820 C:0.23733 A:0.25806 G:0.33641 position 2: T:0.33180 C:0.19816 A:0.30645 G:0.16359 position 3: T:0.21429 C:0.32719 A:0.19355 G:0.26498 Average T:0.23810 C:0.25422 A:0.25269 G:0.25499 #2: D_yakuba_Gfat1-PF position 1: T:0.17281 C:0.23041 A:0.26037 G:0.33641 position 2: T:0.33180 C:0.20046 A:0.30415 G:0.16359 position 3: T:0.21659 C:0.33410 A:0.16590 G:0.28341 Average T:0.24040 C:0.25499 A:0.24347 G:0.26114 #3: D_erecta_Gfat1-PF position 1: T:0.16820 C:0.23963 A:0.25576 G:0.33641 position 2: T:0.33180 C:0.20046 A:0.30415 G:0.16359 position 3: T:0.21198 C:0.34793 A:0.15207 G:0.28802 Average T:0.23733 C:0.26267 A:0.23733 G:0.26267 #4: D_elegans_Gfat1-PF position 1: T:0.15207 C:0.25576 A:0.25576 G:0.33641 position 2: T:0.33180 C:0.19816 A:0.30645 G:0.16359 position 3: T:0.21198 C:0.35484 A:0.14286 G:0.29032 Average T:0.23195 C:0.26959 A:0.23502 G:0.26344 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 14 | Ser S TCT 14 | Tyr Y TAT 16 | Cys C TGT 26 TTC 38 | TCC 41 | TAC 36 | TGC 26 Leu L TTA 11 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 33 | TCG 20 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 21 | Pro P CCT 15 | His H CAT 17 | Arg R CGT 9 CTC 27 | CCC 22 | CAC 27 | CGC 46 CTA 20 | CCA 11 | Gln Q CAA 32 | CGA 17 CTG 80 | CCG 8 | CAG 43 | CGG 23 ------------------------------------------------------------------------------ Ile I ATT 64 | Thr T ACT 24 | Asn N AAT 9 | Ser S AGT 7 ATC 42 | ACC 34 | AAC 32 | AGC 17 ATA 22 | ACA 20 | Lys K AAA 24 | Arg R AGA 8 Met M ATG 68 | ACG 11 | AAG 60 | AGG 5 ------------------------------------------------------------------------------ Val V GTT 49 | Ala A GCT 32 | Asp D GAT 31 | Gly G GGT 23 GTC 33 | GCC 56 | GAC 78 | GGC 37 GTA 15 | GCA 13 | Glu E GAA 45 | GGA 34 GTG 39 | GCG 13 | GAG 80 | GGG 6 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16532 C:0.24078 A:0.25749 G:0.33641 position 2: T:0.33180 C:0.19931 A:0.30530 G:0.16359 position 3: T:0.21371 C:0.34101 A:0.16359 G:0.28168 Average T:0.23694 C:0.26037 A:0.24213 G:0.26056 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Gfat1-PF D_yakuba_Gfat1-PF 0.0125 (0.0041 0.3248) D_erecta_Gfat1-PF 0.0076 (0.0020 0.2668) 0.0043 (0.0010 0.2372) D_elegans_Gfat1-PF 0.0070 (0.0071 1.0259) 0.0081 (0.0097 1.1986) 0.0063 (0.0066 1.0585) Model 0: one-ratio TREE # 1: (1, 4, (2, 3)); MP score: 265 lnL(ntime: 5 np: 7): -2672.907872 +0.000000 5..1 5..4 5..6 6..2 6..3 0.078871 0.710657 0.056992 0.112108 0.065627 1.960376 0.005593 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.02426 (1: 0.078871, 4: 0.710657, (2: 0.112108, 3: 0.065627): 0.056992); (D_melanogaster_Gfat1-PF: 0.078871, D_elegans_Gfat1-PF: 0.710657, (D_yakuba_Gfat1-PF: 0.112108, D_erecta_Gfat1-PF: 0.065627): 0.056992); Detailed output identifying parameters kappa (ts/tv) = 1.96038 omega (dN/dS) = 0.00559 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.079 965.0 337.0 0.0056 0.0006 0.1000 0.5 33.7 5..4 0.711 965.0 