--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 16 23:27:49 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/247/Fer1HCH-PI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1396.78 -1404.08
2 -1396.60 -1408.78
--------------------------------------
TOTAL -1396.69 -1408.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.150819 0.000921 0.098486 0.212677 0.147208 995.09 1116.57 1.000
r(A<->C){all} 0.091828 0.001327 0.025487 0.164307 0.088437 689.43 749.84 1.000
r(A<->G){all} 0.186122 0.002836 0.086653 0.285471 0.181476 705.03 705.13 1.000
r(A<->T){all} 0.136818 0.003449 0.034233 0.257040 0.129492 480.60 507.93 1.001
r(C<->G){all} 0.020423 0.000237 0.000011 0.049489 0.017069 1090.84 1150.26 1.001
r(C<->T){all} 0.459414 0.006329 0.303548 0.611546 0.459213 587.83 615.62 1.000
r(G<->T){all} 0.105394 0.002026 0.019633 0.190432 0.100535 589.25 622.89 1.000
pi(A){all} 0.256793 0.000236 0.227091 0.287115 0.256543 1195.15 1261.36 1.000
pi(C){all} 0.284907 0.000265 0.253089 0.316794 0.284408 1331.87 1375.37 1.000
pi(G){all} 0.283795 0.000264 0.250989 0.313982 0.283635 1329.84 1381.94 1.000
pi(T){all} 0.174505 0.000190 0.147354 0.201281 0.174064 1314.38 1325.94 1.001
alpha{1,2} 0.130575 0.024133 0.000111 0.382277 0.091025 1106.14 1140.29 1.000
alpha{3} 0.941946 0.316016 0.127053 2.115277 0.828221 1304.79 1402.89 1.000
pinvar{all} 0.529853 0.018971 0.230464 0.768644 0.549333 872.97 1017.11 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1324.483592
Model 2: PositiveSelection -1321.416181
Model 0: one-ratio -1334.841805
Model 3: discrete -1321.230942
Model 7: beta -1324.821061
Model 8: beta&w>1 -1321.329015
Model 0 vs 1 20.716425999999956
Model 2 vs 1 6.134821999999986
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.969* 16.824
153 N 0.860 15.045
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.964* 5.324 +- 2.510
153 N 0.949 5.266 +- 2.546
Model 8 vs 7 6.984092000000146
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.981* 16.475
153 N 0.909 15.329
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.981* 4.241 +- 2.163
53 S 0.578 2.416 +- 2.115
153 N 0.974* 4.221 +- 2.176
192 N 0.577 2.391 +- 2.081
>C1
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ
NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C2
MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ
NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C3
MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ
NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C4
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ
NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL
>C5
MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ
NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=245
C1 MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ
C2 MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ
C3 MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ
C4 MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ
C5 MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ
*****.**:******************:*********::**: :::****
C1 NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL
C2 NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
C3 NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
C4 NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL
C5 NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
* .* ****************:**************:*************
C1 AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
C2 AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
C3 AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
C4 AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
C5 AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
**************************************************
C1 LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
C2 LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
C3 LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
C4 LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL
C5 LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL
**.*************:************************.********
C1 VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
C2 VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
C3 VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
C4 VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL
C5 VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
*******************************:*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4900]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4900]--->[4900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.281 Mb, Max= 30.552 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ
NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C2
MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ
NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C3
MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ
NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C4
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ
NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL
>C5
MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ
NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
FORMAT of file /tmp/tmp6135776899380241158aln Not Supported[FATAL:T-COFFEE]
>C1
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ
NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C2
MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ
NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C3
MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ
NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C4
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ
NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL
>C5
MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ
NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:245 S:100 BS:245
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 97.55 C1 C2 97.55
TOP 1 0 97.55 C2 C1 97.55
BOT 0 2 97.55 C1 C3 97.55
TOP 2 0 97.55 C3 C1 97.55
BOT 0 3 94.69 C1 C4 94.69
TOP 3 0 94.69 C4 C1 94.69
BOT 0 4 96.73 C1 C5 96.73
TOP 4 0 96.73 C5 C1 96.73
BOT 1 2 97.55 C2 C3 97.55
TOP 2 1 97.55 C3 C2 97.55
BOT 1 3 94.29 C2 C4 94.29
TOP 3 1 94.29 C4 C2 94.29
BOT 1 4 95.51 C2 C5 95.51
TOP 4 1 95.51 C5 C2 95.51
BOT 2 3 95.10 C3 C4 95.10
TOP 3 2 95.10 C4 C3 95.10
BOT 2 4 96.73 C3 C5 96.73
TOP 4 2 96.73 C5 C3 96.73
BOT 3 4 95.51 C4 C5 95.51
TOP 4 3 95.51 C5 C4 95.51
AVG 0 C1 * 96.63
AVG 1 C2 * 96.22
AVG 2 C3 * 96.73
AVG 3 C4 * 94.90
AVG 4 C5 * 96.12
TOT TOT * 96.12
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTGAAACTAATTGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
C2 ATGGTGAAACTAATCGTTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
C3 ATGGTGAAACTAATCGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
C4 ATGGTGAAATTAATCGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
C5 ATGGTGAAATTAATCGCTAGCCTGTTCCTGTTGGCCGTGGTGGCCCAGGC
********* **** * ******* *************************
C1 CTATGGAGATTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
C2 CTATGGAGATTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
C3 CTATGGAGATTTCAAGTGCGCTCTTTCCAAGAAAGAAAGCAAGAGTTTCG
C4 CTATGGAGACTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
C5 CTATGGAGACTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
********* *********************.******************
C1 TGAGAGAGCTTCAAAGGGAGCGAGAAGAGCATCAACTAAAAGAAAAACAA
C2 TGAGAGAGCTGCAAAGGGAGCGAGAAGAGCATAAACTTAAAGAAAAACAA
C3 TGAGAGAGCTGCAAAGGGAGCGAGAAGAGCAGCAACTTAAAGAAAAACAA
C4 TGAGAGAGCTGCAGAAAGAGCGAAAAGCGCAGCAAGTTAAAGAAAAACAA
C5 TGAGAGAACTGCGGAAAGAGCGAGAAGCGCAGCAGCTTAAAGAAAAACAA
*******.** *..*..******.***.*** .*. *:************
C1 AACCTAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
C2 AACCAAAACCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
C3 AACCCAAACCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCAGT
C4 AACTCAAACCATGGAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
C5 AACCCAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
*** **.*****.*********************************:**
C1 TCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG
C2 TCCTGAGATTACCAAGGATTGGGTGGACATGAAGGATGCCTGCATAAAGG
C3 TCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG
C4 TCCTGAGATTACCAGGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG
C5 TCCTGAGATTACCAAGGATTGGGTGGACATGAAGGATGCCTGCATAAAGG
**************.*** *******************************
C1 GCATGCGCAATCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG
C2 GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG
C3 GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG
C4 GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACCTG
C5 GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACCTG
********.* ************************************ **
C1 GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC
C2 GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC
C3 GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC
C4 GCCATGGGTGCCTACTTCTCCCGTGACACCGTCAACCGCCCTGGATTCGC
C5 GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCCGGCTTCGC
******** ************** ***************** **.*****
C1 CGAGCACTTCTTCAAGGCCGCCAAGGAGGAACGTGAGCACGGATCCAAGC
C2 CGAGCACTTCTTCAAGGCTGCCAAGGAGGAGCGTGAGCACGGATCCAAGC
C3 CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGATCCAAGC
C4 CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGATCCAAGC
C5 CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGTTCCAAGC
****************** ***********.***********:*******
C1 TGGTGGAGTACCTGTCCATGCGCGGTCAACTGACCGAGGGAGTCAGCGAT
C2 TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGAGTCAGCGAT
C3 TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGAGTCAGCGAT
C4 TGGTTGAGTACCTGTCCATGCGCGGTCAGCTGACCGAGGGCGTTAGCGAT
C5 TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGCGTCAGCGAT
**** ***********************. **********.** ******
C1 CTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC
C2 CTGATCTCTGTTCCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC
C3 CTGATCACTGTACCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC
C4 TTGATTAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGCGCTTC
C5 CTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGCGCCGC
**** :.*** ******************************** ** *
C1 CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
C2 CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
C3 CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
C4 CGCCCTGTCCGACGCGCTCGATCTGGAGATCAAGGTGACCAAGTCCATCC
C5 CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
*************** ***** ****************************
C1 GCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCACTACCACCTG
C2 GCAAGCTGATCCAGACCTGCGAGAACAAGCCTTACAACCACTACCACCTG
C3 GCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCACTACCACCTG
C4 GCAAGCTGATCCAGACCTGCGAGAGCAAGCCATACAACCACTACCACCTG
C5 GCAAGCTGATCCAGACCTGCGAGGGCAAGCCATACAACCACTACCACCTG
***********************..****** ******************
C1 GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
C2 GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
C3 GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
C4 GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
C5 GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
**************************************************
C1 CGAGCTCGCCGGCAAGCTGACCACTCTCAAGAAGATGATGGACACCAACG
C2 CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG
C3 CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG
C4 AGAGCTCGCCGGCAAGCTGACCACTCTAAAGAAGATGATGGACTCCAACG
C5 CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG
.************************** ***************:******
C1 GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
C2 GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
C3 GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
C4 GCGAACTGGGCGAGTTCCTGTTCGACAAGACCTTG
C5 GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
******************************** **
>C1
ATGGTGAAACTAATTGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
CTATGGAGATTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
TGAGAGAGCTTCAAAGGGAGCGAGAAGAGCATCAACTAAAAGAAAAACAA
AACCTAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
TCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG
GCATGCGCAATCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG
GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC
CGAGCACTTCTTCAAGGCCGCCAAGGAGGAACGTGAGCACGGATCCAAGC
TGGTGGAGTACCTGTCCATGCGCGGTCAACTGACCGAGGGAGTCAGCGAT
CTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC
CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
GCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCACTACCACCTG
GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
CGAGCTCGCCGGCAAGCTGACCACTCTCAAGAAGATGATGGACACCAACG
GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
>C2
ATGGTGAAACTAATCGTTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
CTATGGAGATTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
TGAGAGAGCTGCAAAGGGAGCGAGAAGAGCATAAACTTAAAGAAAAACAA
AACCAAAACCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
TCCTGAGATTACCAAGGATTGGGTGGACATGAAGGATGCCTGCATAAAGG
GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG
GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC
CGAGCACTTCTTCAAGGCTGCCAAGGAGGAGCGTGAGCACGGATCCAAGC
TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGAGTCAGCGAT
CTGATCTCTGTTCCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC
CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
GCAAGCTGATCCAGACCTGCGAGAACAAGCCTTACAACCACTACCACCTG
GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG
GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
>C3
ATGGTGAAACTAATCGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
CTATGGAGATTTCAAGTGCGCTCTTTCCAAGAAAGAAAGCAAGAGTTTCG
TGAGAGAGCTGCAAAGGGAGCGAGAAGAGCAGCAACTTAAAGAAAAACAA
AACCCAAACCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCAGT
TCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG
GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG
GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC
CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGATCCAAGC
TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGAGTCAGCGAT
CTGATCACTGTACCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC
CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
GCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCACTACCACCTG
GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG
GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
>C4
ATGGTGAAATTAATCGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC
CTATGGAGACTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
TGAGAGAGCTGCAGAAAGAGCGAAAAGCGCAGCAAGTTAAAGAAAAACAA
AACTCAAACCATGGAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
TCCTGAGATTACCAGGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG
GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACCTG
GCCATGGGTGCCTACTTCTCCCGTGACACCGTCAACCGCCCTGGATTCGC
CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGATCCAAGC
TGGTTGAGTACCTGTCCATGCGCGGTCAGCTGACCGAGGGCGTTAGCGAT
TTGATTAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGCGCTTC
CGCCCTGTCCGACGCGCTCGATCTGGAGATCAAGGTGACCAAGTCCATCC
GCAAGCTGATCCAGACCTGCGAGAGCAAGCCATACAACCACTACCACCTG
GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
AGAGCTCGCCGGCAAGCTGACCACTCTAAAGAAGATGATGGACTCCAACG
GCGAACTGGGCGAGTTCCTGTTCGACAAGACCTTG
>C5
ATGGTGAAATTAATCGCTAGCCTGTTCCTGTTGGCCGTGGTGGCCCAGGC
CTATGGAGACTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG
TGAGAGAACTGCGGAAAGAGCGAGAAGCGCAGCAGCTTAAAGAAAAACAA
AACCCAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT
TCCTGAGATTACCAAGGATTGGGTGGACATGAAGGATGCCTGCATAAAGG
GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACCTG
GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCCGGCTTCGC
CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGTTCCAAGC
TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGCGTCAGCGAT
CTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGCGCCGC
CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC
GCAAGCTGATCCAGACCTGCGAGGGCAAGCCATACAACCACTACCACCTG
GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG
CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG
GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
>C1
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ
NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C2
MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ
NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C3
MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ
NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
>C4
MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ
NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL
>C5
MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ
NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL
VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 735 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479338632
Setting output file names to "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 812983423
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8567111570
Seed = 1592854330
Swapseed = 1479338632
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 18 unique site patterns
Division 2 has 13 unique site patterns
Division 3 has 28 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1760.193352 -- -25.624409
Chain 2 -- -1765.828283 -- -25.624409
Chain 3 -- -1764.443545 -- -25.624409
Chain 4 -- -1757.426510 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1755.080490 -- -25.624409
Chain 2 -- -1731.904148 -- -25.624409
Chain 3 -- -1760.193352 -- -25.624409
Chain 4 -- -1765.828283 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1760.193] (-1765.828) (-1764.444) (-1757.427) * [-1755.080] (-1731.904) (-1760.193) (-1765.828)
500 -- [-1424.304] (-1422.613) (-1423.158) (-1414.025) * [-1411.892] (-1418.761) (-1418.338) (-1424.055) -- 0:00:00
1000 -- [-1417.536] (-1414.757) (-1421.551) (-1418.383) * [-1411.773] (-1418.464) (-1423.929) (-1423.336) -- 0:00:00
1500 -- (-1412.432) (-1412.252) (-1421.386) [-1412.298] * (-1414.112) [-1408.405] (-1414.081) (-1414.430) -- 0:00:00
2000 -- (-1411.023) [-1407.864] (-1414.982) (-1408.714) * [-1405.659] (-1403.494) (-1415.061) (-1411.428) -- 0:00:00
2500 -- [-1411.326] (-1404.804) (-1409.804) (-1404.313) * (-1412.000) (-1403.671) [-1411.320] (-1411.212) -- 0:06:39
3000 -- (-1412.593) (-1410.327) [-1410.573] (-1403.003) * (-1405.136) (-1399.963) (-1407.024) [-1407.443] -- 0:05:32
3500 -- (-1414.429) (-1402.111) [-1404.067] (-1405.110) * [-1407.136] (-1396.907) (-1408.358) (-1410.331) -- 0:04:44
4000 -- [-1412.075] (-1407.785) (-1409.574) (-1404.921) * (-1409.264) (-1402.984) (-1409.330) [-1405.304] -- 0:04:09
4500 -- [-1400.433] (-1408.826) (-1404.880) (-1402.579) * (-1410.973) [-1399.280] (-1405.772) (-1401.418) -- 0:03:41
5000 -- [-1401.073] (-1412.769) (-1403.266) (-1403.861) * (-1410.200) (-1403.124) [-1400.763] (-1400.964) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
5500 -- (-1399.271) (-1412.377) [-1410.912] (-1402.304) * [-1406.131] (-1404.663) (-1398.041) (-1402.356) -- 0:03:00
6000 -- (-1402.929) [-1409.762] (-1409.519) (-1400.861) * (-1404.362) (-1405.760) [-1403.983] (-1397.575) -- 0:02:45
6500 -- (-1402.795) (-1404.854) [-1408.590] (-1397.559) * (-1399.745) [-1397.975] (-1399.141) (-1399.818) -- 0:02:32
7000 -- (-1402.544) (-1403.899) [-1406.925] (-1396.198) * (-1407.360) (-1404.794) (-1400.783) [-1397.514] -- 0:02:21
7500 -- (-1397.146) (-1409.462) (-1401.452) [-1397.981] * (-1400.814) (-1400.775) (-1402.464) [-1396.446] -- 0:02:12
8000 -- (-1407.139) (-1404.424) (-1406.632) [-1398.967] * (-1408.153) (-1397.434) [-1398.860] (-1394.935) -- 0:02:04
8500 -- [-1396.024] (-1403.064) (-1398.326) (-1408.514) * (-1396.625) (-1403.625) (-1401.555) [-1393.876] -- 0:03:53
9000 -- [-1398.976] (-1399.007) (-1397.970) (-1414.100) * (-1406.685) (-1394.379) (-1405.052) [-1396.564] -- 0:03:40
9500 -- (-1402.971) (-1395.865) [-1394.755] (-1401.576) * (-1399.129) (-1396.771) (-1400.599) [-1395.957] -- 0:03:28
10000 -- [-1402.735] (-1396.370) (-1397.953) (-1403.597) * (-1405.691) [-1401.621] (-1402.452) (-1398.081) -- 0:03:18
Average standard deviation of split frequencies: 0.022097
10500 -- (-1404.699) (-1400.002) (-1397.889) [-1399.133] * (-1401.161) (-1396.313) (-1396.334) [-1395.524] -- 0:03:08
11000 -- (-1406.939) [-1401.162] (-1396.560) (-1397.128) * (-1399.374) (-1396.019) [-1401.373] (-1404.284) -- 0:02:59
11500 -- (-1402.972) (-1405.227) [-1403.356] (-1400.128) * (-1407.242) [-1395.616] (-1395.205) (-1402.503) -- 0:02:51
12000 -- (-1402.992) (-1399.913) (-1399.397) [-1398.936] * (-1401.934) (-1398.736) (-1399.902) [-1400.168] -- 0:02:44
12500 -- (-1401.418) (-1406.367) (-1407.600) [-1394.855] * (-1399.798) (-1401.026) [-1399.311] (-1400.964) -- 0:02:38
13000 -- (-1405.831) [-1402.087] (-1409.818) (-1396.754) * (-1400.464) (-1404.876) [-1404.123] (-1397.710) -- 0:02:31
13500 -- (-1407.936) (-1401.981) (-1399.119) [-1400.125] * (-1407.240) (-1411.242) (-1402.552) [-1394.448] -- 0:02:26
14000 -- (-1403.198) (-1406.105) [-1398.996] (-1395.627) * [-1408.219] (-1403.565) (-1401.256) (-1397.573) -- 0:02:20
14500 -- [-1402.267] (-1401.952) (-1399.618) (-1398.335) * (-1401.344) (-1410.117) (-1407.759) [-1400.717] -- 0:02:15
15000 -- (-1397.132) (-1400.709) (-1401.558) [-1400.035] * (-1400.914) (-1400.622) [-1400.159] (-1402.590) -- 0:03:17
Average standard deviation of split frequencies: 0.117851
15500 -- [-1399.261] (-1401.490) (-1401.423) (-1398.382) * (-1406.152) (-1400.335) (-1408.279) [-1397.088] -- 0:03:10
16000 -- [-1395.846] (-1404.144) (-1401.276) (-1402.154) * [-1402.651] (-1400.152) (-1397.705) (-1396.959) -- 0:03:04
16500 -- (-1405.127) [-1396.717] (-1407.235) (-1398.229) * (-1404.149) [-1401.673] (-1397.177) (-1401.191) -- 0:02:58
17000 -- [-1395.345] (-1398.066) (-1406.928) (-1402.921) * (-1403.021) (-1404.801) (-1399.660) [-1395.732] -- 0:02:53
17500 -- [-1396.936] (-1397.912) (-1411.078) (-1402.753) * [-1400.898] (-1399.078) (-1407.154) (-1396.821) -- 0:02:48
18000 -- (-1401.531) (-1395.670) (-1400.314) [-1402.293] * [-1397.078] (-1403.914) (-1399.145) (-1397.793) -- 0:02:43
18500 -- [-1400.306] (-1397.542) (-1409.325) (-1399.793) * [-1396.380] (-1401.978) (-1401.080) (-1401.282) -- 0:02:39
19000 -- (-1400.069) (-1397.678) (-1404.480) [-1398.710] * (-1400.768) [-1402.737] (-1398.185) (-1398.218) -- 0:02:34
19500 -- (-1397.699) (-1404.559) [-1398.389] (-1401.372) * (-1399.670) (-1398.256) (-1397.445) [-1401.959] -- 0:02:30
20000 -- (-1403.206) (-1403.826) (-1404.084) [-1396.057] * (-1400.785) (-1402.300) (-1400.556) [-1398.229] -- 0:02:27
Average standard deviation of split frequencies: 0.079835
20500 -- (-1399.670) (-1398.899) (-1397.903) [-1398.906] * (-1399.156) (-1405.211) (-1395.374) [-1404.681] -- 0:02:23
21000 -- (-1398.152) (-1400.234) [-1403.582] (-1402.234) * (-1400.056) (-1401.606) [-1394.293] (-1403.989) -- 0:03:06
21500 -- [-1398.476] (-1401.231) (-1400.300) (-1399.430) * (-1402.423) (-1402.605) [-1399.247] (-1397.776) -- 0:03:02
22000 -- (-1401.541) (-1404.958) (-1401.264) [-1399.225] * [-1400.281] (-1399.889) (-1407.685) (-1399.311) -- 0:02:57
22500 -- (-1401.540) (-1405.109) [-1398.107] (-1401.486) * [-1403.438] (-1405.268) (-1399.548) (-1400.969) -- 0:02:53
23000 -- (-1401.747) (-1399.635) (-1399.444) [-1399.604] * (-1404.716) (-1402.545) (-1402.991) [-1398.769] -- 0:02:49
23500 -- (-1402.668) (-1399.466) (-1394.604) [-1401.978] * [-1403.579] (-1401.758) (-1402.721) (-1399.615) -- 0:02:46
24000 -- (-1400.486) [-1401.985] (-1401.208) (-1398.142) * (-1405.128) (-1403.672) (-1398.999) [-1400.185] -- 0:02:42
24500 -- (-1396.403) (-1398.498) (-1402.594) [-1400.088] * (-1399.565) (-1398.538) [-1398.856] (-1398.106) -- 0:02:39
25000 -- (-1401.918) (-1399.842) [-1406.572] (-1401.117) * (-1396.532) (-1402.065) [-1402.401] (-1400.668) -- 0:02:36
Average standard deviation of split frequencies: 0.036262
25500 -- (-1403.110) [-1401.248] (-1403.646) (-1403.847) * (-1398.508) [-1398.264] (-1404.340) (-1400.627) -- 0:02:32
26000 -- (-1395.101) (-1402.923) (-1404.747) [-1399.451] * (-1402.769) (-1401.094) (-1403.308) [-1398.147] -- 0:02:29
26500 -- (-1402.143) [-1404.795] (-1403.607) (-1397.026) * (-1400.624) [-1396.581] (-1399.262) (-1404.360) -- 0:02:26
27000 -- (-1400.477) (-1398.851) (-1400.627) [-1398.296] * [-1396.965] (-1397.842) (-1397.027) (-1407.343) -- 0:02:24
27500 -- (-1398.430) (-1398.016) (-1403.394) [-1399.242] * (-1396.636) [-1397.376] (-1395.405) (-1397.144) -- 0:02:56
28000 -- (-1398.544) (-1400.500) (-1403.386) [-1399.720] * (-1406.722) (-1407.147) (-1402.847) [-1402.070] -- 0:02:53
28500 -- (-1403.747) (-1402.659) (-1402.911) [-1398.745] * (-1407.267) (-1398.550) (-1398.582) [-1401.471] -- 0:02:50
29000 -- (-1400.535) [-1399.432] (-1403.856) (-1405.715) * (-1401.700) [-1400.683] (-1395.909) (-1402.431) -- 0:02:47
29500 -- (-1403.719) (-1397.307) [-1399.453] (-1405.978) * [-1398.199] (-1409.195) (-1398.315) (-1398.348) -- 0:02:44
30000 -- (-1397.139) (-1399.523) (-1399.103) [-1402.646] * [-1406.741] (-1403.111) (-1403.873) (-1397.676) -- 0:02:41
Average standard deviation of split frequencies: 0.023058
30500 -- (-1396.816) (-1404.254) [-1398.378] (-1407.847) * (-1405.523) (-1398.086) (-1398.491) [-1398.072] -- 0:02:38
31000 -- [-1396.189] (-1402.039) (-1402.841) (-1400.242) * (-1401.102) [-1397.042] (-1401.784) (-1395.609) -- 0:02:36
31500 -- (-1397.496) (-1405.473) (-1405.869) [-1400.321] * (-1404.340) (-1396.844) [-1397.827] (-1396.237) -- 0:02:33
32000 -- (-1399.311) (-1407.786) (-1400.529) [-1401.824] * (-1396.131) [-1398.421] (-1401.632) (-1411.679) -- 0:02:31
32500 -- [-1397.803] (-1401.839) (-1402.468) (-1406.007) * (-1397.360) [-1401.373] (-1400.291) (-1413.240) -- 0:02:28
33000 -- (-1401.588) [-1407.561] (-1402.495) (-1401.887) * [-1399.865] (-1404.409) (-1397.110) (-1400.752) -- 0:02:26
33500 -- (-1402.593) (-1396.921) [-1403.505] (-1395.503) * (-1405.290) [-1403.548] (-1401.817) (-1401.099) -- 0:02:24
34000 -- (-1401.580) (-1396.766) (-1401.505) [-1397.145] * (-1406.473) (-1407.402) [-1397.352] (-1400.989) -- 0:02:50
34500 -- (-1405.600) (-1398.961) [-1397.795] (-1401.400) * [-1404.740] (-1406.760) (-1397.411) (-1399.611) -- 0:02:47
35000 -- (-1413.591) [-1398.873] (-1402.372) (-1399.697) * (-1401.701) (-1404.454) [-1397.954] (-1397.290) -- 0:02:45
Average standard deviation of split frequencies: 0.039284
35500 -- (-1405.470) (-1401.929) [-1404.582] (-1403.614) * (-1399.005) [-1396.458] (-1403.555) (-1408.200) -- 0:02:43
36000 -- (-1400.828) (-1398.992) (-1396.305) [-1401.880] * (-1402.200) (-1396.791) [-1400.215] (-1408.550) -- 0:02:40
36500 -- (-1400.188) [-1395.976] (-1403.693) (-1404.052) * (-1406.661) (-1396.433) [-1400.357] (-1405.712) -- 0:02:38
37000 -- (-1403.203) [-1405.680] (-1402.364) (-1401.807) * (-1404.290) (-1402.215) (-1398.135) [-1398.196] -- 0:02:36
37500 -- (-1402.476) (-1400.358) [-1402.172] (-1399.216) * (-1397.914) (-1396.840) (-1397.012) [-1403.023] -- 0:02:34
38000 -- (-1407.447) [-1398.778] (-1401.078) (-1405.154) * (-1400.116) (-1400.365) [-1392.411] (-1398.806) -- 0:02:31
38500 -- (-1398.137) (-1398.608) (-1400.810) [-1398.942] * (-1404.631) (-1407.264) [-1396.999] (-1400.159) -- 0:02:29
39000 -- (-1414.751) (-1403.551) (-1399.849) [-1399.487] * [-1403.497] (-1400.292) (-1401.571) (-1401.118) -- 0:02:27
39500 -- (-1402.380) (-1399.776) (-1405.747) [-1398.752] * (-1401.737) (-1400.381) [-1393.781] (-1398.547) -- 0:02:25
40000 -- (-1403.378) (-1403.513) (-1398.513) [-1396.639] * [-1401.478] (-1395.877) (-1396.309) (-1401.311) -- 0:02:24
Average standard deviation of split frequencies: 0.011592
40500 -- (-1398.748) (-1403.426) (-1401.534) [-1401.793] * [-1397.392] (-1405.687) (-1395.128) (-1403.428) -- 0:02:45
41000 -- (-1401.895) (-1401.408) [-1399.738] (-1404.353) * (-1401.846) (-1398.040) [-1394.617] (-1402.657) -- 0:02:43
41500 -- (-1410.177) (-1398.546) [-1396.404] (-1397.082) * (-1401.172) (-1399.941) [-1397.600] (-1402.745) -- 0:02:41
42000 -- [-1407.642] (-1397.303) (-1397.249) (-1400.879) * (-1401.954) (-1396.207) (-1397.254) [-1403.304] -- 0:02:39
42500 -- (-1405.255) (-1398.793) [-1402.227] (-1399.347) * (-1394.481) [-1400.387] (-1401.825) (-1403.723) -- 0:02:37
43000 -- (-1397.685) (-1396.309) (-1396.164) [-1396.353] * (-1404.321) [-1399.425] (-1400.040) (-1399.794) -- 0:02:35
43500 -- (-1399.140) (-1401.485) [-1394.227] (-1394.233) * (-1408.940) (-1404.703) [-1397.299] (-1400.941) -- 0:02:33
44000 -- (-1399.865) (-1403.298) [-1396.968] (-1396.479) * [-1407.959] (-1403.768) (-1396.127) (-1397.623) -- 0:02:32
44500 -- (-1405.714) (-1404.013) [-1398.102] (-1401.459) * [-1404.347] (-1397.032) (-1400.557) (-1402.446) -- 0:02:30
45000 -- (-1399.161) (-1398.938) [-1396.442] (-1393.621) * (-1407.157) (-1400.500) [-1402.391] (-1404.735) -- 0:02:28
Average standard deviation of split frequencies: 0.015372
45500 -- (-1399.212) (-1410.507) (-1403.426) [-1398.454] * (-1405.711) (-1403.782) (-1402.666) [-1395.786] -- 0:02:26
46000 -- (-1397.129) [-1401.924] (-1401.698) (-1397.236) * (-1402.992) (-1398.083) (-1398.869) [-1396.341] -- 0:02:25
46500 -- [-1396.586] (-1403.484) (-1402.388) (-1396.487) * (-1400.635) (-1400.524) [-1396.863] (-1396.934) -- 0:02:44
47000 -- [-1395.840] (-1399.703) (-1405.628) (-1399.439) * (-1409.187) (-1402.892) [-1399.766] (-1401.523) -- 0:02:42
47500 -- (-1394.283) [-1398.137] (-1407.452) (-1398.500) * [-1398.356] (-1409.097) (-1398.795) (-1403.957) -- 0:02:40
48000 -- (-1399.153) (-1404.152) (-1400.596) [-1396.783] * (-1401.068) (-1404.187) (-1398.935) [-1397.511] -- 0:02:38
48500 -- [-1400.222] (-1400.079) (-1403.891) (-1401.219) * (-1394.416) (-1403.949) [-1401.488] (-1396.064) -- 0:02:36
49000 -- (-1403.309) [-1399.695] (-1398.679) (-1399.332) * (-1402.045) (-1405.478) (-1397.841) [-1394.393] -- 0:02:35
49500 -- (-1400.398) (-1404.555) (-1401.738) [-1397.771] * (-1401.309) (-1403.987) (-1399.609) [-1396.341] -- 0:02:33
50000 -- [-1403.811] (-1407.875) (-1403.327) (-1396.262) * [-1396.804] (-1407.661) (-1399.371) (-1397.363) -- 0:02:32
Average standard deviation of split frequencies: 0.027912
50500 -- [-1404.699] (-1403.852) (-1400.781) (-1401.716) * [-1397.224] (-1403.296) (-1405.824) (-1397.474) -- 0:02:30
51000 -- (-1399.753) (-1401.521) [-1398.692] (-1398.409) * (-1408.919) (-1397.427) (-1405.757) [-1396.651] -- 0:02:28
51500 -- (-1404.047) (-1409.405) [-1406.900] (-1401.097) * (-1402.007) (-1403.195) (-1394.918) [-1398.892] -- 0:02:45
52000 -- (-1407.663) (-1401.531) (-1399.158) [-1398.033] * (-1406.238) (-1403.282) [-1393.708] (-1397.077) -- 0:02:44
52500 -- (-1410.398) (-1397.802) [-1403.321] (-1396.203) * (-1402.137) [-1401.559] (-1399.620) (-1409.081) -- 0:02:42
53000 -- (-1402.990) (-1402.074) (-1400.192) [-1396.748] * (-1397.222) (-1403.462) (-1399.587) [-1397.946] -- 0:02:40
53500 -- (-1402.974) (-1397.422) [-1397.897] (-1397.402) * [-1397.928] (-1400.441) (-1402.196) (-1401.558) -- 0:02:39
54000 -- (-1399.173) (-1405.674) (-1400.872) [-1399.228] * (-1402.643) [-1399.484] (-1398.886) (-1403.594) -- 0:02:37
54500 -- (-1401.138) (-1412.000) (-1403.932) [-1395.308] * (-1399.561) [-1403.128] (-1401.923) (-1398.767) -- 0:02:36
55000 -- (-1399.203) (-1404.428) [-1403.638] (-1396.492) * (-1394.436) (-1401.784) [-1401.822] (-1397.238) -- 0:02:34
Average standard deviation of split frequencies: 0.033672
55500 -- [-1398.382] (-1402.140) (-1399.313) (-1401.370) * (-1394.740) (-1399.176) (-1400.709) [-1400.402] -- 0:02:33
56000 -- (-1399.073) (-1403.823) [-1394.613] (-1397.987) * (-1395.713) (-1401.619) (-1397.997) [-1401.518] -- 0:02:31
56500 -- (-1402.740) (-1403.980) (-1399.346) [-1402.729] * [-1397.359] (-1406.887) (-1398.536) (-1396.623) -- 0:02:30
57000 -- (-1398.371) (-1408.074) (-1398.767) [-1394.647] * (-1399.146) (-1401.306) (-1400.618) [-1398.157] -- 0:02:28
57500 -- (-1396.709) (-1408.508) (-1400.842) [-1397.378] * (-1399.895) (-1401.546) [-1400.232] (-1400.871) -- 0:02:27
58000 -- (-1398.370) (-1405.792) (-1399.141) [-1398.197] * [-1400.136] (-1400.610) (-1402.712) (-1402.299) -- 0:02:42
58500 -- (-1396.277) (-1400.583) (-1399.693) [-1397.219] * [-1402.079] (-1402.628) (-1402.912) (-1396.974) -- 0:02:40
59000 -- (-1394.993) [-1401.265] (-1400.564) (-1401.137) * (-1400.294) [-1398.437] (-1408.699) (-1397.978) -- 0:02:39
59500 -- (-1398.745) (-1395.289) (-1399.130) [-1396.928] * (-1402.819) [-1400.094] (-1401.311) (-1398.199) -- 0:02:38
60000 -- (-1400.810) (-1400.435) [-1405.629] (-1400.998) * (-1397.779) (-1407.080) (-1402.971) [-1401.637] -- 0:02:36
Average standard deviation of split frequencies: 0.031082
60500 -- (-1401.629) (-1396.012) [-1399.116] (-1397.224) * [-1398.544] (-1400.330) (-1398.607) (-1402.592) -- 0:02:35