337.0 0.0056 0.0050 0.9008 4.9 303.6 5..6 0.057 965.0 337.0 0.0056 0.0004 0.0722 0.4 24.3 6..2 0.112 965.0 337.0 0.0056 0.0008 0.1421 0.8 47.9 6..3 0.066 965.0 337.0 0.0056 0.0005 0.0832 0.4 28.0 tree length for dN: 0.0073 tree length for dS: 1.2983 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 4, (2, 3)); MP score: 265 lnL(ntime: 5 np: 8): -2671.201949 +0.000000 5..1 5..4 5..6 6..2 6..3 0.082738 0.714004 0.052675 0.112027 0.065705 1.979328 0.996108 0.003650 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.02715 (1: 0.082738, 4: 0.714004, (2: 0.112027, 3: 0.065705): 0.052675); (D_melanogaster_Gfat1-PF: 0.082738, D_elegans_Gfat1-PF: 0.714004, (D_yakuba_Gfat1-PF: 0.112027, D_erecta_Gfat1-PF: 0.065705): 0.052675); Detailed output identifying parameters kappa (ts/tv) = 1.97933 dN/dS (w) for site classes (K=2) p: 0.99611 0.00389 w: 0.00365 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.083 964.5 337.5 0.0075 0.0008 0.1042 0.8 35.2 5..4 0.714 964.5 337.5 0.0075 0.0068 0.8989 6.5 303.4 5..6 0.053 964.5 337.5 0.0075 0.0005 0.0663 0.5 22.4 6..2 0.112 964.5 337.5 0.0075 0.0011 0.1410 1.0 47.6 6..3 0.066 964.5 337.5 0.0075 0.0006 0.0827 0.6 27.9 Time used: 0:03 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 4, (2, 3)); MP score: 265 lnL(ntime: 5 np: 10): -2671.201949 +0.000000 5..1 5..4 5..6 6..2 6..3 0.082738 0.714005 0.052675 0.112026 0.065705 1.979333 0.996109 0.003891 0.003650 57.002877 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.02715 (1: 0.082738, 4: 0.714005, (2: 0.112026, 3: 0.065705): 0.052675); (D_melanogaster_Gfat1-PF: 0.082738, D_elegans_Gfat1-PF: 0.714005, (D_yakuba_Gfat1-PF: 0.112026, D_erecta_Gfat1-PF: 0.065705): 0.052675); Detailed output identifying parameters kappa (ts/tv) = 1.97933 dN/dS (w) for site classes (K=3) p: 0.99611 0.00389 0.00000 w: 0.00365 1.00000 57.00288 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.083 964.5 337.5 0.0075 0.0008 0.1042 0.8 35.2 5..4 0.714 964.5 337.5 0.0075 0.0068 0.8989 6.5 303.4 5..6 0.053 964.5 337.5 0.0075 0.0005 0.0663 0.5 22.4 6..2 0.112 964.5 337.5 0.0075 0.0011 0.1410 1.0 47.6 6..3 0.066 964.5 337.5 0.0075 0.0006 0.0827 0.6 27.9 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gfat1-PF) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.288 0.125 0.093 0.080 0.074 0.071 0.069 0.068 0.067 0.066 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 0:12 Model 3: discrete (3 categories) TREE # 1: (1, 4, (2, 3)); MP score: 265 lnL(ntime: 5 np: 11): -2670.402957 +0.000000 5..1 5..4 5..6 6..2 6..3 0.079253 0.713947 0.056551 0.112134 0.065658 1.976206 0.585935 0.375430 0.000001 0.000001 0.159842 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.02754 (1: 0.079253, 4: 0.713947, (2: 0.112134, 3: 0.065658): 0.056551); (D_melanogaster_Gfat1-PF: 0.079253, D_elegans_Gfat1-PF: 0.713947, (D_yakuba_Gfat1-PF: 0.112134, D_erecta_Gfat1-PF: 0.065658): 0.056551); Detailed output identifying parameters