61000 -- (-1402.199) [-1396.330] (-1399.234) (-1398.111) * (-1400.830) (-1403.402) [-1401.489] (-1401.016) -- 0:02:33
61500 -- (-1404.285) (-1398.878) (-1414.542) [-1398.636] * (-1402.995) (-1404.647) [-1395.735] (-1399.787) -- 0:02:32
62000 -- (-1401.769) [-1397.958] (-1397.210) (-1399.347) * (-1402.266) (-1407.057) (-1397.168) [-1402.441] -- 0:02:31
62500 -- (-1405.039) [-1399.093] (-1401.543) (-1399.274) * (-1402.532) (-1399.168) (-1397.737) [-1406.727] -- 0:02:30
63000 -- (-1399.699) (-1408.606) [-1396.595] (-1399.067) * (-1402.198) [-1401.717] (-1399.071) (-1406.785) -- 0:02:28
63500 -- (-1400.733) (-1405.801) (-1399.091) [-1403.716] * [-1400.688] (-1401.572) (-1398.297) (-1403.285) -- 0:02:27
64000 -- (-1398.561) (-1409.142) [-1401.248] (-1398.889) * (-1411.026) (-1404.516) (-1401.606) [-1401.951] -- 0:02:40
64500 -- (-1402.223) (-1403.405) [-1395.291] (-1400.701) * (-1395.592) [-1401.311] (-1410.072) (-1402.714) -- 0:02:39
65000 -- (-1402.231) (-1408.160) (-1405.937) [-1401.010] * (-1402.500) (-1399.570) (-1398.998) [-1401.671] -- 0:02:38
Average standard deviation of split frequencies: 0.028570
65500 -- (-1403.991) (-1398.855) (-1404.482) [-1399.894] * (-1396.296) (-1403.164) (-1395.909) [-1404.540] -- 0:02:36
66000 -- [-1400.405] (-1397.191) (-1406.339) (-1396.201) * (-1396.640) [-1396.059] (-1399.397) (-1400.030) -- 0:02:35
66500 -- (-1402.792) (-1400.668) (-1407.174) [-1399.756] * (-1400.982) (-1399.808) (-1404.706) [-1400.735] -- 0:02:34
67000 -- [-1397.750] (-1396.738) (-1403.762) (-1398.649) * (-1403.744) (-1408.163) (-1397.269) [-1399.770] -- 0:02:33
67500 -- (-1401.828) (-1395.197) (-1402.494) [-1396.795] * [-1400.255] (-1403.408) (-1401.041) (-1398.018) -- 0:02:31
68000 -- (-1400.693) (-1397.907) (-1412.010) [-1397.611] * (-1399.792) (-1401.796) (-1400.966) [-1397.770] -- 0:02:30
68500 -- (-1399.022) (-1399.783) (-1402.515) [-1399.208] * (-1402.288) (-1397.564) [-1404.715] (-1397.100) -- 0:02:29
69000 -- (-1408.272) (-1408.931) (-1400.874) [-1397.612] * (-1407.680) (-1396.684) [-1405.524] (-1400.097) -- 0:02:28
69500 -- (-1406.791) (-1399.797) (-1399.130) [-1396.539] * (-1403.535) (-1395.920) [-1400.105] (-1397.733) -- 0:02:27
70000 -- (-1404.907) [-1396.913] (-1404.357) (-1412.136) * (-1399.411) (-1398.182) [-1400.143] (-1397.917) -- 0:02:26
Average standard deviation of split frequencies: 0.030019
70500 -- (-1402.235) (-1397.894) [-1401.598] (-1400.993) * (-1401.717) [-1399.906] (-1394.770) (-1404.073) -- 0:02:38
71000 -- (-1403.002) (-1402.810) (-1402.094) [-1400.220] * (-1398.924) (-1408.168) (-1404.295) [-1396.986] -- 0:02:37
71500 -- (-1397.435) [-1395.403] (-1406.228) (-1408.562) * (-1400.329) [-1399.308] (-1396.515) (-1405.829) -- 0:02:35
72000 -- (-1399.563) (-1400.193) (-1400.533) [-1398.110] * (-1393.993) [-1396.490] (-1402.595) (-1402.962) -- 0:02:34
72500 -- (-1394.618) [-1396.725] (-1399.504) (-1399.546) * (-1402.071) [-1400.435] (-1398.152) (-1400.226) -- 0:02:33
73000 -- (-1396.915) [-1396.786] (-1397.713) (-1396.700) * (-1396.972) (-1397.821) [-1400.025] (-1402.631) -- 0:02:32
73500 -- (-1399.137) [-1397.930] (-1403.559) (-1406.477) * [-1396.105] (-1400.345) (-1396.793) (-1399.843) -- 0:02:31
74000 -- (-1398.961) [-1401.150] (-1397.570) (-1403.630) * [-1404.629] (-1399.660) (-1399.104) (-1402.847) -- 0:02:30
74500 -- [-1398.692] (-1402.889) (-1405.688) (-1399.230) * (-1400.715) [-1396.721] (-1403.225) (-1408.362) -- 0:02:29
75000 -- [-1397.002] (-1405.177) (-1402.533) (-1400.367) * (-1404.821) (-1400.473) [-1396.047] (-1393.805) -- 0:02:28
Average standard deviation of split frequencies: 0.037216
75500 -- (-1397.497) [-1402.712] (-1397.039) (-1397.845) * (-1396.760) (-1398.729) [-1398.093] (-1397.980) -- 0:02:26
76000 -- (-1395.378) (-1397.055) [-1396.296] (-1401.871) * (-1397.219) (-1398.442) (-1401.550) [-1398.173] -- 0:02:25
76500 -- [-1400.664] (-1398.700) (-1402.090) (-1399.098) * (-1401.843) (-1399.431) [-1404.608] (-1396.286) -- 0:02:24
77000 -- (-1397.926) [-1398.249] (-1403.486) (-1402.292) * [-1397.881] (-1401.609) (-1399.914) (-1398.769) -- 0:02:35
77500 -- (-1398.922) [-1401.221] (-1398.307) (-1401.796) * (-1403.087) [-1396.748] (-1401.192) (-1404.754) -- 0:02:34
78000 -- (-1409.172) [-1402.126] (-1399.665) (-1402.368) * (-1396.770) (-1401.724) [-1399.316] (-1402.503) -- 0:02:33
78500 -- (-1397.749) [-1402.554] (-1399.859) (-1401.290) * (-1398.313) (-1400.777) [-1399.813] (-1399.068) -- 0:02:32
79000 -- [-1400.333] (-1401.523) (-1412.158) (-1401.195) * (-1402.238) (-1400.482) (-1399.363) [-1399.408] -- 0:02:31
79500 -- [-1394.774] (-1397.720) (-1402.499) (-1398.758) * (-1396.814) [-1401.429] (-1401.599) (-1399.219) -- 0:02:30
80000 -- [-1406.211] (-1407.794) (-1405.473) (-1407.608) * [-1400.398] (-1398.557) (-1398.467) (-1408.765) -- 0:02:29
Average standard deviation of split frequencies: 0.032141
80500 -- (-1404.674) [-1405.092] (-1403.343) (-1402.716) * (-1407.031) [-1402.124] (-1400.948) (-1401.154) -- 0:02:28
81000 -- (-1401.950) [-1407.831] (-1402.789) (-1399.187) * (-1404.219) (-1405.458) (-1400.495) [-1399.667] -- 0:02:27
81500 -- (-1401.387) [-1401.260] (-1396.694) (-1400.057) * [-1400.463] (-1403.711) (-1399.536) (-1408.512) -- 0:02:26
82000 -- (-1398.158) (-1401.541) [-1395.295] (-1400.874) * (-1397.588) (-1397.614) [-1397.643] (-1404.008) -- 0:02:25
82500 -- [-1399.942] (-1409.434) (-1396.494) (-1402.613) * (-1401.204) [-1399.819] (-1396.569) (-1401.669) -- 0:02:24
83000 -- (-1394.830) [-1402.036] (-1397.667) (-1403.944) * (-1401.463) (-1402.402) [-1395.031] (-1397.151) -- 0:02:34
83500 -- [-1401.742] (-1403.095) (-1400.321) (-1403.000) * (-1397.384) (-1403.439) (-1400.851) [-1399.834] -- 0:02:33
84000 -- (-1396.935) (-1402.149) (-1399.163) [-1398.917] * (-1400.446) (-1397.726) (-1395.171) [-1394.789] -- 0:02:32
84500 -- (-1403.053) [-1403.612] (-1403.442) (-1399.071) * (-1399.249) (-1400.995) (-1397.855) [-1395.267] -- 0:02:31
85000 -- (-1399.674) (-1407.943) [-1395.418] (-1408.920) * (-1404.669) (-1396.660) (-1400.470) [-1395.685] -- 0:02:30
Average standard deviation of split frequencies: 0.035629
85500 -- (-1401.782) [-1400.561] (-1400.716) (-1401.729) * [-1400.855] (-1399.995) (-1395.816) (-1397.434) -- 0:02:29
86000 -- [-1401.432] (-1400.129) (-1399.922) (-1405.293) * (-1400.616) (-1408.409) (-1402.011) [-1396.798] -- 0:02:28
86500 -- (-1400.963) (-1403.669) [-1398.232] (-1403.886) * [-1404.646] (-1409.340) (-1412.811) (-1399.871) -- 0:02:27
87000 -- [-1396.618] (-1408.999) (-1400.377) (-1396.965) * (-1411.099) (-1410.840) (-1408.526) [-1394.167] -- 0:02:26
87500 -- [-1396.052] (-1406.154) (-1399.287) (-1399.671) * (-1402.630) (-1408.750) [-1406.392] (-1402.346) -- 0:02:26
88000 -- (-1402.671) [-1404.269] (-1398.589) (-1406.201) * (-1399.942) (-1413.239) (-1408.015) [-1395.931] -- 0:02:25
88500 -- (-1400.494) (-1410.789) (-1399.927) [-1402.252] * (-1402.663) [-1400.795] (-1408.231) (-1397.419) -- 0:02:24
89000 -- (-1398.517) [-1404.882] (-1399.512) (-1404.475) * (-1401.410) [-1405.700] (-1399.868) (-1403.255) -- 0:02:23
89500 -- [-1401.744] (-1401.266) (-1400.140) (-1405.579) * (-1401.560) (-1399.903) [-1400.888] (-1396.232) -- 0:02:32
90000 -- (-1402.795) (-1401.858) [-1396.292] (-1409.017) * (-1401.094) (-1404.070) [-1399.558] (-1402.347) -- 0:02:31
Average standard deviation of split frequencies: 0.031196
90500 -- [-1397.704] (-1407.917) (-1400.503) (-1404.129) * (-1406.334) (-1401.050) (-1399.076) [-1396.853] -- 0:02:30
91000 -- (-1401.330) (-1400.859) [-1399.810] (-1407.729) * (-1403.438) [-1398.535] (-1399.930) (-1398.734) -- 0:02:29
91500 -- (-1398.578) [-1405.330] (-1405.839) (-1407.728) * (-1405.026) (-1403.287) (-1408.389) [-1398.046] -- 0:02:28
92000 -- (-1402.254) (-1399.260) [-1400.288] (-1403.670) * (-1399.666) [-1398.035] (-1402.874) (-1396.280) -- 0:02:28
92500 -- (-1406.941) (-1399.936) [-1398.591] (-1400.229) * [-1399.199] (-1403.395) (-1407.319) (-1406.877) -- 0:02:27
93000 -- (-1405.537) (-1406.447) [-1401.005] (-1404.873) * (-1395.824) (-1401.592) (-1396.153) [-1394.331] -- 0:02:26
93500 -- (-1403.674) (-1401.274) [-1401.337] (-1407.427) * [-1403.138] (-1404.427) (-1397.922) (-1402.343) -- 0:02:25
94000 -- (-1401.246) (-1401.287) [-1404.743] (-1398.441) * [-1398.289] (-1403.786) (-1396.622) (-1396.592) -- 0:02:24
94500 -- [-1398.880] (-1396.694) (-1401.655) (-1398.985) * (-1399.239) [-1402.184] (-1400.232) (-1404.874) -- 0:02:23
95000 -- (-1399.339) (-1399.118) (-1401.021) [-1398.630] * [-1402.625] (-1398.863) (-1396.237) (-1398.818) -- 0:02:22
Average standard deviation of split frequencies: 0.024552
95500 -- (-1402.288) (-1398.147) (-1406.169) [-1397.853] * [-1399.735] (-1404.092) (-1398.612) (-1400.240) -- 0:02:22
96000 -- [-1397.373] (-1397.319) (-1402.990) (-1404.351) * (-1397.814) (-1406.704) (-1397.114) [-1393.415] -- 0:02:30
96500 -- [-1395.125] (-1404.030) (-1398.135) (-1397.105) * [-1408.629] (-1397.999) (-1398.929) (-1397.094) -- 0:02:29
97000 -- (-1395.578) (-1406.482) (-1400.934) [-1394.649] * (-1408.828) (-1395.609) [-1395.110] (-1396.317) -- 0:02:28
97500 -- (-1396.454) (-1402.117) (-1401.227) [-1398.340] * [-1401.991] (-1397.237) (-1399.354) (-1403.225) -- 0:02:28
98000 -- (-1395.704) (-1399.894) [-1395.457] (-1399.354) * (-1405.973) [-1400.057] (-1400.632) (-1407.651) -- 0:02:27
98500 -- [-1395.178] (-1397.599) (-1397.773) (-1403.702) * [-1402.315] (-1401.668) (-1396.143) (-1400.878) -- 0:02:26
99000 -- (-1398.733) (-1406.492) [-1397.626] (-1396.306) * (-1400.411) (-1401.938) [-1398.595] (-1399.860) -- 0:02:25
99500 -- [-1399.202] (-1400.390) (-1396.251) (-1394.979) * (-1400.941) (-1400.147) (-1399.130) [-1399.501] -- 0:02:24
100000 -- (-1407.759) (-1402.389) [-1396.741] (-1400.981) * (-1402.547) [-1398.231] (-1403.434) (-1396.382) -- 0:02:24
Average standard deviation of split frequencies: 0.016390
100500 -- (-1396.308) [-1396.214] (-1400.601) (-1399.041) * [-1399.549] (-1400.920) (-1402.552) (-1399.635) -- 0:02:23
101000 -- (-1400.465) [-1399.315] (-1402.641) (-1400.561) * (-1401.222) (-1396.592) [-1404.834] (-1398.743) -- 0:02:22
101500 -- [-1395.768] (-1411.430) (-1400.718) (-1395.360) * (-1398.190) (-1403.823) [-1407.123] (-1399.483) -- 0:02:21
102000 -- [-1395.726] (-1406.030) (-1398.096) (-1400.113) * [-1395.467] (-1396.684) (-1402.486) (-1398.803) -- 0:02:20
102500 -- [-1396.422] (-1402.873) (-1395.678) (-1400.033) * (-1397.929) (-1399.832) [-1399.464] (-1405.346) -- 0:02:28
103000 -- (-1400.346) (-1402.782) [-1398.346] (-1400.702) * (-1407.007) [-1401.043] (-1407.256) (-1395.497) -- 0:02:28
103500 -- (-1398.557) (-1400.029) [-1398.756] (-1400.603) * [-1396.785] (-1396.310) (-1403.661) (-1397.627) -- 0:02:27
104000 -- (-1399.479) (-1400.521) (-1398.036) [-1404.313] * (-1400.295) [-1401.361] (-1404.330) (-1399.803) -- 0:02:26
104500 -- [-1399.137] (-1402.388) (-1401.436) (-1409.306) * (-1399.233) [-1398.605] (-1402.425) (-1403.916) -- 0:02:25
105000 -- (-1399.643) [-1398.248] (-1395.785) (-1397.681) * (-1398.666) [-1406.305] (-1404.120) (-1402.946) -- 0:02:24
Average standard deviation of split frequencies: 0.017789
105500 -- (-1396.622) (-1401.847) [-1394.086] (-1400.479) * (-1402.320) (-1397.882) [-1403.426] (-1405.339) -- 0:02:24
106000 -- [-1405.345] (-1400.431) (-1396.090) (-1403.990) * (-1402.397) (-1401.774) [-1402.435] (-1407.449) -- 0:02:23
106500 -- (-1403.083) (-1402.955) (-1397.948) [-1402.588] * (-1400.579) (-1403.998) [-1400.937] (-1404.042) -- 0:02:22
107000 -- (-1403.012) (-1396.992) [-1397.535] (-1399.189) * (-1402.525) (-1402.073) [-1395.363] (-1407.322) -- 0:02:21
107500 -- (-1403.871) (-1397.374) [-1399.046] (-1394.862) * (-1397.647) [-1394.221] (-1402.355) (-1412.620) -- 0:02:21
108000 -- [-1399.277] (-1401.032) (-1402.126) (-1402.913) * (-1396.187) [-1399.760] (-1398.210) (-1407.122) -- 0:02:20
108500 -- (-1410.036) (-1397.195) [-1396.736] (-1395.466) * (-1402.159) [-1399.202] (-1403.428) (-1403.003) -- 0:02:27
109000 -- (-1401.881) (-1396.593) [-1395.201] (-1410.460) * (-1404.120) [-1406.800] (-1401.399) (-1402.248) -- 0:02:27
109500 -- (-1406.736) [-1398.575] (-1393.153) (-1398.303) * (-1402.762) (-1405.145) (-1404.030) [-1397.158] -- 0:02:26
110000 -- (-1405.854) (-1396.424) (-1394.765) [-1398.222] * (-1410.672) (-1397.823) (-1399.087) [-1400.579] -- 0:02:25
Average standard deviation of split frequencies: 0.021298
110500 -- (-1402.961) (-1398.834) (-1396.018) [-1397.459] * (-1407.137) [-1395.734] (-1399.045) (-1398.111) -- 0:02:24
111000 -- (-1412.928) (-1398.984) [-1399.670] (-1397.692) * [-1403.027] (-1396.426) (-1396.592) (-1395.896) -- 0:02:24
111500 -- (-1409.029) (-1398.749) [-1396.932] (-1395.428) * (-1403.834) [-1397.106] (-1399.810) (-1400.429) -- 0:02:23
112000 -- (-1409.944) [-1395.433] (-1403.424) (-1396.528) * (-1405.369) (-1400.216) (-1398.770) [-1396.397] -- 0:02:22
112500 -- (-1409.181) (-1407.753) [-1398.625] (-1401.389) * (-1408.178) (-1399.411) (-1395.226) [-1396.930] -- 0:02:22
113000 -- [-1399.956] (-1402.708) (-1404.150) (-1401.669) * (-1398.390) (-1397.860) [-1397.022] (-1398.153) -- 0:02:21
113500 -- (-1410.792) [-1398.423] (-1402.505) (-1399.476) * [-1397.074] (-1404.632) (-1402.405) (-1397.839) -- 0:02:20
114000 -- (-1408.461) (-1397.316) [-1399.876] (-1401.922) * (-1398.209) (-1410.236) [-1399.206] (-1398.535) -- 0:02:19
114500 -- (-1408.022) [-1398.614] (-1399.492) (-1400.958) * [-1407.216] (-1405.177) (-1399.034) (-1402.562) -- 0:02:19
115000 -- (-1402.511) [-1397.667] (-1399.642) (-1399.706) * (-1405.358) (-1404.353) (-1402.962) [-1398.514] -- 0:02:26
Average standard deviation of split frequencies: 0.020319
115500 -- (-1400.090) (-1406.427) [-1399.660] (-1394.972) * (-1403.082) [-1398.024] (-1404.540) (-1402.145) -- 0:02:25
116000 -- (-1404.694) (-1401.534) (-1403.821) [-1398.538] * (-1402.805) [-1402.824] (-1400.765) (-1403.161) -- 0:02:24
116500 -- (-1402.087) (-1401.761) [-1403.220] (-1401.106) * (-1401.099) (-1403.109) (-1399.587) [-1405.059] -- 0:02:24
117000 -- (-1402.968) [-1406.687] (-1403.643) (-1406.496) * (-1404.632) (-1398.749) (-1402.705) [-1398.930] -- 0:02:23
117500 -- (-1400.308) [-1400.111] (-1401.150) (-1402.460) * [-1406.808] (-1405.815) (-1397.064) (-1397.022) -- 0:02:22
118000 -- (-1409.130) (-1402.964) (-1407.319) [-1399.597] * (-1400.783) [-1400.013] (-1400.801) (-1398.113) -- 0:02:22
118500 -- [-1400.073] (-1397.814) (-1409.469) (-1408.337) * (-1401.943) (-1398.401) [-1402.373] (-1398.899) -- 0:02:21
119000 -- [-1394.171] (-1404.901) (-1404.906) (-1408.424) * (-1399.061) (-1397.252) [-1403.832] (-1397.308) -- 0:02:20
119500 -- [-1397.524] (-1401.255) (-1401.338) (-1412.029) * (-1396.605) (-1400.148) (-1403.933) [-1398.189] -- 0:02:19
120000 -- [-1395.608] (-1401.191) (-1402.548) (-1400.877) * (-1399.388) [-1400.926] (-1401.929) (-1395.717) -- 0:02:19
Average standard deviation of split frequencies: 0.023440
120500 -- [-1398.664] (-1405.160) (-1403.815) (-1405.365) * (-1405.722) (-1400.271) (-1399.686) [-1398.967] -- 0:02:18
121000 -- (-1398.457) (-1396.621) [-1400.044] (-1400.489) * (-1404.245) (-1400.886) (-1399.910) [-1401.400] -- 0:02:18
121500 -- (-1397.817) [-1399.182] (-1397.119) (-1399.445) * (-1400.542) (-1402.064) (-1399.260) [-1399.879] -- 0:02:24
122000 -- (-1400.753) (-1396.033) [-1398.113] (-1403.058) * (-1400.063) (-1401.289) (-1403.140) [-1399.365] -- 0:02:23
122500 -- [-1398.022] (-1396.721) (-1398.018) (-1402.398) * (-1403.234) (-1402.120) [-1397.037] (-1405.020) -- 0:02:23
123000 -- (-1395.749) (-1402.125) [-1396.417] (-1405.603) * (-1410.994) [-1397.317] (-1397.123) (-1399.970) -- 0:02:22
123500 -- (-1400.117) (-1400.592) [-1397.103] (-1400.949) * (-1406.198) [-1397.319] (-1403.538) (-1403.112) -- 0:02:21
124000 -- (-1400.359) (-1402.222) (-1398.281) [-1399.369] * (-1397.769) (-1397.172) (-1397.662) [-1402.228] -- 0:02:21
124500 -- [-1398.701] (-1401.627) (-1401.347) (-1404.447) * (-1401.598) (-1407.248) [-1399.664] (-1400.448) -- 0:02:20
125000 -- (-1398.929) (-1404.894) [-1395.153] (-1408.733) * (-1402.361) (-1402.693) [-1398.473] (-1411.368) -- 0:02:20
Average standard deviation of split frequencies: 0.016836
125500 -- (-1396.256) [-1401.971] (-1394.822) (-1403.161) * (-1405.984) [-1399.029] (-1400.535) (-1403.058) -- 0:02:19
126000 -- (-1395.461) [-1399.654] (-1401.901) (-1399.545) * (-1401.314) [-1400.493] (-1395.515) (-1404.684) -- 0:02:18
126500 -- (-1399.523) (-1402.074) [-1396.006] (-1402.323) * (-1401.992) (-1399.765) (-1405.654) [-1399.695] -- 0:02:18
127000 -- [-1393.653] (-1401.749) (-1396.745) (-1399.779) * (-1400.711) (-1401.198) [-1398.230] (-1398.422) -- 0:02:17
127500 -- (-1402.125) (-1403.391) (-1399.523) [-1399.265] * [-1404.291] (-1400.737) (-1400.814) (-1400.754) -- 0:02:16
128000 -- [-1399.092] (-1395.685) (-1397.304) (-1403.588) * (-1405.031) (-1394.116) [-1396.457] (-1403.573) -- 0:02:23
128500 -- (-1401.621) [-1395.084] (-1398.565) (-1394.754) * (-1408.585) [-1398.787] (-1403.569) (-1396.305) -- 0:02:22
129000 -- (-1397.256) [-1395.895] (-1401.265) (-1401.904) * (-1404.438) (-1396.194) [-1399.688] (-1397.842) -- 0:02:21
129500 -- (-1401.363) [-1395.999] (-1404.306) (-1401.342) * (-1398.615) [-1395.800] (-1404.148) (-1408.082) -- 0:02:21
130000 -- (-1404.137) (-1397.287) [-1399.513] (-1394.899) * (-1400.086) (-1401.698) [-1401.587] (-1398.778) -- 0:02:20
Average standard deviation of split frequencies: 0.023450
130500 -- (-1396.363) (-1394.821) [-1401.682] (-1405.591) * (-1399.932) (-1400.117) (-1400.658) [-1403.560] -- 0:02:19
131000 -- [-1397.258] (-1396.514) (-1412.878) (-1397.374) * (-1396.565) (-1399.102) (-1402.948) [-1400.678] -- 0:02:19
131500 -- (-1395.984) (-1397.983) (-1412.042) [-1401.071] * (-1396.554) (-1404.836) (-1398.128) [-1400.948] -- 0:02:18
132000 -- (-1398.723) (-1406.308) [-1404.790] (-1401.595) * (-1401.904) (-1401.292) (-1407.805) [-1408.936] -- 0:02:18
132500 -- (-1397.925) (-1398.115) [-1399.770] (-1400.410) * (-1398.883) (-1403.693) [-1396.110] (-1402.174) -- 0:02:17
133000 -- (-1403.725) [-1397.442] (-1396.063) (-1403.695) * (-1397.389) (-1402.811) [-1398.554] (-1402.906) -- 0:02:16
133500 -- [-1402.570] (-1400.688) (-1400.076) (-1407.437) * [-1395.916] (-1407.401) (-1402.942) (-1401.051) -- 0:02:16
134000 -- (-1398.499) (-1407.801) [-1399.417] (-1407.578) * [-1394.631] (-1407.884) (-1397.013) (-1402.706) -- 0:02:22
134500 -- [-1396.220] (-1408.343) (-1403.425) (-1402.242) * (-1396.933) (-1400.967) [-1398.081] (-1396.874) -- 0:02:21
135000 -- (-1398.415) (-1404.198) [-1400.566] (-1410.986) * (-1399.350) (-1405.120) (-1400.475) [-1401.323] -- 0:02:20
Average standard deviation of split frequencies: 0.017331
135500 -- (-1397.656) (-1402.567) (-1397.588) [-1407.183] * [-1402.771] (-1406.430) (-1400.010) (-1400.034) -- 0:02:20
136000 -- (-1398.427) (-1402.099) [-1400.603] (-1404.311) * (-1395.406) [-1398.325] (-1404.034) (-1399.337) -- 0:02:19
136500 -- (-1400.893) (-1404.857) [-1396.962] (-1401.971) * (-1395.582) (-1395.811) (-1400.889) [-1400.763] -- 0:02:19
137000 -- (-1401.363) [-1399.816] (-1400.188) (-1402.607) * (-1406.327) [-1398.331] (-1400.208) (-1407.927) -- 0:02:18
137500 -- [-1403.869] (-1403.295) (-1400.030) (-1411.857) * [-1397.725] (-1409.489) (-1401.408) (-1403.652) -- 0:02:18
138000 -- (-1404.420) (-1408.273) (-1396.082) [-1405.098] * (-1395.500) (-1403.404) [-1396.896] (-1405.612) -- 0:02:17
138500 -- (-1409.835) (-1406.710) (-1395.675) [-1398.864] * [-1397.861] (-1411.112) (-1404.390) (-1406.791) -- 0:02:16
139000 -- (-1408.799) (-1398.855) [-1402.156] (-1394.509) * [-1397.260] (-1399.830) (-1398.718) (-1404.823) -- 0:02:16
139500 -- (-1407.718) (-1401.884) [-1401.923] (-1401.998) * [-1396.860] (-1403.383) (-1397.868) (-1402.356) -- 0:02:15
140000 -- (-1406.687) (-1400.345) (-1398.722) [-1401.345] * (-1403.638) [-1395.253] (-1398.964) (-1401.032) -- 0:02:15
Average standard deviation of split frequencies: 0.016756
140500 -- (-1406.421) (-1398.364) (-1399.210) [-1398.636] * (-1400.997) (-1403.970) [-1398.359] (-1404.007) -- 0:02:20
141000 -- (-1401.525) [-1398.645] (-1399.569) (-1400.957) * (-1407.881) (-1401.053) [-1401.464] (-1406.034) -- 0:02:20
141500 -- (-1399.210) (-1398.550) (-1399.387) [-1404.832] * (-1403.322) [-1397.429] (-1397.285) (-1404.852) -- 0:02:19
142000 -- (-1402.167) [-1396.113] (-1402.764) (-1401.440) * (-1403.944) (-1397.882) (-1398.917) [-1398.280] -- 0:02:18
142500 -- (-1403.612) (-1399.790) [-1403.099] (-1405.072) * (-1403.567) [-1398.999] (-1401.607) (-1402.088) -- 0:02:18
143000 -- (-1402.527) [-1398.902] (-1399.332) (-1404.483) * (-1409.392) (-1399.360) (-1402.170) [-1400.932] -- 0:02:17
143500 -- (-1396.140) (-1402.084) (-1398.344) [-1398.488] * (-1406.167) (-1399.768) [-1401.547] (-1405.033) -- 0:02:17
144000 -- (-1399.808) (-1399.717) (-1399.971) [-1395.900] * (-1402.546) (-1398.428) (-1401.525) [-1398.276] -- 0:02:16
144500 -- (-1399.282) (-1406.239) (-1402.194) [-1397.578] * (-1403.339) [-1398.153] (-1403.776) (-1407.228) -- 0:02:16
145000 -- (-1396.200) (-1398.487) (-1402.172) [-1394.785] * (-1399.380) (-1402.136) [-1394.787] (-1407.272) -- 0:02:15
Average standard deviation of split frequencies: 0.017758
145500 -- (-1402.174) [-1401.665] (-1403.491) (-1393.814) * (-1399.606) (-1401.427) (-1399.861) [-1397.392] -- 0:02:15
146000 -- (-1398.223) (-1402.277) [-1401.971] (-1401.033) * (-1398.507) (-1398.520) [-1400.176] (-1395.316) -- 0:02:14
146500 -- (-1406.803) (-1401.824) (-1397.459) [-1401.490] * [-1395.525] (-1400.174) (-1394.194) (-1400.797) -- 0:02:13
147000 -- (-1400.142) [-1402.195] (-1394.889) (-1401.005) * (-1396.059) (-1396.783) [-1395.902] (-1395.023) -- 0:02:19
147500 -- [-1403.656] (-1404.962) (-1404.567) (-1399.552) * (-1396.682) [-1402.498] (-1402.500) (-1401.714) -- 0:02:18
148000 -- (-1403.530) (-1396.618) (-1406.434) [-1396.750] * (-1401.295) (-1404.894) [-1401.205] (-1397.078) -- 0:02:18
148500 -- (-1403.350) [-1398.030] (-1402.403) (-1402.144) * [-1398.184] (-1400.867) (-1398.049) (-1401.643) -- 0:02:17
149000 -- [-1407.039] (-1394.900) (-1404.714) (-1395.766) * [-1397.606] (-1401.917) (-1396.229) (-1402.432) -- 0:02:17
149500 -- (-1400.033) [-1401.016] (-1405.426) (-1396.137) * (-1401.181) (-1396.593) [-1397.363] (-1408.943) -- 0:02:16
150000 -- (-1397.822) (-1402.690) (-1405.876) [-1401.200] * (-1402.838) [-1398.442] (-1399.328) (-1410.928) -- 0:02:16
Average standard deviation of split frequencies: 0.010951
150500 -- (-1403.542) [-1396.144] (-1406.229) (-1397.350) * (-1402.519) (-1404.607) [-1401.921] (-1404.513) -- 0:02:15
151000 -- [-1400.480] (-1394.887) (-1406.053) (-1397.508) * [-1398.457] (-1404.154) (-1402.294) (-1398.629) -- 0:02:14
151500 -- [-1398.933] (-1402.137) (-1399.466) (-1397.261) * (-1404.978) [-1398.501] (-1406.747) (-1397.583) -- 0:02:14
152000 -- (-1402.514) [-1401.552] (-1401.163) (-1403.228) * (-1398.654) (-1398.778) [-1401.281] (-1396.337) -- 0:02:13
152500 -- (-1401.686) [-1399.155] (-1408.477) (-1403.670) * (-1399.688) (-1399.496) [-1395.953] (-1395.767) -- 0:02:13
153000 -- [-1403.496] (-1397.354) (-1405.646) (-1404.230) * (-1398.755) (-1400.666) [-1394.715] (-1402.956) -- 0:02:18
153500 -- (-1407.516) [-1402.005] (-1403.048) (-1400.513) * (-1399.017) [-1400.559] (-1399.824) (-1398.400) -- 0:02:17
154000 -- (-1405.560) [-1399.396] (-1406.070) (-1401.167) * [-1397.976] (-1399.132) (-1396.932) (-1400.345) -- 0:02:17
154500 -- [-1396.480] (-1401.352) (-1408.173) (-1402.342) * (-1402.037) (-1399.078) [-1402.028] (-1405.376) -- 0:02:16
155000 -- (-1397.708) (-1399.640) [-1398.314] (-1401.574) * [-1403.036] (-1407.194) (-1395.667) (-1405.844) -- 0:02:16
Average standard deviation of split frequencies: 0.010576
155500 -- (-1407.638) (-1401.587) [-1398.582] (-1395.506) * [-1401.294] (-1403.061) (-1398.349) (-1402.547) -- 0:02:15
156000 -- (-1403.382) (-1397.073) (-1395.978) [-1398.751] * (-1398.420) (-1402.178) (-1402.572) [-1396.845] -- 0:02:15
156500 -- (-1400.771) (-1402.529) [-1396.849] (-1398.975) * (-1397.794) (-1402.830) (-1405.960) [-1397.551] -- 0:02:14
157000 -- (-1402.385) [-1398.776] (-1399.898) (-1395.828) * [-1398.008] (-1406.421) (-1401.433) (-1406.539) -- 0:02:14
157500 -- (-1405.306) (-1407.859) [-1399.329] (-1406.361) * (-1409.919) (-1400.626) (-1400.935) [-1399.559] -- 0:02:13
158000 -- [-1402.778] (-1404.838) (-1399.171) (-1396.922) * (-1401.506) (-1404.704) (-1400.759) [-1399.982] -- 0:02:13
158500 -- (-1407.928) (-1397.220) [-1395.678] (-1395.331) * [-1399.481] (-1405.431) (-1401.238) (-1400.940) -- 0:02:12
159000 -- [-1398.616] (-1401.466) (-1398.010) (-1403.767) * (-1397.218) (-1408.469) [-1404.208] (-1400.403) -- 0:02:12
159500 -- (-1405.525) [-1396.451] (-1402.676) (-1403.667) * (-1398.448) (-1405.631) [-1394.281] (-1396.066) -- 0:02:17
160000 -- (-1398.808) [-1400.839] (-1400.700) (-1399.068) * [-1400.181] (-1405.467) (-1397.470) (-1401.642) -- 0:02:16
Average standard deviation of split frequencies: 0.010269
160500 -- (-1399.159) (-1396.945) [-1395.997] (-1401.607) * (-1401.716) (-1402.223) [-1406.211] (-1397.330) -- 0:02:15
161000 -- (-1397.672) [-1399.213] (-1400.965) (-1401.406) * (-1403.236) (-1400.771) (-1403.481) [-1399.510] -- 0:02:15
161500 -- (-1403.329) (-1398.439) [-1397.703] (-1403.642) * (-1410.122) (-1407.485) (-1398.167) [-1395.699] -- 0:02:14
162000 -- (-1407.811) (-1399.466) [-1404.371] (-1399.052) * (-1405.613) [-1398.958] (-1399.689) (-1398.285) -- 0:02:14
162500 -- (-1408.108) [-1398.568] (-1397.852) (-1403.977) * [-1398.391] (-1402.101) (-1408.466) (-1399.399) -- 0:02:14
163000 -- (-1405.289) [-1404.667] (-1398.207) (-1402.055) * (-1403.478) (-1400.311) [-1396.557] (-1400.416) -- 0:02:13
163500 -- (-1401.542) (-1401.004) [-1400.097] (-1399.277) * (-1407.534) (-1400.092) (-1404.756) [-1396.713] -- 0:02:13
164000 -- [-1402.399] (-1401.675) (-1397.637) (-1406.273) * [-1409.729] (-1404.435) (-1402.663) (-1398.561) -- 0:02:12
164500 -- (-1400.668) (-1400.093) (-1395.260) [-1396.909] * (-1403.263) (-1404.722) (-1395.529) [-1400.282] -- 0:02:12
165000 -- [-1400.324] (-1396.031) (-1405.327) (-1395.108) * (-1416.283) (-1405.142) (-1404.494) [-1399.093] -- 0:02:11
Average standard deviation of split frequencies: 0.008519
165500 -- [-1400.723] (-1401.666) (-1396.565) (-1406.816) * (-1405.451) [-1405.124] (-1399.559) (-1399.140) -- 0:02:16
166000 -- (-1400.972) [-1402.244] (-1400.138) (-1399.203) * [-1399.759] (-1410.526) (-1407.418) (-1397.645) -- 0:02:15
166500 -- [-1401.263] (-1400.948) (-1400.614) (-1403.581) * (-1397.482) (-1404.376) (-1396.686) [-1398.197] -- 0:02:15
167000 -- [-1402.002] (-1398.257) (-1403.236) (-1401.429) * (-1402.277) (-1405.927) [-1398.776] (-1398.619) -- 0:02:14
167500 -- (-1403.420) [-1400.514] (-1404.067) (-1408.665) * [-1395.849] (-1403.784) (-1399.666) (-1403.822) -- 0:02:14
168000 -- [-1399.139] (-1408.683) (-1404.008) (-1402.867) * (-1398.978) [-1399.904] (-1401.134) (-1402.166) -- 0:02:13
168500 -- (-1399.293) (-1398.517) (-1398.763) [-1398.427] * [-1395.564] (-1400.008) (-1400.691) (-1399.225) -- 0:02:13
169000 -- (-1403.503) (-1397.036) (-1400.911) [-1398.027] * (-1401.193) (-1405.674) (-1396.730) [-1401.736] -- 0:02:12
169500 -- (-1398.943) [-1397.538] (-1403.742) (-1407.859) * [-1406.734] (-1405.051) (-1400.423) (-1400.022) -- 0:02:12
170000 -- (-1403.795) [-1396.943] (-1398.089) (-1394.690) * (-1407.581) [-1400.486] (-1397.142) (-1399.366) -- 0:02:11
Average standard deviation of split frequencies: 0.011049
170500 -- [-1400.108] (-1397.188) (-1407.950) (-1398.194) * (-1402.335) [-1399.654] (-1400.329) (-1404.160) -- 0:02:11
171000 -- (-1400.997) (-1399.947) (-1402.963) [-1397.984] * [-1401.464] (-1398.860) (-1399.295) (-1398.893) -- 0:02:10
171500 -- (-1403.697) [-1396.523] (-1404.837) (-1397.079) * (-1402.424) [-1398.400] (-1396.049) (-1401.206) -- 0:02:10
172000 -- (-1398.526) [-1401.170] (-1397.239) (-1399.525) * (-1401.997) (-1400.339) (-1402.836) [-1404.911] -- 0:02:14
172500 -- (-1402.500) (-1396.933) (-1399.286) [-1399.725] * (-1407.915) [-1401.877] (-1401.669) (-1399.552) -- 0:02:14
173000 -- (-1401.049) (-1397.946) (-1396.655) [-1398.221] * (-1405.635) (-1399.737) (-1405.951) [-1401.960] -- 0:02:13
173500 -- [-1401.632] (-1401.283) (-1401.267) (-1405.947) * (-1401.375) (-1401.453) [-1397.950] (-1404.515) -- 0:02:13
174000 -- (-1400.982) [-1394.042] (-1397.652) (-1402.865) * (-1403.043) [-1397.430] (-1405.813) (-1402.221) -- 0:02:12
174500 -- [-1400.536] (-1392.925) (-1417.563) (-1403.058) * (-1400.852) [-1397.881] (-1397.587) (-1399.686) -- 0:02:12
175000 -- (-1400.656) [-1400.236] (-1399.895) (-1399.196) * (-1399.918) [-1398.410] (-1398.282) (-1400.829) -- 0:02:12
Average standard deviation of split frequencies: 0.008035
175500 -- [-1398.354] (-1397.949) (-1404.786) (-1393.638) * [-1407.327] (-1401.632) (-1405.143) (-1403.094) -- 0:02:11
176000 -- (-1404.917) [-1397.414] (-1402.779) (-1396.515) * (-1404.947) (-1397.714) [-1395.228] (-1397.417) -- 0:02:11
176500 -- (-1401.913) (-1397.315) (-1400.118) [-1405.040] * (-1401.508) (-1399.596) [-1402.450] (-1397.169) -- 0:02:10
177000 -- (-1404.486) (-1404.209) (-1399.163) [-1399.459] * (-1405.201) [-1400.304] (-1398.361) (-1401.834) -- 0:02:10
177500 -- (-1401.815) [-1396.609] (-1408.368) (-1398.590) * [-1403.633] (-1401.263) (-1402.149) (-1410.799) -- 0:02:09
178000 -- [-1401.138] (-1400.553) (-1403.386) (-1399.443) * (-1401.254) (-1404.129) [-1394.804] (-1396.728) -- 0:02:13
178500 -- [-1398.940] (-1399.223) (-1400.444) (-1402.556) * (-1399.544) (-1407.737) [-1396.168] (-1405.098) -- 0:02:13
179000 -- (-1407.189) [-1397.709] (-1409.329) (-1399.312) * [-1396.360] (-1401.717) (-1396.141) (-1395.987) -- 0:02:13
179500 -- (-1399.232) (-1395.344) (-1405.410) [-1399.019] * (-1396.770) (-1401.929) (-1397.476) [-1394.740] -- 0:02:12
180000 -- (-1404.247) (-1395.833) (-1404.971) [-1400.134] * (-1395.341) (-1403.581) [-1399.576] (-1400.185) -- 0:02:12
Average standard deviation of split frequencies: 0.003914
180500 -- (-1400.891) (-1393.980) (-1397.910) [-1399.256] * (-1401.948) (-1408.592) [-1393.816] (-1402.930) -- 0:02:11
181000 -- (-1401.293) (-1402.977) [-1400.880] (-1401.355) * (-1402.016) (-1403.276) [-1402.918] (-1400.892) -- 0:02:11
181500 -- (-1397.200) [-1397.505] (-1406.925) (-1404.964) * (-1402.975) [-1405.436] (-1402.546) (-1401.939) -- 0:02:10
182000 -- (-1396.395) (-1396.050) (-1405.019) [-1400.970] * (-1400.864) (-1404.195) [-1403.576] (-1400.444) -- 0:02:10
182500 -- [-1396.083] (-1396.179) (-1400.529) (-1400.766) * (-1400.255) (-1406.377) (-1400.914) [-1398.669] -- 0:02:09
183000 -- (-1400.308) [-1406.119] (-1403.400) (-1399.831) * [-1405.959] (-1405.889) (-1399.209) (-1396.707) -- 0:02:09
183500 -- [-1400.295] (-1402.694) (-1397.500) (-1402.466) * [-1403.458] (-1403.554) (-1407.513) (-1397.439) -- 0:02:09
184000 -- (-1398.730) (-1403.074) [-1399.354] (-1401.758) * [-1403.963] (-1402.148) (-1399.538) (-1401.110) -- 0:02:08
184500 -- [-1401.212] (-1398.177) (-1402.606) (-1404.151) * (-1403.318) (-1398.747) (-1404.428) [-1402.357] -- 0:02:12
185000 -- [-1402.082] (-1400.694) (-1403.220) (-1402.905) * (-1399.757) (-1401.077) (-1399.863) [-1398.685] -- 0:02:12
Average standard deviation of split frequencies: 0.007603
185500 -- [-1398.990] (-1399.128) (-1398.101) (-1405.999) * [-1400.902] (-1411.770) (-1399.632) (-1399.977) -- 0:02:11
186000 -- (-1404.867) (-1395.902) (-1400.460) [-1402.553] * (-1401.609) (-1399.438) [-1401.446] (-1402.609) -- 0:02:11
186500 -- (-1405.517) (-1399.836) [-1397.342] (-1399.501) * (-1405.577) [-1404.486] (-1397.455) (-1395.954) -- 0:02:10
187000 -- (-1404.950) [-1405.345] (-1393.699) (-1397.163) * (-1404.992) (-1399.829) [-1399.839] (-1398.909) -- 0:02:10
187500 -- (-1402.308) (-1403.217) (-1399.219) [-1397.873] * [-1401.619] (-1398.613) (-1400.094) (-1403.488) -- 0:02:10
188000 -- (-1403.093) (-1397.927) [-1405.251] (-1405.282) * (-1404.078) (-1399.396) (-1402.985) [-1397.939] -- 0:02:09
188500 -- (-1403.169) (-1401.664) [-1396.726] (-1405.829) * (-1405.438) (-1408.542) [-1399.428] (-1398.543) -- 0:02:09
189000 -- (-1404.546) (-1400.797) [-1396.993] (-1397.991) * (-1401.534) (-1406.187) [-1398.148] (-1405.008) -- 0:02:08
189500 -- (-1399.918) (-1402.949) [-1396.126] (-1398.219) * [-1401.143] (-1402.258) (-1403.937) (-1395.618) -- 0:02:08
190000 -- (-1399.820) [-1402.459] (-1411.094) (-1398.095) * (-1410.760) [-1400.909] (-1394.313) (-1403.723) -- 0:02:07
Average standard deviation of split frequencies: 0.007417
190500 -- [-1402.154] (-1400.225) (-1398.982) (-1397.376) * (-1406.390) (-1414.663) [-1397.776] (-1403.087) -- 0:02:11
191000 -- [-1396.265] (-1405.474) (-1397.472) (-1395.245) * (-1406.326) (-1416.875) [-1407.022] (-1398.084) -- 0:02:11