kappa (ts/tv) = 1.97621 dN/dS (w) for site classes (K=3) p: 0.58594 0.37543 0.03863 w: 0.00000 0.00000 0.15984 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.079 964.6 337.4 0.0062 0.0006 0.1002 0.6 33.8 5..4 0.714 964.6 337.4 0.0062 0.0056 0.9024 5.4 304.5 5..6 0.057 964.6 337.4 0.0062 0.0004 0.0715 0.4 24.1 6..2 0.112 964.6 337.4 0.0062 0.0009 0.1417 0.8 47.8 6..3 0.066 964.6 337.4 0.0062 0.0005 0.0830 0.5 28.0 Naive Empirical Bayes (NEB) analysis Time used: 0:15 Model 7: beta (10 categories) TREE # 1: (1, 4, (2, 3)); MP score: 265 lnL(ntime: 5 np: 8): -2670.827861 +0.000000 5..1 5..4 5..6 6..2 6..3 0.079018 0.711999 0.056861 0.112150 0.065657 1.965955 0.011937 0.474090 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.02569 (1: 0.079018, 4: 0.711999, (2: 0.112150, 3: 0.065657): 0.056861); (D_melanogaster_Gfat1-PF: 0.079018, D_elegans_Gfat1-PF: 0.711999, (D_yakuba_Gfat1-PF: 0.112150, D_erecta_Gfat1-PF: 0.065657): 0.056861); Detailed output identifying parameters kappa (ts/tv) = 1.96596 Parameters in M7 (beta): p = 0.01194 q = 0.47409 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.05899 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.079 964.9 337.1 0.0059 0.0006 0.1000 0.6 33.7 5..4 0.712 964.9 337.1 0.0059 0.0053 0.9013 5.1 303.9 5..6 0.057 964.9 337.1 0.0059 0.0004 0.0720 0.4 24.3 6..2 0.112 964.9 337.1 0.0059 0.0008 0.1420 0.8 47.9 6..3 0.066 964.9 337.1 0.0059 0.0005 0.0831 0.5 28.0 Time used: 0:35 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 4, (2, 3)); MP score: 265 lnL(ntime: 5 np: 10): -2670.827932 +0.000000 5..1 5..4 5..6 6..2 6..3 0.079028 0.712007 0.056850 0.112150 0.065657 1.965975 0.999990 0.011815 0.466015 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.02569 (1: 0.079028, 4: 0.712007, (2: 0.112150, 3: 0.065657): 0.056850); (D_melanogaster_Gfat1-PF: 0.079028, D_elegans_Gfat1-PF: 0.712007, (D_yakuba_Gfat1-PF: 0.112150, D_erecta_Gfat1-PF: 0.065657): 0.056850); Detailed output identifying parameters kappa (ts/tv) = 1.96597 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.01181 q = 0.46602 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.05892 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.079 964.9 337.1 0.0059 0.0006 0.1000 0.6 33.7 5..4 0.712 964.9 337.1 0.0059 0.0053 0.9013 5.1 303.9 5..6 0.057 964.9 337.1 0.0059 0.0004 0.0720 0.4 24.3 6..2 0.112 964.9 337.1 0.0059 0.0008 0.1420 0.8 47.9 6..3 0.066 964.9 337.1 0.0059 0.0005 0.0831 0.5 28.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gfat1-PF) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.048 0.951 ws: 0.398 0.120 0.081 0.067 0.061 0.057 0.055 0.054 0.053 0.053 Time used: 1:20
Model 1: NearlyNeutral -2671.201949 Model 2: PositiveSelection -2671.201949 Model 0: one-ratio -2672.907872 Model 3: discrete -2670.402957 Model 7: beta -2670.827861 Model 8: beta&w>1 -2670.827932 Model 0 vs 1 3.411846000000878 Model 2 vs 1 0.0 Model 8 vs 7 1.4199999986885814E-4