191500 -- [-1407.288] (-1402.787) (-1399.141) (-1396.881) * (-1410.380) (-1396.646) [-1396.340] (-1396.222) -- 0:02:10
192000 -- (-1400.841) (-1401.819) [-1395.030] (-1402.734) * (-1403.799) (-1402.991) (-1396.074) [-1399.429] -- 0:02:10
192500 -- [-1402.780] (-1405.399) (-1404.762) (-1410.038) * (-1415.239) (-1398.440) [-1395.071] (-1399.083) -- 0:02:10
193000 -- [-1405.107] (-1402.480) (-1398.505) (-1399.639) * (-1402.574) (-1401.680) [-1396.620] (-1401.908) -- 0:02:09
193500 -- (-1401.344) (-1401.961) (-1398.815) [-1398.736] * (-1414.848) (-1404.795) (-1402.422) [-1398.846] -- 0:02:09
194000 -- (-1400.666) (-1406.959) [-1407.827] (-1402.609) * (-1402.048) (-1398.437) (-1405.996) [-1396.175] -- 0:02:08
194500 -- (-1402.608) (-1397.888) (-1394.656) [-1394.368] * (-1406.524) (-1397.311) [-1404.863] (-1399.731) -- 0:02:08
195000 -- (-1399.896) [-1396.531] (-1407.792) (-1396.845) * (-1404.837) [-1400.958] (-1401.103) (-1396.707) -- 0:02:07
Average standard deviation of split frequencies: 0.009621
195500 -- (-1396.316) [-1402.530] (-1398.625) (-1397.671) * (-1405.038) (-1399.868) [-1400.529] (-1407.708) -- 0:02:07
196000 -- (-1403.542) (-1401.013) [-1401.001] (-1400.354) * [-1403.625] (-1401.630) (-1401.410) (-1403.804) -- 0:02:07
196500 -- (-1397.699) (-1400.509) [-1397.750] (-1405.800) * (-1400.540) (-1403.018) (-1400.618) [-1397.316] -- 0:02:06
197000 -- (-1406.525) (-1401.557) [-1399.462] (-1403.068) * (-1403.768) (-1403.416) [-1398.218] (-1399.975) -- 0:02:10
197500 -- [-1405.656] (-1400.941) (-1408.376) (-1398.049) * (-1399.851) (-1400.456) [-1399.750] (-1401.569) -- 0:02:10
198000 -- [-1404.624] (-1402.962) (-1409.549) (-1399.648) * (-1395.256) (-1396.080) [-1395.654] (-1398.510) -- 0:02:09
198500 -- (-1400.610) (-1401.474) (-1400.332) [-1394.994] * (-1399.531) (-1403.622) [-1396.191] (-1397.806) -- 0:02:09
199000 -- [-1400.293] (-1401.177) (-1398.724) (-1396.377) * (-1402.738) [-1401.850] (-1396.897) (-1401.229) -- 0:02:08
199500 -- (-1401.301) [-1404.977] (-1403.334) (-1397.972) * [-1395.375] (-1403.866) (-1397.500) (-1405.445) -- 0:02:08
200000 -- (-1399.506) [-1402.309] (-1398.083) (-1396.691) * (-1398.321) (-1403.696) [-1401.156] (-1400.897) -- 0:02:08
Average standard deviation of split frequencies: 0.010571
200500 -- (-1402.262) (-1394.184) (-1396.602) [-1404.441] * (-1403.316) (-1403.610) (-1403.295) [-1396.455] -- 0:02:07
201000 -- (-1398.659) (-1398.335) [-1398.689] (-1399.808) * (-1406.194) [-1401.489] (-1401.523) (-1405.200) -- 0:02:07
201500 -- [-1400.997] (-1398.509) (-1399.642) (-1402.698) * [-1400.607] (-1398.374) (-1402.488) (-1402.299) -- 0:02:06
202000 -- (-1400.893) [-1395.639] (-1401.613) (-1396.153) * (-1399.330) (-1401.335) [-1402.806] (-1398.010) -- 0:02:06
202500 -- (-1399.407) (-1399.307) (-1403.928) [-1398.024] * (-1399.230) (-1398.527) [-1398.705] (-1400.747) -- 0:02:06
203000 -- (-1400.563) (-1399.873) (-1403.021) [-1399.740] * (-1395.834) [-1401.080] (-1397.819) (-1403.283) -- 0:02:09
203500 -- (-1398.889) (-1399.905) (-1406.275) [-1402.914] * (-1402.733) (-1404.419) (-1399.867) [-1398.071] -- 0:02:09
204000 -- (-1400.887) [-1401.508] (-1399.279) (-1404.736) * (-1402.687) [-1399.057] (-1412.546) (-1411.522) -- 0:02:08
204500 -- (-1404.373) (-1397.462) (-1402.974) [-1405.346] * (-1400.231) [-1396.932] (-1400.147) (-1398.995) -- 0:02:08
205000 -- (-1405.548) (-1398.409) [-1397.987] (-1408.170) * (-1397.911) (-1399.698) [-1397.139] (-1396.738) -- 0:02:07
Average standard deviation of split frequencies: 0.013730
205500 -- (-1405.027) (-1407.114) [-1399.917] (-1407.076) * [-1400.549] (-1397.380) (-1401.401) (-1400.938) -- 0:02:07
206000 -- (-1405.828) (-1402.097) (-1399.809) [-1397.152] * [-1401.089] (-1408.035) (-1403.565) (-1399.737) -- 0:02:07
206500 -- [-1402.934] (-1403.834) (-1397.038) (-1403.913) * [-1403.313] (-1398.273) (-1413.535) (-1403.531) -- 0:02:06
207000 -- [-1400.840] (-1404.171) (-1402.099) (-1402.824) * (-1405.407) (-1399.863) (-1401.955) [-1401.834] -- 0:02:06
207500 -- (-1399.442) (-1405.254) [-1397.354] (-1396.277) * (-1403.049) (-1403.562) (-1399.135) [-1396.024] -- 0:02:06
208000 -- (-1397.310) (-1398.423) (-1396.281) [-1399.500] * [-1401.572] (-1403.062) (-1399.766) (-1399.828) -- 0:02:05
208500 -- (-1399.642) (-1400.563) [-1402.106] (-1397.353) * (-1404.835) (-1409.632) [-1399.033] (-1401.542) -- 0:02:05
209000 -- (-1400.788) (-1404.272) [-1396.230] (-1402.753) * (-1404.011) (-1407.955) [-1398.569] (-1403.352) -- 0:02:04
209500 -- (-1402.506) [-1399.861] (-1397.230) (-1401.097) * (-1408.681) (-1399.079) [-1397.892] (-1403.721) -- 0:02:08
210000 -- (-1401.127) (-1402.335) [-1398.540] (-1404.570) * (-1408.556) (-1400.314) (-1402.232) [-1403.215] -- 0:02:07
Average standard deviation of split frequencies: 0.016783
210500 -- (-1398.014) (-1401.790) (-1400.143) [-1400.028] * (-1414.434) (-1398.414) (-1398.727) [-1400.940] -- 0:02:07
211000 -- (-1394.815) (-1404.859) (-1400.097) [-1401.011] * (-1402.175) [-1401.918] (-1401.950) (-1399.441) -- 0:02:07
211500 -- [-1392.951] (-1398.889) (-1398.778) (-1399.139) * (-1396.745) (-1403.761) (-1399.529) [-1401.507] -- 0:02:06
212000 -- (-1403.116) [-1402.921] (-1401.155) (-1396.697) * (-1395.267) [-1398.931] (-1403.418) (-1403.497) -- 0:02:06
212500 -- (-1402.850) [-1400.273] (-1397.716) (-1406.934) * [-1397.899] (-1396.631) (-1406.290) (-1402.618) -- 0:02:06
213000 -- (-1395.315) (-1401.755) (-1395.284) [-1399.216] * (-1398.914) (-1399.162) [-1403.093] (-1403.681) -- 0:02:05
213500 -- (-1398.602) [-1406.573] (-1405.149) (-1397.159) * (-1398.429) (-1398.664) [-1399.154] (-1404.532) -- 0:02:05
214000 -- (-1404.567) [-1396.214] (-1400.562) (-1401.466) * (-1400.653) [-1402.052] (-1403.721) (-1403.616) -- 0:02:04
214500 -- (-1404.433) [-1403.610] (-1405.902) (-1399.681) * (-1399.237) [-1396.736] (-1407.540) (-1402.430) -- 0:02:04
215000 -- (-1398.311) (-1398.113) [-1398.747] (-1395.107) * [-1404.882] (-1401.311) (-1399.879) (-1401.945) -- 0:02:04
Average standard deviation of split frequencies: 0.015277
215500 -- (-1398.121) (-1407.248) (-1397.980) [-1395.159] * (-1400.106) [-1397.827] (-1402.865) (-1400.918) -- 0:02:07
216000 -- (-1407.670) [-1398.617] (-1399.293) (-1396.088) * (-1397.001) (-1403.340) [-1403.904] (-1405.749) -- 0:02:07
216500 -- (-1398.393) [-1394.663] (-1401.274) (-1399.166) * (-1401.593) [-1404.143] (-1411.927) (-1400.869) -- 0:02:06
217000 -- (-1401.110) [-1396.124] (-1401.571) (-1397.671) * [-1399.595] (-1405.805) (-1404.427) (-1405.053) -- 0:02:06
217500 -- (-1404.048) (-1398.901) [-1398.520] (-1403.248) * [-1399.596] (-1402.970) (-1413.892) (-1399.596) -- 0:02:05
218000 -- [-1404.266] (-1400.698) (-1408.348) (-1406.841) * (-1403.721) [-1399.769] (-1405.570) (-1402.532) -- 0:02:05
218500 -- [-1400.855] (-1396.742) (-1408.490) (-1406.872) * (-1403.349) (-1399.976) (-1396.847) [-1395.551] -- 0:02:05
219000 -- [-1400.342] (-1398.706) (-1406.632) (-1406.231) * (-1406.624) (-1398.954) (-1400.143) [-1397.490] -- 0:02:04
219500 -- (-1407.601) [-1400.848] (-1399.335) (-1400.179) * [-1400.456] (-1396.883) (-1401.183) (-1398.889) -- 0:02:04
220000 -- (-1412.452) [-1398.044] (-1407.869) (-1401.172) * (-1398.838) [-1401.004] (-1402.026) (-1400.931) -- 0:02:04
Average standard deviation of split frequencies: 0.018158
220500 -- (-1408.106) (-1395.316) [-1399.891] (-1402.030) * (-1401.606) [-1400.676] (-1400.001) (-1399.642) -- 0:02:03
221000 -- [-1398.685] (-1399.293) (-1403.468) (-1401.233) * (-1396.352) (-1399.089) [-1394.336] (-1400.798) -- 0:02:03
221500 -- (-1404.920) (-1395.354) [-1394.949] (-1398.580) * (-1400.374) (-1398.221) [-1396.156] (-1397.060) -- 0:02:03
222000 -- (-1399.372) [-1402.024] (-1397.827) (-1396.719) * [-1399.174] (-1406.937) (-1398.347) (-1398.094) -- 0:02:06
222500 -- (-1405.674) (-1401.371) (-1405.596) [-1398.661] * (-1404.491) (-1400.670) [-1394.170] (-1405.565) -- 0:02:05
223000 -- (-1405.659) [-1399.361] (-1404.425) (-1403.725) * (-1403.021) (-1399.707) (-1394.536) [-1397.532] -- 0:02:05
223500 -- (-1402.195) (-1399.713) (-1400.406) [-1400.138] * (-1402.161) (-1401.506) (-1398.785) [-1396.846] -- 0:02:05
224000 -- [-1410.726] (-1394.975) (-1401.457) (-1401.621) * (-1404.987) (-1408.076) [-1399.625] (-1396.931) -- 0:02:04
224500 -- [-1395.600] (-1401.539) (-1401.396) (-1404.625) * (-1400.006) (-1405.715) (-1399.220) [-1404.368] -- 0:02:04
225000 -- [-1398.942] (-1399.888) (-1403.396) (-1400.468) * (-1404.894) [-1403.025] (-1398.804) (-1404.186) -- 0:02:04
Average standard deviation of split frequencies: 0.019816
225500 -- [-1401.299] (-1397.328) (-1405.473) (-1404.865) * (-1399.670) (-1402.998) [-1400.045] (-1405.296) -- 0:02:03
226000 -- (-1410.039) (-1397.666) (-1402.943) [-1400.113] * (-1401.276) (-1402.277) [-1393.738] (-1412.388) -- 0:02:03
226500 -- [-1404.863] (-1397.764) (-1397.937) (-1398.690) * [-1397.910] (-1403.006) (-1401.411) (-1396.377) -- 0:02:02
227000 -- (-1404.801) (-1397.148) (-1402.672) [-1395.928] * (-1400.942) [-1397.880] (-1401.130) (-1402.114) -- 0:02:02
227500 -- [-1401.864] (-1405.510) (-1396.261) (-1398.043) * (-1402.096) (-1404.728) (-1405.302) [-1401.656] -- 0:02:02
228000 -- (-1396.922) [-1399.591] (-1398.915) (-1403.535) * (-1398.704) (-1400.984) [-1394.000] (-1406.208) -- 0:02:05
228500 -- (-1400.025) [-1400.174] (-1404.624) (-1405.580) * (-1410.934) [-1397.282] (-1400.532) (-1400.491) -- 0:02:04
229000 -- [-1404.253] (-1396.934) (-1401.290) (-1396.484) * [-1395.833] (-1397.964) (-1404.308) (-1401.175) -- 0:02:04
229500 -- (-1403.207) (-1401.027) (-1404.185) [-1396.795] * (-1400.943) (-1397.474) [-1397.081] (-1400.864) -- 0:02:04
230000 -- (-1403.329) (-1399.577) (-1400.420) [-1400.729] * (-1396.261) (-1405.160) [-1394.078] (-1408.161) -- 0:02:03
Average standard deviation of split frequencies: 0.019415
230500 -- (-1407.412) [-1403.328] (-1407.522) (-1399.593) * (-1400.471) (-1397.722) (-1399.249) [-1401.343] -- 0:02:03
231000 -- [-1399.310] (-1401.977) (-1398.713) (-1399.298) * (-1399.902) (-1399.155) [-1396.699] (-1399.512) -- 0:02:03
231500 -- (-1409.701) (-1398.204) [-1400.122] (-1397.976) * (-1398.422) [-1402.963] (-1404.856) (-1404.091) -- 0:02:02
232000 -- [-1401.208] (-1401.697) (-1402.827) (-1398.576) * (-1396.335) [-1400.270] (-1405.983) (-1407.860) -- 0:02:02
232500 -- (-1401.107) (-1398.479) [-1398.636] (-1398.299) * (-1396.793) (-1404.657) (-1403.043) [-1394.935] -- 0:02:02
233000 -- (-1405.999) (-1400.216) (-1404.265) [-1396.551] * (-1403.555) (-1405.085) [-1402.140] (-1399.755) -- 0:02:01
233500 -- (-1401.613) [-1397.655] (-1398.781) (-1405.202) * (-1404.524) (-1401.472) (-1397.343) [-1396.847] -- 0:02:01
234000 -- (-1400.155) (-1402.244) [-1395.402] (-1401.130) * (-1408.730) [-1396.896] (-1404.207) (-1397.393) -- 0:02:01
234500 -- (-1400.114) (-1401.993) (-1400.454) [-1398.802] * (-1401.536) [-1400.099] (-1403.383) (-1404.021) -- 0:02:04
235000 -- (-1402.516) (-1399.399) [-1398.562] (-1405.238) * (-1400.780) (-1400.773) (-1398.270) [-1398.148] -- 0:02:03
Average standard deviation of split frequencies: 0.020974
235500 -- [-1398.630] (-1400.471) (-1403.575) (-1404.532) * (-1404.334) (-1402.239) (-1409.195) [-1396.898] -- 0:02:03
236000 -- (-1402.621) (-1402.413) [-1406.627] (-1402.037) * [-1397.370] (-1396.731) (-1398.924) (-1399.788) -- 0:02:03
236500 -- (-1403.512) [-1396.365] (-1407.196) (-1397.755) * (-1399.398) (-1402.123) (-1397.214) [-1404.079] -- 0:02:02
237000 -- [-1401.398] (-1397.800) (-1404.339) (-1399.555) * [-1399.634] (-1402.628) (-1398.888) (-1407.949) -- 0:02:02
237500 -- [-1403.135] (-1403.944) (-1407.057) (-1405.798) * [-1397.120] (-1397.949) (-1401.298) (-1405.803) -- 0:02:02
238000 -- (-1398.158) (-1402.470) (-1401.396) [-1402.748] * (-1401.575) [-1403.204] (-1398.834) (-1404.043) -- 0:02:01
238500 -- [-1399.047] (-1398.284) (-1404.579) (-1407.806) * (-1402.353) (-1394.249) (-1398.393) [-1397.478] -- 0:02:01
239000 -- (-1398.465) (-1400.145) (-1399.034) [-1401.874] * (-1399.551) (-1399.894) (-1396.500) [-1405.984] -- 0:02:00
239500 -- (-1400.580) (-1398.221) [-1398.948] (-1402.520) * [-1398.994] (-1396.929) (-1407.183) (-1398.641) -- 0:02:00
240000 -- (-1396.679) (-1397.848) (-1403.584) [-1397.264] * (-1400.159) (-1398.183) [-1394.992] (-1398.948) -- 0:02:00
Average standard deviation of split frequencies: 0.021546
240500 -- (-1406.016) (-1412.502) [-1397.365] (-1400.831) * [-1408.944] (-1398.472) (-1395.160) (-1396.640) -- 0:02:03
241000 -- (-1396.322) (-1400.209) [-1404.388] (-1405.126) * (-1408.519) [-1396.005] (-1398.095) (-1402.331) -- 0:02:02
241500 -- (-1402.276) [-1399.179] (-1408.863) (-1400.105) * (-1396.232) [-1400.477] (-1400.844) (-1403.502) -- 0:02:02
242000 -- [-1397.748] (-1395.364) (-1401.133) (-1398.119) * (-1400.125) [-1399.049] (-1406.722) (-1400.852) -- 0:02:02
242500 -- (-1398.986) [-1397.610] (-1401.844) (-1400.055) * (-1411.068) [-1399.980] (-1403.676) (-1406.932) -- 0:02:01
243000 -- (-1405.343) (-1406.079) [-1393.897] (-1409.231) * (-1401.176) (-1397.358) (-1404.593) [-1402.959] -- 0:02:01
243500 -- [-1400.614] (-1405.207) (-1396.035) (-1396.864) * [-1404.531] (-1397.881) (-1399.610) (-1403.803) -- 0:02:01
244000 -- (-1399.733) [-1402.311] (-1396.738) (-1403.421) * (-1402.024) (-1404.875) [-1399.951] (-1403.195) -- 0:02:00
244500 -- (-1394.207) [-1402.938] (-1396.392) (-1404.310) * (-1403.052) (-1404.164) [-1400.299] (-1409.802) -- 0:02:00
245000 -- [-1396.535] (-1405.962) (-1403.232) (-1398.934) * (-1400.852) [-1400.741] (-1404.407) (-1399.029) -- 0:02:00
Average standard deviation of split frequencies: 0.022995
245500 -- [-1402.632] (-1401.296) (-1398.780) (-1399.206) * [-1398.169] (-1400.720) (-1408.437) (-1404.374) -- 0:01:59
246000 -- (-1398.332) (-1400.256) [-1400.520] (-1399.476) * (-1409.978) [-1400.045] (-1402.964) (-1397.150) -- 0:01:59
246500 -- [-1404.991] (-1406.832) (-1402.496) (-1405.480) * [-1406.709] (-1402.750) (-1399.766) (-1398.327) -- 0:01:59
247000 -- (-1398.175) [-1399.034] (-1400.728) (-1397.955) * (-1403.279) (-1402.220) (-1402.187) [-1400.194] -- 0:02:01
247500 -- [-1403.602] (-1399.257) (-1403.236) (-1400.026) * [-1405.097] (-1397.354) (-1404.385) (-1399.769) -- 0:02:01
248000 -- (-1404.950) [-1396.781] (-1406.647) (-1404.617) * (-1402.862) (-1397.677) (-1405.835) [-1404.480] -- 0:02:01
248500 -- (-1399.196) (-1400.138) (-1403.560) [-1397.642] * (-1407.093) (-1399.447) (-1404.959) [-1397.359] -- 0:02:00
249000 -- [-1396.321] (-1396.753) (-1402.773) (-1403.949) * [-1398.903] (-1402.862) (-1397.678) (-1400.344) -- 0:02:00
249500 -- (-1399.337) (-1402.600) (-1402.813) [-1407.334] * (-1410.990) (-1402.567) (-1397.340) [-1399.594] -- 0:02:00
250000 -- [-1398.328] (-1395.103) (-1400.618) (-1402.762) * (-1407.954) [-1401.845] (-1396.643) (-1398.088) -- 0:02:00
Average standard deviation of split frequencies: 0.027269
250500 -- [-1398.397] (-1399.422) (-1403.579) (-1400.868) * (-1405.769) (-1403.041) (-1397.424) [-1395.810] -- 0:01:59
251000 -- (-1399.060) [-1396.332] (-1413.277) (-1399.555) * [-1400.652] (-1402.583) (-1410.326) (-1399.888) -- 0:01:59
251500 -- [-1396.647] (-1400.949) (-1403.456) (-1399.994) * (-1403.240) [-1402.656] (-1399.491) (-1403.913) -- 0:01:59
252000 -- (-1398.497) (-1404.924) [-1402.316] (-1400.441) * [-1392.738] (-1405.150) (-1398.555) (-1396.818) -- 0:01:58
252500 -- (-1395.600) [-1396.006] (-1398.321) (-1414.697) * (-1401.032) (-1409.184) (-1402.671) [-1399.714] -- 0:01:58
253000 -- (-1402.350) [-1402.832] (-1395.584) (-1400.285) * [-1403.290] (-1403.394) (-1402.265) (-1399.140) -- 0:02:01
253500 -- (-1400.697) (-1401.459) (-1408.104) [-1399.801] * (-1401.253) [-1399.489] (-1413.353) (-1397.310) -- 0:02:00
254000 -- [-1399.209] (-1396.897) (-1398.440) (-1408.857) * (-1398.482) [-1405.127] (-1405.585) (-1395.541) -- 0:02:00
254500 -- [-1396.169] (-1403.823) (-1402.751) (-1406.289) * (-1396.435) [-1396.757] (-1396.104) (-1396.205) -- 0:02:00
255000 -- (-1402.056) (-1407.157) [-1398.085] (-1402.476) * (-1401.012) (-1406.174) [-1399.594] (-1397.677) -- 0:01:59
Average standard deviation of split frequencies: 0.028542
255500 -- (-1405.656) [-1404.157] (-1400.813) (-1405.929) * (-1398.530) (-1401.972) [-1404.100] (-1407.268) -- 0:01:59
256000 -- (-1399.939) (-1404.426) (-1395.359) [-1400.688] * (-1403.182) (-1403.415) (-1401.739) [-1401.441] -- 0:01:59
256500 -- (-1397.893) (-1401.998) [-1398.249] (-1399.809) * [-1401.204] (-1401.175) (-1397.249) (-1406.500) -- 0:01:58
257000 -- (-1398.487) (-1407.093) (-1400.855) [-1398.429] * [-1398.177] (-1406.151) (-1400.826) (-1403.872) -- 0:01:58
257500 -- [-1395.958] (-1400.555) (-1397.958) (-1400.470) * (-1401.303) (-1401.685) (-1409.809) [-1399.299] -- 0:01:58
258000 -- (-1402.622) (-1398.001) [-1396.012] (-1399.366) * (-1399.869) [-1395.459] (-1401.749) (-1398.157) -- 0:01:57
258500 -- (-1403.294) [-1402.930] (-1401.344) (-1400.751) * (-1399.888) (-1399.451) (-1400.198) [-1399.001] -- 0:01:57
259000 -- (-1396.696) (-1400.745) [-1402.491] (-1401.419) * (-1398.462) (-1396.432) [-1400.901] (-1397.264) -- 0:01:57
259500 -- (-1399.578) (-1396.634) [-1399.715] (-1400.368) * [-1398.167] (-1397.295) (-1395.034) (-1411.999) -- 0:01:59
260000 -- (-1409.517) [-1399.630] (-1399.970) (-1400.768) * (-1393.460) (-1399.133) (-1399.676) [-1401.087] -- 0:01:59
Average standard deviation of split frequencies: 0.029840
260500 -- [-1407.058] (-1404.313) (-1403.372) (-1398.435) * [-1403.427] (-1400.874) (-1403.790) (-1410.857) -- 0:01:59
261000 -- (-1403.553) (-1401.076) [-1398.918] (-1406.460) * [-1399.599] (-1402.669) (-1402.003) (-1410.444) -- 0:01:58
261500 -- (-1399.359) [-1395.943] (-1397.592) (-1396.026) * [-1397.068] (-1404.329) (-1398.859) (-1404.704) -- 0:01:58
262000 -- (-1399.985) [-1397.461] (-1395.756) (-1400.568) * [-1399.478] (-1403.468) (-1401.552) (-1410.644) -- 0:01:58
262500 -- [-1400.709] (-1401.355) (-1401.743) (-1406.100) * (-1404.789) (-1405.132) [-1405.360] (-1405.386) -- 0:01:58
263000 -- (-1400.843) [-1395.277] (-1399.549) (-1399.252) * (-1400.009) [-1397.744] (-1399.385) (-1409.330) -- 0:01:57
263500 -- (-1399.966) (-1401.351) [-1394.439] (-1404.438) * [-1397.832] (-1403.848) (-1403.752) (-1406.096) -- 0:01:57
264000 -- [-1403.575] (-1403.950) (-1398.858) (-1404.829) * (-1397.236) (-1397.410) [-1403.551] (-1405.653) -- 0:01:57
264500 -- (-1401.957) [-1396.303] (-1398.801) (-1400.172) * (-1396.826) (-1404.682) [-1398.794] (-1401.495) -- 0:01:56
265000 -- [-1397.861] (-1399.965) (-1398.713) (-1397.806) * (-1398.373) (-1404.620) (-1399.662) [-1403.275] -- 0:01:56
Average standard deviation of split frequencies: 0.026583
265500 -- (-1400.737) (-1404.194) [-1395.846] (-1401.259) * (-1400.767) (-1406.057) [-1401.534] (-1405.212) -- 0:01:58
266000 -- (-1406.135) (-1394.338) [-1398.991] (-1401.960) * (-1402.231) (-1399.817) [-1399.504] (-1400.275) -- 0:01:58
266500 -- [-1405.632] (-1397.520) (-1402.200) (-1398.296) * (-1401.190) [-1401.277] (-1400.582) (-1400.592) -- 0:01:58
267000 -- (-1402.475) (-1401.486) [-1396.863] (-1402.482) * (-1400.271) (-1405.929) (-1400.587) [-1396.958] -- 0:01:58
267500 -- (-1407.183) (-1403.750) (-1412.072) [-1402.271] * (-1392.649) (-1402.865) (-1404.151) [-1408.851] -- 0:01:57
268000 -- (-1411.243) (-1409.569) (-1400.068) [-1401.070] * (-1398.775) [-1393.682] (-1403.766) (-1405.749) -- 0:01:57
268500 -- (-1408.502) (-1405.816) (-1403.237) [-1397.935] * (-1399.661) (-1401.380) (-1408.398) [-1404.437] -- 0:01:57
269000 -- (-1403.797) (-1401.936) [-1402.468] (-1398.107) * (-1397.610) (-1396.534) [-1396.974] (-1401.357) -- 0:01:56
269500 -- (-1408.464) (-1402.780) (-1399.866) [-1394.773] * (-1400.772) (-1395.043) (-1401.494) [-1397.805] -- 0:01:56
270000 -- [-1399.740] (-1406.156) (-1400.913) (-1399.368) * (-1400.687) (-1403.570) (-1393.829) [-1404.639] -- 0:01:56
Average standard deviation of split frequencies: 0.025254
270500 -- (-1397.697) (-1404.438) [-1398.714] (-1403.736) * [-1404.550] (-1404.748) (-1399.160) (-1402.223) -- 0:01:55
271000 -- (-1401.743) (-1402.500) (-1400.969) [-1396.881] * (-1400.253) (-1398.351) [-1401.364] (-1399.823) -- 0:01:55
271500 -- (-1408.326) (-1413.694) [-1401.893] (-1396.807) * (-1400.311) (-1399.594) [-1398.070] (-1397.508) -- 0:01:55
272000 -- (-1405.894) (-1407.163) (-1402.830) [-1394.726] * (-1402.084) (-1403.060) [-1400.440] (-1401.230) -- 0:01:57
272500 -- (-1400.345) (-1409.321) (-1402.536) [-1397.020] * [-1398.990] (-1403.074) (-1402.898) (-1404.828) -- 0:01:57
273000 -- (-1403.646) (-1403.834) (-1403.018) [-1396.282] * (-1401.313) [-1399.863] (-1404.153) (-1401.047) -- 0:01:57
273500 -- (-1406.496) [-1400.312] (-1399.648) (-1402.360) * (-1401.549) [-1395.176] (-1403.536) (-1400.242) -- 0:01:56
274000 -- (-1408.396) [-1407.997] (-1400.447) (-1404.713) * [-1402.635] (-1398.699) (-1404.524) (-1404.396) -- 0:01:56
274500 -- (-1402.436) (-1400.469) [-1400.368] (-1404.021) * (-1400.677) (-1402.963) [-1400.950] (-1397.819) -- 0:01:56
275000 -- [-1397.689] (-1403.822) (-1404.436) (-1399.813) * (-1400.297) (-1404.878) (-1403.626) [-1396.256] -- 0:01:56
Average standard deviation of split frequencies: 0.023912
275500 -- [-1406.647] (-1408.930) (-1397.378) (-1402.943) * (-1398.797) [-1398.199] (-1403.740) (-1396.716) -- 0:01:55
276000 -- (-1402.376) (-1400.697) (-1402.718) [-1397.974] * (-1399.787) (-1401.610) [-1396.808] (-1394.966) -- 0:01:55
276500 -- (-1401.158) (-1400.145) [-1399.934] (-1396.485) * (-1401.741) [-1404.992] (-1398.190) (-1398.274) -- 0:01:55
277000 -- (-1403.146) (-1401.756) (-1395.454) [-1397.045] * [-1397.834] (-1402.725) (-1404.650) (-1401.151) -- 0:01:54
277500 -- (-1396.762) (-1402.865) [-1400.995] (-1399.679) * (-1403.229) (-1397.919) (-1404.640) [-1397.647] -- 0:01:54
278000 -- (-1397.268) (-1403.145) [-1399.675] (-1398.274) * [-1400.586] (-1398.109) (-1404.512) (-1398.540) -- 0:01:56
278500 -- [-1405.297] (-1410.884) (-1396.079) (-1397.819) * [-1401.115] (-1407.721) (-1407.185) (-1405.478) -- 0:01:56
279000 -- [-1401.582] (-1407.680) (-1397.456) (-1400.507) * (-1400.338) (-1400.520) (-1403.790) [-1403.763] -- 0:01:56
279500 -- (-1398.840) (-1400.169) (-1398.600) [-1397.321] * [-1398.024] (-1398.883) (-1402.143) (-1404.481) -- 0:01:56
280000 -- (-1400.642) (-1404.191) (-1399.533) [-1397.789] * (-1396.800) [-1398.421] (-1398.995) (-1407.995) -- 0:01:55
Average standard deviation of split frequencies: 0.023514
280500 -- (-1398.732) (-1408.347) [-1395.940] (-1397.691) * (-1396.320) [-1396.191] (-1401.906) (-1402.835) -- 0:01:55
281000 -- [-1399.035] (-1402.096) (-1397.201) (-1400.756) * (-1398.590) (-1400.597) [-1400.255] (-1397.556) -- 0:01:55
281500 -- [-1398.748] (-1406.737) (-1402.781) (-1400.287) * [-1397.974] (-1399.624) (-1400.683) (-1396.064) -- 0:01:54
282000 -- (-1398.246) (-1402.584) (-1398.879) [-1400.003] * (-1395.580) [-1398.545] (-1396.792) (-1400.412) -- 0:01:54
282500 -- (-1399.649) (-1397.579) [-1394.670] (-1401.915) * (-1415.110) (-1397.157) [-1399.061] (-1406.418) -- 0:01:54
283000 -- (-1397.425) (-1398.679) [-1395.997] (-1403.709) * (-1402.624) (-1398.054) [-1400.000] (-1400.186) -- 0:01:54
283500 -- [-1404.106] (-1396.492) (-1398.058) (-1401.870) * (-1399.266) (-1397.534) (-1402.402) [-1401.354] -- 0:01:53
284000 -- [-1397.978] (-1399.195) (-1395.323) (-1396.833) * (-1402.126) (-1401.305) (-1404.236) [-1397.910] -- 0:01:53
284500 -- (-1406.653) (-1399.730) (-1401.746) [-1399.522] * (-1395.503) [-1403.522] (-1400.041) (-1399.899) -- 0:01:55
285000 -- (-1405.094) (-1406.823) [-1398.234] (-1399.397) * (-1400.160) (-1400.657) (-1395.409) [-1398.594] -- 0:01:55
Average standard deviation of split frequencies: 0.025548
285500 -- (-1410.220) (-1397.846) (-1402.504) [-1397.431] * (-1401.299) (-1396.968) [-1400.355] (-1404.743) -- 0:01:55
286000 -- (-1407.654) (-1399.673) [-1396.124] (-1401.548) * (-1397.768) [-1396.822] (-1396.142) (-1398.897) -- 0:01:54
286500 -- [-1395.050] (-1398.846) (-1408.596) (-1398.192) * (-1400.615) [-1398.780] (-1399.985) (-1402.997) -- 0:01:54
287000 -- (-1403.997) (-1408.619) (-1401.700) [-1401.449] * (-1402.911) (-1395.398) (-1393.236) [-1401.172] -- 0:01:54
287500 -- [-1400.014] (-1405.210) (-1410.376) (-1407.891) * (-1398.851) [-1398.616] (-1401.219) (-1407.578) -- 0:01:54
288000 -- (-1396.455) (-1402.490) (-1406.613) [-1397.313] * (-1401.502) (-1397.542) (-1397.735) [-1394.298] -- 0:01:53
288500 -- (-1396.102) [-1407.638] (-1403.913) (-1401.127) * (-1400.319) (-1396.382) (-1399.295) [-1395.716] -- 0:01:53
289000 -- (-1397.678) [-1400.611] (-1403.548) (-1402.600) * [-1397.931] (-1401.905) (-1399.184) (-1399.847) -- 0:01:53
289500 -- (-1401.268) (-1410.449) (-1401.519) [-1399.086] * [-1396.917] (-1399.326) (-1400.619) (-1400.369) -- 0:01:52
290000 -- (-1397.196) (-1401.824) (-1403.231) [-1396.741] * [-1396.422] (-1400.698) (-1399.083) (-1400.890) -- 0:01:52
Average standard deviation of split frequencies: 0.029192
290500 -- [-1402.770] (-1396.583) (-1398.680) (-1399.114) * (-1399.281) (-1406.731) [-1396.061] (-1401.700) -- 0:01:54
291000 -- (-1403.818) (-1402.188) (-1398.563) [-1399.496] * (-1400.054) [-1395.138] (-1400.209) (-1406.166) -- 0:01:54
291500 -- (-1406.907) (-1400.079) (-1402.389) [-1404.429] * (-1403.533) [-1397.775] (-1397.079) (-1397.025) -- 0:01:54
292000 -- (-1405.850) (-1404.803) [-1398.908] (-1401.556) * (-1399.939) (-1399.829) [-1400.334] (-1399.072) -- 0:01:53
292500 -- (-1402.327) (-1397.213) (-1402.434) [-1394.796] * (-1403.823) (-1406.814) (-1401.130) [-1399.795] -- 0:01:53
293000 -- (-1399.325) (-1394.784) [-1401.474] (-1401.215) * (-1403.758) (-1401.350) [-1397.494] (-1398.900) -- 0:01:53
293500 -- [-1401.048] (-1397.348) (-1398.029) (-1400.346) * (-1408.174) [-1400.624] (-1401.193) (-1397.554) -- 0:01:53
294000 -- (-1399.569) [-1398.703] (-1403.099) (-1399.048) * (-1404.218) [-1405.295] (-1399.402) (-1404.678) -- 0:01:52
294500 -- (-1395.631) (-1399.012) (-1403.731) [-1402.770] * (-1400.113) (-1406.053) [-1403.190] (-1408.238) -- 0:01:52
295000 -- (-1396.183) (-1396.909) [-1401.861] (-1412.816) * [-1398.094] (-1403.111) (-1404.608) (-1409.240) -- 0:01:52
Average standard deviation of split frequencies: 0.032648
295500 -- (-1401.927) (-1403.933) (-1395.106) [-1395.679] * [-1401.090] (-1409.187) (-1407.112) (-1411.800) -- 0:01:52
296000 -- (-1398.743) [-1398.062] (-1404.265) (-1402.627) * [-1402.280] (-1401.023) (-1397.488) (-1400.904) -- 0:01:51
296500 -- (-1399.707) (-1407.104) [-1395.450] (-1401.730) * [-1402.799] (-1399.556) (-1403.952) (-1400.242) -- 0:01:51
297000 -- (-1398.939) [-1397.391] (-1405.029) (-1397.645) * (-1401.016) (-1397.986) [-1404.014] (-1405.655) -- 0:01:53
297500 -- (-1404.636) (-1398.288) [-1397.987] (-1402.309) * (-1402.630) (-1397.068) (-1404.072) [-1400.205] -- 0:01:53
298000 -- [-1402.680] (-1409.036) (-1406.442) (-1397.650) * (-1398.037) (-1396.555) (-1402.269) [-1398.627] -- 0:01:53
298500 -- (-1398.807) (-1402.340) (-1402.413) [-1399.135] * (-1407.742) (-1399.499) [-1403.603] (-1400.138) -- 0:01:52
299000 -- (-1407.412) (-1402.950) [-1398.907] (-1404.198) * [-1397.049] (-1395.366) (-1403.229) (-1398.598) -- 0:01:52
299500 -- (-1404.252) (-1403.516) [-1405.427] (-1403.880) * (-1400.286) (-1395.638) (-1401.425) [-1402.887] -- 0:01:52
300000 -- (-1399.243) (-1400.043) [-1397.217] (-1397.814) * [-1400.864] (-1404.907) (-1398.074) (-1401.812) -- 0:01:52
Average standard deviation of split frequencies: 0.032141
300500 -- (-1403.428) (-1398.268) [-1398.457] (-1403.150) * [-1400.368] (-1400.451) (-1400.709) (-1399.714) -- 0:01:51
301000 -- (-1398.281) (-1404.503) (-1395.961) [-1402.555] * (-1403.101) (-1402.883) (-1401.681) [-1398.489] -- 0:01:51
301500 -- (-1400.339) (-1401.166) [-1392.661] (-1406.375) * [-1400.088] (-1400.130) (-1407.720) (-1395.959) -- 0:01:51
302000 -- (-1401.806) (-1398.500) [-1401.563] (-1398.731) * (-1404.517) [-1404.540] (-1398.470) (-1400.517) -- 0:01:50
302500 -- (-1401.627) [-1397.868] (-1398.185) (-1403.197) * [-1402.353] (-1399.440) (-1399.316) (-1403.241) -- 0:01:50
303000 -- (-1397.745) [-1398.582] (-1397.407) (-1398.425) * (-1405.806) (-1404.858) [-1399.694] (-1395.487) -- 0:01:52
303500 -- (-1396.183) [-1397.173] (-1405.452) (-1400.001) * [-1400.493] (-1408.334) (-1399.076) (-1398.617) -- 0:01:52
304000 -- (-1397.512) (-1401.045) [-1400.462] (-1398.947) * (-1396.756) (-1406.738) [-1398.412] (-1400.754) -- 0:01:52
304500 -- (-1395.064) [-1399.138] (-1398.777) (-1398.410) * (-1403.417) [-1397.216] (-1403.699) (-1398.100) -- 0:01:51
305000 -- (-1395.477) (-1400.463) (-1400.059) [-1402.188] * (-1397.506) [-1394.477] (-1403.563) (-1398.281) -- 0:01:51
Average standard deviation of split frequencies: 0.027730
305500 -- (-1401.808) (-1398.285) [-1399.934] (-1398.481) * (-1412.595) (-1398.091) [-1397.540] (-1399.417) -- 0:01:51
306000 -- (-1398.452) [-1399.847] (-1401.716) (-1403.687) * (-1405.859) (-1400.604) [-1394.685] (-1397.199) -- 0:01:51
306500 -- (-1409.672) [-1401.365] (-1400.086) (-1398.427) * (-1404.259) [-1395.689] (-1396.406) (-1399.151) -- 0:01:50
307000 -- (-1402.050) [-1394.728] (-1401.011) (-1398.942) * (-1402.374) [-1392.928] (-1398.154) (-1401.788) -- 0:01:50
307500 -- (-1395.988) (-1406.588) (-1397.954) [-1394.171] * (-1400.289) [-1394.508] (-1403.335) (-1407.258) -- 0:01:50
308000 -- (-1402.355) [-1403.457] (-1403.299) (-1397.865) * (-1399.290) (-1393.981) [-1396.822] (-1398.159) -- 0:01:50
308500 -- (-1403.689) (-1402.584) [-1405.753] (-1397.876) * (-1404.160) (-1394.638) [-1399.281] (-1401.310) -- 0:01:49
309000 -- (-1398.178) [-1397.695] (-1401.124) (-1402.181) * (-1401.822) [-1397.269] (-1399.774) (-1394.777) -- 0:01:49
309500 -- (-1402.282) [-1398.875] (-1398.037) (-1395.570) * (-1398.615) (-1398.045) (-1403.999) [-1401.479] -- 0:01:51
310000 -- (-1395.004) (-1400.014) [-1404.499] (-1395.736) * [-1400.905] (-1401.421) (-1406.797) (-1401.238) -- 0:01:51
Average standard deviation of split frequencies: 0.024278
310500 -- (-1398.662) (-1395.230) [-1402.686] (-1399.615) * (-1402.546) (-1406.141) (-1398.328) [-1396.469] -- 0:01:51
311000 -- (-1399.774) (-1398.110) (-1402.465) [-1394.610] * (-1398.492) (-1401.818) [-1393.937] (-1406.121) -- 0:01:50
311500 -- (-1393.227) [-1397.973] (-1398.758) (-1397.053) * [-1398.493] (-1398.532) (-1399.528) (-1403.443) -- 0:01:50
312000 -- (-1399.422) (-1406.761) (-1399.013) [-1402.613] * (-1403.760) (-1399.714) (-1399.119) [-1398.705] -- 0:01:50
312500 -- (-1397.632) (-1400.986) [-1394.457] (-1400.686) * (-1400.349) (-1408.591) (-1399.919) [-1398.750] -- 0:01:50
313000 -- (-1400.357) [-1404.600] (-1396.303) (-1397.704) * (-1403.245) [-1405.467] (-1401.025) (-1401.676) -- 0:01:49
313500 -- [-1395.447] (-1405.712) (-1397.800) (-1397.978) * [-1398.283] (-1407.693) (-1398.189) (-1402.176) -- 0:01:49
314000 -- (-1398.308) (-1398.074) [-1398.562] (-1398.463) * (-1402.730) [-1402.069] (-1409.342) (-1402.187) -- 0:01:49
314500 -- (-1398.693) [-1403.616] (-1396.748) (-1398.513) * [-1396.933] (-1404.320) (-1401.485) (-1401.180) -- 0:01:48
315000 -- (-1394.935) (-1402.153) (-1398.843) [-1397.563] * (-1395.970) (-1404.818) (-1397.865) [-1402.272] -- 0:01:48
Average standard deviation of split frequencies: 0.026106
315500 -- (-1405.184) (-1401.408) (-1404.305) [-1399.032] * (-1397.419) [-1403.488] (-1400.741) (-1404.825) -- 0:01:50
316000 -- (-1405.685) (-1401.374) (-1397.508) [-1404.501] * (-1403.424) (-1399.416) [-1396.191] (-1408.024) -- 0:01:50
316500 -- [-1401.062] (-1398.001) (-1402.858) (-1400.827) * (-1401.094) [-1405.212] (-1401.943) (-1409.316) -- 0:01:50
317000 -- (-1397.775) [-1398.122] (-1409.894) (-1396.989) * (-1399.876) [-1406.542] (-1398.511) (-1406.484) -- 0:01:49
317500 -- (-1401.466) (-1396.802) (-1407.891) [-1396.822] * (-1398.602) [-1403.545] (-1404.228) (-1400.533) -- 0:01:49
318000 -- [-1399.326] (-1399.017) (-1406.391) (-1397.686) * [-1397.904] (-1402.289) (-1403.837) (-1403.978) -- 0:01:49
318500 -- [-1397.505] (-1395.079) (-1401.353) (-1397.710) * [-1400.323] (-1402.115) (-1399.759) (-1403.389) -- 0:01:49
319000 -- [-1396.111] (-1401.394) (-1397.369) (-1394.724) * (-1397.193) [-1402.845] (-1405.535) (-1402.227) -- 0:01:48
319500 -- (-1399.309) (-1393.159) [-1397.557] (-1397.145) * [-1396.034] (-1395.687) (-1405.662) (-1404.540) -- 0:01:48
320000 -- (-1401.998) (-1397.457) [-1395.165] (-1399.513) * (-1399.472) (-1399.891) [-1406.602] (-1406.340) -- 0:01:48
Average standard deviation of split frequencies: 0.026461
320500 -- [-1399.761] (-1400.472) (-1401.172) (-1401.898) * [-1399.666] (-1396.165) (-1401.516) (-1401.671) -- 0:01:48
321000 -- [-1400.578] (-1399.115) (-1397.495) (-1405.728) * [-1398.984] (-1394.642) (-1397.488) (-1399.171) -- 0:01:47
321500 -- (-1400.109) (-1400.436) (-1399.723) [-1396.542] * (-1398.332) [-1396.236] (-1401.219) (-1402.980) -- 0:01:47
322000 -- [-1403.709] (-1400.276) (-1409.661) (-1399.203) * (-1400.602) [-1399.493] (-1401.863) (-1396.076) -- 0:01:49
322500 -- (-1397.218) (-1402.939) [-1400.505] (-1405.600) * (-1403.747) (-1404.984) (-1400.466) [-1401.245] -- 0:01:49
323000 -- [-1396.407] (-1405.162) (-1399.773) (-1404.718) * (-1405.272) (-1396.894) [-1402.773] (-1397.981) -- 0:01:48
323500 -- (-1395.742) (-1403.100) [-1398.801] (-1400.907) * (-1404.067) (-1400.123) (-1401.783) [-1401.250] -- 0:01:48
324000 -- (-1397.568) [-1393.184] (-1399.394) (-1401.523) * (-1400.119) (-1394.735) [-1395.199] (-1396.514) -- 0:01:48
324500 -- (-1409.787) [-1398.280] (-1401.620) (-1403.870) * (-1406.893) (-1399.306) (-1397.742) [-1399.416] -- 0:01:48
325000 -- [-1398.236] (-1405.082) (-1402.884) (-1401.462) * (-1403.279) (-1400.242) (-1396.469) [-1400.920] -- 0:01:48
Average standard deviation of split frequencies: 0.023136
325500 -- (-1401.906) (-1407.446) [-1398.825] (-1402.524) * (-1399.915) (-1399.187) [-1397.296] (-1396.611) -- 0:01:47
326000 -- (-1396.931) [-1396.777] (-1406.920) (-1396.012) * [-1397.730] (-1400.005) (-1401.686) (-1399.838) -- 0:01:47
326500 -- (-1405.667) (-1396.913) [-1402.385] (-1402.116) * [-1402.455] (-1403.002) (-1400.071) (-1397.026) -- 0:01:47
327000 -- (-1402.081) (-1398.725) (-1399.641) [-1399.055] * (-1403.557) (-1395.812) [-1395.422] (-1401.590) -- 0:01:47
327500 -- (-1405.052) (-1402.965) (-1410.554) [-1399.152] * (-1402.518) [-1394.482] (-1397.996) (-1401.416) -- 0:01:46
328000 -- [-1405.362] (-1404.606) (-1402.661) (-1401.091) * (-1400.162) (-1399.256) [-1397.524] (-1403.249) -- 0:01:46
328500 -- (-1404.839) (-1409.111) (-1399.342) [-1400.945] * (-1398.569) [-1399.701] (-1402.186) (-1407.645) -- 0:01:48
329000 -- (-1398.179) (-1396.881) [-1395.990] (-1405.373) * (-1396.530) (-1394.738) (-1399.135) [-1397.312] -- 0:01:48
329500 -- (-1406.282) (-1399.230) (-1399.711) [-1397.153] * (-1398.978) [-1399.640] (-1404.528) (-1401.068) -- 0:01:47
330000 -- (-1402.786) [-1397.574] (-1397.918) (-1401.594) * [-1397.658] (-1400.953) (-1407.497) (-1398.262) -- 0:01:47
Average standard deviation of split frequencies: 0.023523
330500 -- (-1401.422) (-1399.513) [-1396.814] (-1408.282) * (-1400.720) (-1405.617) (-1402.378) [-1396.543] -- 0:01:47
331000 -- (-1405.421) (-1403.064) [-1395.079] (-1396.648) * (-1411.505) [-1400.312] (-1398.989) (-1398.200) -- 0:01:47
331500 -- (-1406.942) (-1404.465) (-1395.646) [-1398.694] * [-1399.579] (-1403.447) (-1395.897) (-1396.669) -- 0:01:46
332000 -- (-1403.401) (-1399.118) [-1395.582] (-1396.058) * (-1398.327) (-1399.823) (-1403.598) [-1395.495] -- 0:01:46
332500 -- (-1402.446) [-1397.182] (-1395.165) (-1402.347) * (-1398.039) [-1396.282] (-1400.926) (-1401.727) -- 0:01:46
333000 -- (-1398.323) (-1396.644) [-1396.710] (-1396.075) * [-1395.989] (-1402.886) (-1397.893) (-1396.504) -- 0:01:46
333500 -- [-1399.458] (-1396.361) (-1394.932) (-1407.239) * (-1404.709) (-1406.217) (-1401.252) [-1396.542] -- 0:01:45
334000 -- [-1401.630] (-1399.211) (-1398.502) (-1399.442) * (-1401.482) (-1404.161) [-1397.007] (-1401.803) -- 0:01:45
334500 -- (-1405.698) [-1395.739] (-1401.862) (-1402.959) * (-1406.949) (-1400.327) (-1398.336) [-1398.361] -- 0:01:47
335000 -- (-1408.490) (-1400.134) (-1398.297) [-1402.649] * (-1401.732) (-1403.891) (-1400.389) [-1401.839] -- 0:01:47
Average standard deviation of split frequencies: 0.021746
335500 -- (-1405.000) (-1397.911) (-1400.582) [-1399.891] * (-1396.958) (-1397.256) [-1397.756] (-1404.630) -- 0:01:46
336000 -- (-1410.514) [-1398.116] (-1405.523) (-1399.696) * (-1403.180) [-1400.588] (-1395.245) (-1401.687) -- 0:01:46
336500 -- (-1406.778) (-1402.041) (-1398.704) [-1403.421] * (-1396.139) (-1399.308) [-1403.157] (-1414.762) -- 0:01:46
337000 -- (-1402.251) (-1401.267) (-1402.085) [-1404.457] * (-1402.803) (-1412.418) (-1396.995) [-1410.083] -- 0:01:46
337500 -- (-1403.191) [-1395.191] (-1397.700) (-1406.201) * (-1406.700) (-1403.815) (-1396.636) [-1402.897] -- 0:01:46
338000 -- (-1402.435) (-1398.969) [-1398.639] (-1404.672) * [-1397.837] (-1402.053) (-1399.094) (-1403.243) -- 0:01:45
338500 -- (-1401.023) [-1398.312] (-1402.418) (-1400.298) * [-1394.576] (-1405.791) (-1398.052) (-1398.826) -- 0:01:45
339000 -- (-1402.139) (-1397.787) [-1401.795] (-1399.057) * (-1400.763) [-1396.366] (-1401.604) (-1400.838) -- 0:01:45
339500 -- (-1403.969) (-1397.063) (-1408.959) [-1399.033] * (-1400.637) (-1399.581) [-1396.609] (-1410.667) -- 0:01:45
340000 -- (-1404.664) (-1394.255) (-1407.301) [-1399.296] * [-1398.187] (-1399.483) (-1395.566) (-1396.850) -- 0:01:44
Average standard deviation of split frequencies: 0.024908
340500 -- [-1400.058] (-1401.779) (-1406.644) (-1400.142) * (-1397.258) [-1399.396] (-1397.978) (-1399.462) -- 0:01:46
341000 -- (-1405.432) (-1404.277) [-1403.019] (-1401.944) * [-1397.984] (-1405.426) (-1400.690) (-1396.610) -- 0:01:46
341500 -- (-1395.780) [-1403.498] (-1397.133) (-1404.872) * [-1399.934] (-1413.912) (-1401.109) (-1399.851) -- 0:01:46
342000 -- (-1398.990) [-1400.420] (-1401.483) (-1397.642) * [-1398.092] (-1406.041) (-1401.278) (-1398.032) -- 0:01:45
342500 -- (-1397.557) [-1399.572] (-1402.815) (-1401.472) * [-1396.368] (-1405.642) (-1409.451) (-1405.393) -- 0:01:45
343000 -- (-1404.351) [-1399.563] (-1402.901) (-1398.541) * (-1404.554) (-1399.988) (-1403.354) [-1399.812] -- 0:01:45
343500 -- (-1398.629) (-1402.840) (-1407.139) [-1409.114] * (-1398.305) (-1398.186) [-1402.320] (-1401.082) -- 0:01:45
344000 -- [-1400.094] (-1400.599) (-1407.684) (-1408.118) * [-1401.138] (-1400.249) (-1395.571) (-1402.607) -- 0:01:44
344500 -- [-1397.358] (-1400.794) (-1403.135) (-1407.400) * [-1402.065] (-1398.612) (-1399.420) (-1405.554) -- 0:01:44
345000 -- (-1399.568) [-1404.977] (-1405.351) (-1402.561) * (-1399.014) (-1405.593) [-1400.219] (-1400.211) -- 0:01:44
Average standard deviation of split frequencies: 0.027249
345500 -- (-1405.055) [-1400.529] (-1408.595) (-1403.613) * (-1402.744) (-1404.942) [-1399.803] (-1403.753) -- 0:01:44
346000 -- [-1401.410] (-1400.237) (-1401.600) (-1402.530) * (-1405.678) (-1403.930) [-1399.487] (-1399.304) -- 0:01:43
346500 -- (-1402.099) (-1404.370) (-1401.908) [-1398.974] * (-1399.917) (-1402.593) (-1399.694) [-1395.873] -- 0:01:43
347000 -- [-1397.705] (-1402.129) (-1398.183) (-1412.344) * (-1396.915) [-1400.454] (-1401.827) (-1399.436) -- 0:01:45
347500 -- (-1401.634) [-1400.705] (-1409.757) (-1398.309) * (-1401.105) (-1395.191) [-1395.826] (-1402.020) -- 0:01:45
348000 -- [-1394.226] (-1398.317) (-1399.837) (-1403.786) * (-1401.871) [-1399.646] (-1399.643) (-1402.287) -- 0:01:44
348500 -- (-1398.790) [-1399.445] (-1399.460) (-1412.359) * (-1398.342) [-1409.879] (-1400.506) (-1406.243) -- 0:01:44
349000 -- (-1400.719) (-1401.400) [-1394.995] (-1405.342) * (-1402.846) (-1403.006) [-1402.336] (-1401.905) -- 0:01:44
349500 -- (-1398.550) (-1400.131) (-1403.613) [-1396.741] * [-1397.246] (-1400.419) (-1404.975) (-1402.915) -- 0:01:44
350000 -- (-1402.271) (-1404.145) [-1396.719] (-1401.772) * (-1395.210) [-1403.451] (-1402.805) (-1402.778) -- 0:01:44
Average standard deviation of split frequencies: 0.028230
350500 -- (-1400.900) (-1397.009) [-1397.880] (-1402.154) * [-1394.674] (-1402.176) (-1394.702) (-1403.369) -- 0:01:43
351000 -- (-1404.019) (-1402.342) (-1397.183) [-1395.667] * (-1401.448) (-1412.521) [-1397.759] (-1400.425) -- 0:01:43
351500 -- (-1400.043) (-1401.946) [-1399.459] (-1399.434) * [-1398.531] (-1403.332) (-1410.126) (-1402.699) -- 0:01:43
352000 -- (-1409.835) [-1399.472] (-1397.988) (-1402.416) * (-1402.515) [-1398.105] (-1402.591) (-1403.511) -- 0:01:43
352500 -- (-1401.624) [-1399.609] (-1398.389) (-1400.744) * (-1398.616) (-1398.517) [-1401.122] (-1401.855) -- 0:01:42
353000 -- [-1401.411] (-1401.365) (-1404.537) (-1396.616) * [-1397.476] (-1405.659) (-1400.622) (-1398.214) -- 0:01:44
353500 -- [-1404.526] (-1400.182) (-1413.908) (-1394.785) * (-1401.848) (-1398.606) (-1402.909) [-1402.657] -- 0:01:44
354000 -- (-1398.829) [-1398.893] (-1400.633) (-1398.750) * (-1403.519) (-1399.777) [-1402.743] (-1405.640) -- 0:01:44
354500 -- (-1402.969) (-1402.885) (-1398.857) [-1393.598] * (-1404.917) (-1398.058) (-1399.586) [-1403.785] -- 0:01:43
355000 -- (-1402.331) (-1400.340) (-1399.409) [-1397.181] * (-1400.240) (-1400.591) [-1396.706] (-1400.160) -- 0:01:43
Average standard deviation of split frequencies: 0.026483
355500 -- (-1400.490) (-1402.414) [-1397.316] (-1399.309) * (-1400.284) (-1396.496) (-1400.248) [-1398.843] -- 0:01:43
356000 -- (-1399.519) (-1406.677) (-1399.704) [-1400.858] * (-1406.330) [-1396.785] (-1395.085) (-1403.654) -- 0:01:43
356500 -- [-1399.507] (-1405.962) (-1401.894) (-1402.168) * (-1397.777) (-1400.624) [-1400.851] (-1404.489) -- 0:01:42
357000 -- (-1404.188) [-1402.474] (-1401.246) (-1403.407) * (-1403.498) [-1396.047] (-1399.777) (-1400.961) -- 0:01:42
357500 -- (-1399.176) [-1401.322] (-1399.797) (-1401.796) * (-1404.238) [-1403.579] (-1405.989) (-1405.066) -- 0:01:42
358000 -- [-1407.480] (-1405.762) (-1399.724) (-1400.668) * (-1402.028) (-1398.831) (-1398.497) [-1401.149] -- 0:01:42
358500 -- (-1401.679) (-1406.548) (-1403.984) [-1401.935] * (-1400.990) [-1400.434] (-1399.912) (-1408.361) -- 0:01:41
359000 -- (-1399.273) (-1401.552) [-1401.600] (-1396.985) * (-1403.276) [-1398.407] (-1398.416) (-1400.337) -- 0:01:41
359500 -- (-1398.512) (-1398.164) (-1403.077) [-1399.769] * (-1399.754) (-1400.967) (-1399.315) [-1398.454] -- 0:01:43
360000 -- (-1398.336) (-1397.353) [-1403.729] (-1404.751) * [-1398.009] (-1398.700) (-1397.725) (-1398.769) -- 0:01:43
Average standard deviation of split frequencies: 0.025487
360500 -- (-1397.698) [-1398.119] (-1407.920) (-1405.075) * (-1404.059) (-1400.570) [-1400.345] (-1399.780) -- 0:01:42
361000 -- (-1399.775) [-1399.922] (-1402.699) (-1396.294) * (-1395.843) (-1402.456) [-1399.936] (-1399.280) -- 0:01:42
361500 -- (-1399.221) (-1400.290) [-1398.407] (-1402.820) * (-1405.405) [-1400.021] (-1401.977) (-1396.629) -- 0:01:42
362000 -- [-1398.050] (-1403.578) (-1405.303) (-1397.951) * (-1409.954) (-1399.360) [-1396.403] (-1401.661) -- 0:01:42
362500 -- (-1407.544) (-1400.667) (-1397.773) [-1396.636] * (-1404.390) [-1397.829] (-1400.614) (-1403.933) -- 0:01:42
363000 -- (-1400.641) [-1395.142] (-1400.664) (-1402.758) * (-1401.675) (-1397.075) [-1397.821] (-1404.237) -- 0:01:41
363500 -- [-1403.044] (-1396.888) (-1402.464) (-1400.217) * (-1398.442) (-1404.458) [-1398.034] (-1401.162) -- 0:01:41
364000 -- (-1404.091) (-1401.265) (-1399.679) [-1404.170] * (-1399.051) (-1400.244) [-1395.243] (-1397.270) -- 0:01:41
364500 -- (-1402.124) (-1407.665) (-1399.589) [-1399.464] * [-1401.063] (-1400.844) (-1402.533) (-1399.654) -- 0:01:41
365000 -- (-1397.721) [-1399.381] (-1397.050) (-1398.253) * [-1400.632] (-1406.734) (-1399.526) (-1402.706) -- 0:01:40
Average standard deviation of split frequencies: 0.023828
365500 -- (-1407.016) (-1398.199) (-1402.306) [-1400.458] * [-1395.647] (-1400.291) (-1405.034) (-1398.773) -- 0:01:40
366000 -- (-1400.272) (-1399.313) [-1400.197] (-1400.610) * [-1394.609] (-1396.967) (-1408.951) (-1397.771) -- 0:01:42
366500 -- (-1402.102) (-1400.248) [-1398.769] (-1402.434) * (-1401.721) (-1401.968) (-1407.486) [-1396.418] -- 0:01:41
367000 -- (-1398.291) (-1400.669) (-1404.791) [-1397.601] * (-1402.314) (-1398.188) [-1399.510] (-1398.607) -- 0:01:41
367500 -- (-1400.916) [-1400.619] (-1406.869) (-1403.289) * (-1398.427) (-1400.284) [-1401.815] (-1402.322) -- 0:01:41
368000 -- (-1400.062) (-1405.568) (-1399.541) [-1395.818] * (-1403.723) (-1402.329) [-1397.620] (-1400.938) -- 0:01:41
368500 -- (-1398.491) (-1410.108) (-1401.057) [-1399.070] * [-1396.594] (-1402.124) (-1407.533) (-1402.458) -- 0:01:41
369000 -- (-1399.970) (-1400.560) (-1402.393) [-1394.783] * (-1399.060) (-1405.216) (-1403.615) [-1401.137] -- 0:01:40
369500 -- (-1398.686) (-1398.245) (-1403.833) [-1400.127] * [-1400.007] (-1403.601) (-1402.222) (-1397.004) -- 0:01:40
370000 -- (-1403.100) (-1402.207) [-1400.681] (-1399.250) * (-1398.671) [-1405.710] (-1405.258) (-1400.366) -- 0:01:40
Average standard deviation of split frequencies: 0.024800
370500 -- [-1397.971] (-1399.187) (-1401.327) (-1401.762) * (-1397.210) (-1404.136) (-1404.055) [-1398.276] -- 0:01:40
371000 -- (-1401.982) [-1396.355] (-1396.718) (-1402.799) * (-1406.004) (-1400.478) [-1394.760] (-1401.059) -- 0:01:40
371500 -- (-1396.329) (-1398.507) (-1399.300) [-1399.080] * (-1405.737) [-1397.524] (-1396.625) (-1404.358) -- 0:01:39
372000 -- [-1400.078] (-1401.786) (-1400.450) (-1405.101) * (-1408.877) [-1402.524] (-1399.341) (-1401.966) -- 0:01:41
372500 -- (-1396.304) (-1398.721) [-1400.233] (-1405.873) * (-1403.871) [-1398.508] (-1399.746) (-1395.252) -- 0:01:41
373000 -- (-1399.423) [-1402.760] (-1403.312) (-1402.384) * (-1405.792) (-1396.995) [-1402.330] (-1399.213) -- 0:01:40
373500 -- (-1399.035) (-1402.558) (-1396.913) [-1393.997] * (-1406.024) (-1402.877) [-1398.622] (-1396.535) -- 0:01:40
374000 -- (-1398.560) [-1396.084] (-1404.646) (-1400.451) * [-1402.825] (-1397.075) (-1399.612) (-1397.166) -- 0:01:40
374500 -- (-1403.595) [-1394.559] (-1400.444) (-1395.763) * (-1395.527) [-1400.238] (-1405.549) (-1397.146) -- 0:01:40
375000 -- (-1398.346) (-1402.759) (-1401.995) [-1398.999] * (-1398.507) [-1401.352] (-1396.897) (-1407.704) -- 0:01:40
Average standard deviation of split frequencies: 0.026328
375500 -- (-1398.284) [-1402.258] (-1398.739) (-1397.401) * (-1401.719) (-1399.352) [-1405.685] (-1399.704) -- 0:01:39
376000 -- (-1408.373) [-1399.828] (-1406.576) (-1398.496) * (-1397.174) (-1402.763) (-1403.153) [-1401.312] -- 0:01:39
376500 -- (-1406.170) [-1399.404] (-1405.806) (-1396.486) * (-1395.651) (-1401.296) (-1406.719) [-1405.246] -- 0:01:39
377000 -- [-1401.506] (-1398.919) (-1398.589) (-1396.555) * (-1399.393) [-1396.260] (-1410.851) (-1402.523) -- 0:01:39
377500 -- (-1408.023) [-1404.595] (-1402.137) (-1402.322) * (-1402.204) [-1399.000] (-1406.885) (-1409.916) -- 0:01:38
378000 -- [-1405.287] (-1395.238) (-1408.928) (-1402.322) * [-1396.676] (-1406.768) (-1408.526) (-1398.196) -- 0:01:38
378500 -- (-1400.738) (-1396.220) [-1396.424] (-1401.675) * [-1398.030] (-1400.397) (-1404.756) (-1397.029) -- 0:01:40
379000 -- (-1402.335) (-1403.671) [-1397.702] (-1399.162) * [-1401.336] (-1398.590) (-1403.984) (-1397.427) -- 0:01:39
379500 -- (-1403.726) [-1397.556] (-1402.979) (-1399.403) * [-1404.108] (-1398.516) (-1397.326) (-1398.131) -- 0:01:39
380000 -- (-1403.487) (-1402.917) [-1399.443] (-1402.533) * (-1397.161) [-1396.347] (-1397.836) (-1396.083) -- 0:01:39
Average standard deviation of split frequencies: 0.028482
380500 -- (-1400.972) [-1396.581] (-1400.639) (-1402.843) * [-1402.248] (-1404.659) (-1398.415) (-1402.028) -- 0:01:39
381000 -- [-1398.705] (-1396.617) (-1404.084) (-1399.899) * (-1398.674) (-1403.117) [-1398.560] (-1401.400) -- 0:01:39
381500 -- (-1399.109) (-1402.013) [-1397.027] (-1399.245) * [-1396.796] (-1398.561) (-1406.013) (-1403.032) -- 0:01:38
382000 -- (-1400.307) (-1399.459) [-1397.937] (-1404.859) * (-1407.122) (-1402.763) [-1400.919] (-1397.914) -- 0:01:38
382500 -- (-1404.467) (-1399.497) (-1398.571) [-1401.727] * (-1397.492) (-1405.196) [-1397.039] (-1404.864) -- 0:01:38
383000 -- (-1403.826) [-1400.869] (-1400.677) (-1399.176) * (-1401.370) [-1399.754] (-1399.266) (-1398.331) -- 0:01:38
383500 -- [-1399.014] (-1402.937) (-1410.316) (-1407.590) * (-1400.813) (-1401.759) [-1401.443] (-1402.284) -- 0:01:38
384000 -- (-1396.319) (-1398.067) (-1406.845) [-1400.479] * (-1402.703) [-1397.750] (-1399.786) (-1400.773) -- 0:01:37
384500 -- (-1399.910) [-1399.925] (-1406.448) (-1396.849) * (-1401.274) (-1403.425) (-1401.787) [-1396.232] -- 0:01:39
385000 -- (-1398.020) (-1400.415) (-1397.344) [-1396.342] * (-1396.536) [-1396.164] (-1398.881) (-1400.535) -- 0:01:39
Average standard deviation of split frequencies: 0.025646
385500 -- (-1397.464) (-1398.739) [-1396.711] (-1401.963) * (-1404.921) (-1398.592) [-1396.483] (-1401.973) -- 0:01:38
386000 -- (-1401.108) (-1399.816) (-1407.878) [-1397.003] * (-1400.486) (-1405.322) [-1401.097] (-1400.625) -- 0:01:38
386500 -- [-1398.279] (-1402.363) (-1401.394) (-1397.038) * [-1402.482] (-1396.813) (-1406.249) (-1408.070) -- 0:01:38
387000 -- [-1397.166] (-1405.496) (-1398.977) (-1402.979) * (-1403.961) (-1398.304) (-1407.006) [-1399.585] -- 0:01:38
387500 -- (-1396.079) [-1398.512] (-1398.456) (-1400.440) * [-1395.820] (-1398.253) (-1403.953) (-1398.807) -- 0:01:38
388000 -- (-1400.080) (-1402.627) [-1398.330] (-1403.972) * (-1398.537) [-1404.761] (-1397.269) (-1401.584) -- 0:01:37
388500 -- (-1403.545) (-1400.422) (-1400.689) [-1396.843] * (-1402.970) (-1405.373) (-1404.120) [-1397.787] -- 0:01:37
389000 -- [-1396.004] (-1404.495) (-1397.990) (-1400.773) * [-1395.954] (-1403.943) (-1407.851) (-1401.237) -- 0:01:37
389500 -- (-1395.812) (-1399.148) [-1398.565] (-1400.048) * (-1401.166) [-1401.452] (-1399.775) (-1401.439) -- 0:01:37
390000 -- (-1397.517) (-1398.690) [-1398.336] (-1399.753) * (-1396.069) (-1401.814) [-1401.296] (-1406.002) -- 0:01:36
Average standard deviation of split frequencies: 0.023530
390500 -- (-1402.376) (-1400.694) [-1398.119] (-1396.006) * (-1395.823) (-1402.402) (-1396.060) [-1400.806] -- 0:01:36
391000 -- (-1400.979) [-1393.663] (-1395.661) (-1396.719) * [-1400.830] (-1397.241) (-1401.139) (-1402.015) -- 0:01:38
391500 -- (-1401.091) (-1400.237) [-1407.097] (-1398.074) * [-1401.952] (-1394.080) (-1397.867) (-1402.913) -- 0:01:37
392000 -- (-1402.393) (-1402.958) (-1398.290) [-1394.691] * (-1400.806) [-1397.187] (-1397.758) (-1400.965) -- 0:01:37
392500 -- (-1399.222) (-1399.987) (-1399.369) [-1399.847] * (-1400.127) (-1395.843) [-1399.220] (-1398.705) -- 0:01:37
393000 -- (-1400.325) (-1405.079) (-1405.885) [-1403.185] * (-1402.142) (-1402.299) [-1400.734] (-1403.163) -- 0:01:37
393500 -- (-1394.951) (-1401.032) [-1401.869] (-1397.290) * (-1403.738) [-1403.049] (-1400.484) (-1401.495) -- 0:01:37
394000 -- (-1400.642) (-1398.473) (-1397.723) [-1397.268] * [-1399.975] (-1400.802) (-1398.081) (-1405.166) -- 0:01:36
394500 -- [-1398.853] (-1401.330) (-1402.881) (-1402.440) * (-1401.849) [-1401.783] (-1403.497) (-1399.297) -- 0:01:36
395000 -- [-1397.870] (-1404.164) (-1399.694) (-1400.191) * [-1399.904] (-1398.748) (-1401.471) (-1400.797) -- 0:01:36
Average standard deviation of split frequencies: 0.022023
395500 -- (-1401.761) (-1401.174) (-1400.080) [-1402.616] * [-1398.703] (-1399.658) (-1405.092) (-1405.529) -- 0:01:36
396000 -- (-1401.031) (-1397.770) (-1401.845) [-1397.741] * [-1400.942] (-1398.026) (-1400.366) (-1409.535) -- 0:01:36
396500 -- (-1401.788) [-1401.645] (-1402.645) (-1405.703) * [-1399.618] (-1403.413) (-1408.877) (-1402.586) -- 0:01:35
397000 -- (-1399.437) (-1400.606) (-1405.801) [-1399.118] * [-1398.676] (-1404.183) (-1409.035) (-1403.336) -- 0:01:37
397500 -- (-1403.384) [-1401.403] (-1400.080) (-1400.244) * (-1401.552) (-1397.438) (-1411.356) [-1405.026] -- 0:01:37
398000 -- (-1403.474) (-1401.913) [-1398.443] (-1405.992) * (-1410.917) [-1400.509] (-1405.099) (-1399.936) -- 0:01:36
398500 -- [-1396.888] (-1405.750) (-1401.630) (-1400.484) * (-1398.558) [-1396.938] (-1397.541) (-1400.039) -- 0:01:36
399000 -- [-1398.503] (-1407.253) (-1398.216) (-1407.395) * (-1403.956) (-1399.783) [-1403.871] (-1400.216) -- 0:01:36
399500 -- [-1396.864] (-1401.998) (-1403.962) (-1396.452) * [-1400.296] (-1407.090) (-1401.701) (-1401.826) -- 0:01:36
400000 -- (-1401.410) (-1404.024) [-1393.537] (-1397.129) * [-1401.343] (-1400.190) (-1403.775) (-1402.313) -- 0:01:36
Average standard deviation of split frequencies: 0.020590
400500 -- (-1400.246) (-1402.759) [-1400.174] (-1398.876) * (-1397.394) [-1398.287] (-1400.290) (-1400.930) -- 0:01:35
401000 -- (-1396.016) (-1400.987) [-1398.251] (-1398.664) * [-1404.188] (-1401.291) (-1401.997) (-1397.849) -- 0:01:35
401500 -- (-1403.342) (-1399.218) (-1399.016) [-1399.119] * [-1400.243] (-1403.421) (-1400.367) (-1398.854) -- 0:01:35
402000 -- (-1402.695) (-1404.265) (-1412.911) [-1398.187] * (-1400.080) (-1404.068) [-1400.476] (-1399.413) -- 0:01:35
402500 -- (-1400.869) (-1408.763) (-1396.276) [-1405.396] * (-1407.094) (-1403.483) (-1402.232) [-1400.144] -- 0:01:35
403000 -- (-1397.934) (-1398.146) [-1397.695] (-1401.206) * [-1402.859] (-1400.862) (-1394.300) (-1400.467) -- 0:01:34
403500 -- (-1394.501) (-1400.287) [-1397.930] (-1401.741) * (-1397.569) (-1400.152) (-1395.408) [-1397.179] -- 0:01:36
404000 -- (-1399.604) [-1398.665] (-1402.984) (-1401.405) * (-1400.382) [-1396.787] (-1395.348) (-1395.559) -- 0:01:35
404500 -- (-1396.278) (-1400.702) [-1403.997] (-1398.109) * (-1402.157) (-1398.363) (-1412.203) [-1396.827] -- 0:01:35
405000 -- (-1400.354) (-1403.357) (-1399.713) [-1400.720] * (-1395.082) [-1399.875] (-1397.546) (-1396.669) -- 0:01:35
Average standard deviation of split frequencies: 0.020900
405500 -- (-1400.879) (-1396.567) [-1401.430] (-1399.057) * [-1397.891] (-1397.110) (-1395.540) (-1401.311) -- 0:01:35
406000 -- (-1402.616) (-1395.584) [-1400.394] (-1403.485) * (-1403.876) [-1399.816] (-1402.130) (-1398.289) -- 0:01:35
406500 -- (-1409.665) (-1396.659) (-1407.007) [-1399.215] * (-1402.278) (-1398.259) [-1401.929] (-1399.985) -- 0:01:34
407000 -- [-1406.614] (-1399.082) (-1402.366) (-1398.057) * [-1400.508] (-1401.022) (-1399.391) (-1403.439) -- 0:01:34
407500 -- [-1401.630] (-1398.116) (-1397.825) (-1404.791) * (-1402.250) (-1404.018) (-1402.006) [-1399.872] -- 0:01:34
408000 -- (-1406.421) (-1400.313) [-1398.203] (-1402.983) * [-1402.072] (-1397.771) (-1397.945) (-1398.638) -- 0:01:34
408500 -- [-1397.750] (-1407.039) (-1396.729) (-1401.223) * (-1403.747) [-1396.224] (-1398.254) (-1396.592) -- 0:01:34
409000 -- (-1397.298) (-1410.882) [-1398.996] (-1400.942) * (-1398.664) (-1398.544) (-1402.291) [-1402.211] -- 0:01:33
409500 -- (-1400.427) (-1405.764) (-1405.394) [-1398.711] * (-1398.700) (-1405.140) (-1403.580) [-1397.871] -- 0:01:35
410000 -- (-1401.144) (-1400.623) [-1398.760] (-1396.055) * [-1395.892] (-1400.375) (-1397.978) (-1400.734) -- 0:01:34
Average standard deviation of split frequencies: 0.023532
410500 -- (-1399.030) (-1400.519) (-1396.448) [-1403.450] * [-1401.966] (-1396.702) (-1397.471) (-1400.737) -- 0:01:34
411000 -- (-1398.955) (-1403.249) (-1396.514) [-1403.674] * (-1405.052) [-1398.207] (-1396.350) (-1402.179) -- 0:01:34
411500 -- [-1399.470] (-1401.397) (-1399.170) (-1397.578) * [-1402.791] (-1396.197) (-1399.956) (-1401.976) -- 0:01:34
412000 -- [-1398.011] (-1397.506) (-1394.410) (-1404.293) * (-1401.184) (-1403.087) [-1404.074] (-1394.317) -- 0:01:34
412500 -- (-1402.853) (-1397.604) [-1398.568] (-1408.199) * (-1396.718) [-1406.481] (-1399.309) (-1399.587) -- 0:01:34
413000 -- (-1403.780) [-1397.263] (-1406.599) (-1400.961) * (-1400.261) (-1405.174) [-1400.673] (-1401.211) -- 0:01:33
413500 -- (-1406.987) [-1398.734] (-1411.058) (-1404.489) * (-1399.711) (-1404.397) [-1401.376] (-1406.455) -- 0:01:33
414000 -- (-1397.802) (-1410.786) [-1398.071] (-1398.504) * (-1403.283) (-1399.745) [-1402.677] (-1401.358) -- 0:01:33
414500 -- (-1400.124) (-1402.819) (-1396.230) [-1400.982] * (-1406.392) (-1399.980) [-1401.025] (-1402.834) -- 0:01:33
415000 -- (-1398.334) (-1403.252) [-1398.871] (-1404.838) * (-1400.142) (-1399.701) [-1404.579] (-1400.425) -- 0:01:33
Average standard deviation of split frequencies: 0.023797
415500 -- (-1403.732) (-1400.402) [-1397.690] (-1407.227) * (-1397.742) (-1400.292) (-1399.814) [-1397.880] -- 0:01:34
416000 -- (-1402.017) [-1395.936] (-1401.572) (-1400.311) * (-1398.085) (-1395.515) [-1402.977] (-1403.868) -- 0:01:34
416500 -- (-1400.450) (-1397.880) [-1398.181] (-1404.110) * (-1395.944) (-1399.724) [-1398.171] (-1397.095) -- 0:01:33
417000 -- (-1398.494) [-1402.791] (-1394.984) (-1399.741) * (-1397.244) (-1399.929) [-1408.625] (-1404.886) -- 0:01:33
417500 -- [-1397.725] (-1401.138) (-1399.375) (-1400.021) * (-1402.002) [-1398.883] (-1403.500) (-1403.356) -- 0:01:33
418000 -- (-1404.215) (-1401.335) [-1399.501] (-1402.102) * (-1401.916) [-1403.199] (-1401.236) (-1396.914) -- 0:01:33
418500 -- (-1401.047) (-1401.711) [-1397.688] (-1399.871) * (-1398.561) (-1402.079) [-1402.146] (-1397.251) -- 0:01:33
419000 -- (-1393.798) (-1402.098) [-1406.046] (-1399.817) * (-1401.187) [-1397.117] (-1396.350) (-1399.730) -- 0:01:32
419500 -- [-1394.610] (-1405.364) (-1406.343) (-1397.644) * [-1403.302] (-1399.672) (-1402.129) (-1398.314) -- 0:01:32
420000 -- (-1398.607) (-1405.861) [-1404.546] (-1399.378) * (-1396.484) (-1407.926) [-1404.622] (-1401.076) -- 0:01:32
Average standard deviation of split frequencies: 0.023533
420500 -- (-1398.925) (-1405.553) [-1401.234] (-1396.197) * (-1399.157) (-1401.394) [-1403.731] (-1399.955) -- 0:01:32
421000 -- (-1395.222) (-1401.783) [-1396.073] (-1395.588) * (-1402.779) (-1398.262) (-1399.242) [-1398.985] -- 0:01:32
421500 -- [-1394.158] (-1400.241) (-1401.603) (-1405.740) * (-1400.803) [-1398.269] (-1404.938) (-1398.353) -- 0:01:31
422000 -- (-1399.146) [-1398.094] (-1397.593) (-1398.650) * [-1395.914] (-1411.390) (-1404.418) (-1397.990) -- 0:01:33
422500 -- (-1404.176) (-1402.603) (-1400.692) [-1400.973] * (-1404.065) (-1404.764) [-1407.267] (-1397.964) -- 0:01:32
423000 -- [-1403.013] (-1397.345) (-1401.012) (-1405.852) * (-1407.627) [-1403.720] (-1398.872) (-1403.080) -- 0:01:32
423500 -- (-1404.211) (-1395.757) (-1396.146) [-1398.757] * (-1402.450) [-1405.812] (-1398.177) (-1395.879) -- 0:01:32
424000 -- (-1412.258) (-1401.380) [-1403.166] (-1403.080) * (-1400.179) (-1403.270) [-1399.039] (-1400.093) -- 0:01:32
424500 -- (-1413.090) (-1399.235) (-1406.297) [-1401.568] * (-1403.140) (-1396.432) (-1403.230) [-1402.208] -- 0:01:32
425000 -- (-1411.383) (-1402.921) (-1407.197) [-1395.370] * (-1402.497) [-1397.569] (-1402.846) (-1401.367) -- 0:01:32
Average standard deviation of split frequencies: 0.022132
425500 -- (-1402.780) [-1405.238] (-1403.758) (-1400.116) * (-1403.333) (-1398.710) (-1402.380) [-1401.063] -- 0:01:31
426000 -- (-1403.170) (-1401.083) [-1401.578] (-1397.247) * [-1399.324] (-1397.975) (-1400.516) (-1402.503) -- 0:01:31
426500 -- (-1398.769) (-1401.197) [-1401.358] (-1404.635) * [-1398.235] (-1403.716) (-1399.323) (-1405.687) -- 0:01:31
427000 -- (-1399.561) [-1400.553] (-1406.138) (-1402.852) * (-1398.227) [-1400.766] (-1400.702) (-1410.040) -- 0:01:31
427500 -- [-1397.839] (-1398.134) (-1405.187) (-1403.310) * [-1396.779] (-1400.431) (-1397.429) (-1399.813) -- 0:01:31
428000 -- (-1399.843) (-1397.263) [-1404.324] (-1404.341) * (-1400.381) [-1397.747] (-1395.827) (-1400.804) -- 0:01:32
428500 -- (-1405.156) (-1400.706) (-1403.244) [-1403.323] * (-1403.024) (-1403.616) (-1403.177) [-1398.855] -- 0:01:32
429000 -- (-1402.215) (-1400.505) (-1406.226) [-1398.367] * (-1405.000) (-1401.547) (-1399.629) [-1401.665] -- 0:01:31
429500 -- [-1399.037] (-1396.074) (-1409.219) (-1398.326) * (-1402.713) (-1400.446) (-1403.613) [-1398.384] -- 0:01:31
430000 -- (-1414.224) (-1399.918) (-1406.764) [-1400.334] * (-1400.113) (-1403.251) (-1409.460) [-1399.643] -- 0:01:31
Average standard deviation of split frequencies: 0.020250
430500 -- (-1401.515) (-1400.437) [-1400.998] (-1412.983) * (-1404.617) [-1400.259] (-1409.865) (-1404.820) -- 0:01:31
431000 -- (-1401.106) [-1403.693] (-1400.512) (-1405.611) * (-1401.056) (-1407.216) (-1402.270) [-1403.822] -- 0:01:31
431500 -- (-1401.941) [-1398.622] (-1403.054) (-1406.077) * (-1396.121) [-1397.161] (-1401.585) (-1399.996) -- 0:01:30
432000 -- (-1398.742) [-1396.211] (-1401.785) (-1401.550) * (-1398.048) (-1404.062) (-1398.410) [-1401.718] -- 0:01:30
432500 -- [-1398.154] (-1395.994) (-1401.990) (-1399.314) * [-1402.548] (-1402.563) (-1395.475) (-1401.186) -- 0:01:30
433000 -- (-1406.753) (-1394.321) [-1400.171] (-1402.075) * (-1406.450) (-1406.533) [-1397.569] (-1396.886) -- 0:01:30
433500 -- (-1399.627) [-1394.126] (-1402.358) (-1397.273) * (-1402.590) (-1404.343) (-1396.954) [-1399.553] -- 0:01:30
434000 -- [-1398.647] (-1397.231) (-1404.686) (-1401.327) * (-1400.881) (-1404.559) (-1400.927) [-1397.160] -- 0:01:29
434500 -- [-1401.015] (-1396.868) (-1400.548) (-1400.623) * (-1400.079) (-1405.617) (-1398.849) [-1399.217] -- 0:01:31
435000 -- [-1399.218] (-1403.451) (-1405.808) (-1397.658) * [-1397.127] (-1401.972) (-1402.634) (-1403.989) -- 0:01:30
Average standard deviation of split frequencies: 0.021624
435500 -- (-1404.155) [-1396.943] (-1402.332) (-1401.050) * (-1399.574) (-1403.200) (-1400.151) [-1401.147] -- 0:01:30
436000 -- (-1403.481) (-1404.090) [-1398.503] (-1400.913) * [-1396.535] (-1398.286) (-1403.251) (-1403.012) -- 0:01:30
436500 -- (-1403.366) (-1398.763) [-1406.366] (-1399.653) * (-1398.315) [-1396.760] (-1408.436) (-1404.821) -- 0:01:30
437000 -- (-1407.436) (-1400.850) (-1403.490) [-1396.940] * (-1400.081) (-1397.398) (-1413.366) [-1408.854] -- 0:01:30
437500 -- (-1402.895) (-1397.641) [-1402.372] (-1404.853) * (-1401.757) (-1397.981) (-1415.915) [-1404.321] -- 0:01:30
438000 -- (-1402.922) (-1402.022) [-1398.577] (-1398.466) * [-1398.149] (-1399.815) (-1404.643) (-1401.727) -- 0:01:29
438500 -- (-1402.010) (-1399.815) (-1400.863) [-1399.109] * (-1404.977) (-1403.495) [-1401.668] (-1394.564) -- 0:01:29
439000 -- (-1399.445) (-1401.699) (-1399.085) [-1404.157] * [-1403.146] (-1396.283) (-1405.487) (-1398.312) -- 0:01:29
439500 -- (-1399.408) [-1396.932] (-1397.921) (-1400.158) * (-1401.825) [-1400.344] (-1398.387) (-1403.656) -- 0:01:29
440000 -- (-1402.692) (-1398.792) [-1399.357] (-1406.128) * [-1397.819] (-1402.683) (-1404.040) (-1403.266) -- 0:01:29
Average standard deviation of split frequencies: 0.021930
440500 -- (-1398.563) [-1395.221] (-1404.675) (-1398.217) * (-1403.886) [-1397.253] (-1410.433) (-1400.716) -- 0:01:30
441000 -- [-1399.948] (-1401.205) (-1402.974) (-1400.171) * (-1400.239) (-1402.375) [-1405.812] (-1402.868) -- 0:01:29
441500 -- (-1400.462) (-1400.550) [-1401.826] (-1398.231) * [-1394.968] (-1404.679) (-1404.712) (-1401.118) -- 0:01:29
442000 -- (-1399.698) (-1401.560) (-1404.492) [-1402.268] * (-1400.183) (-1401.546) (-1397.176) [-1399.568] -- 0:01:29
442500 -- (-1396.902) (-1401.907) [-1399.523] (-1396.522) * (-1407.152) (-1398.989) (-1401.584) [-1404.287] -- 0:01:29
443000 -- (-1396.228) [-1404.211] (-1400.781) (-1411.766) * (-1404.568) (-1400.341) (-1402.277) [-1401.138] -- 0:01:29
443500 -- (-1407.576) (-1401.181) [-1405.944] (-1411.922) * [-1400.387] (-1402.567) (-1402.424) (-1399.369) -- 0:01:29
444000 -- [-1401.427] (-1397.839) (-1395.966) (-1404.761) * (-1400.216) [-1398.482] (-1405.264) (-1402.627) -- 0:01:28
444500 -- (-1398.419) (-1398.403) (-1399.334) [-1398.921] * [-1399.235] (-1399.216) (-1397.792) (-1405.293) -- 0:01:28
445000 -- (-1401.445) (-1401.029) (-1400.053) [-1396.472] * [-1400.636] (-1405.243) (-1400.906) (-1400.742) -- 0:01:28
Average standard deviation of split frequencies: 0.021668
445500 -- (-1399.984) (-1400.273) [-1401.260] (-1397.824) * (-1407.228) (-1401.246) [-1402.382] (-1401.518) -- 0:01:28
446000 -- (-1403.171) (-1400.921) [-1393.736] (-1399.883) * (-1402.831) (-1403.649) [-1399.612] (-1398.267) -- 0:01:28
446500 -- (-1399.019) (-1397.995) [-1394.470] (-1396.570) * (-1399.381) [-1400.596] (-1398.806) (-1400.529) -- 0:01:28
447000 -- (-1400.535) (-1400.355) [-1396.045] (-1395.630) * (-1402.316) [-1397.602] (-1400.921) (-1398.650) -- 0:01:29
447500 -- (-1400.737) (-1398.593) [-1398.677] (-1401.977) * (-1402.418) (-1398.736) (-1402.138) [-1401.425] -- 0:01:28
448000 -- (-1403.071) [-1395.865] (-1396.136) (-1402.748) * (-1401.423) [-1399.481] (-1403.534) (-1398.907) -- 0:01:28
448500 -- (-1404.863) [-1398.024] (-1401.463) (-1403.793) * (-1398.549) [-1398.793] (-1406.376) (-1398.063) -- 0:01:28
449000 -- (-1403.974) (-1402.088) [-1396.586] (-1406.405) * (-1400.278) (-1403.017) [-1400.262] (-1404.204) -- 0:01:28
449500 -- (-1396.590) [-1396.045] (-1407.665) (-1399.205) * (-1404.286) [-1397.326] (-1403.656) (-1400.775) -- 0:01:28
450000 -- (-1401.393) (-1407.134) (-1408.265) [-1401.863] * (-1402.595) (-1398.537) (-1402.312) [-1395.833] -- 0:01:28
Average standard deviation of split frequencies: 0.019874
450500 -- (-1400.607) (-1402.224) [-1407.101] (-1400.266) * [-1404.092] (-1404.397) (-1398.002) (-1403.835) -- 0:01:27
451000 -- (-1397.517) [-1406.012] (-1408.771) (-1402.316) * (-1396.022) (-1403.291) [-1398.182] (-1402.253) -- 0:01:27
451500 -- [-1396.926] (-1402.456) (-1404.856) (-1398.884) * (-1399.702) (-1399.719) [-1399.934] (-1398.406) -- 0:01:27
452000 -- [-1393.880] (-1408.447) (-1404.372) (-1405.064) * [-1397.728] (-1397.576) (-1406.135) (-1397.969) -- 0:01:27
452500 -- [-1398.739] (-1399.740) (-1401.193) (-1403.738) * (-1402.109) (-1402.239) [-1409.972] (-1405.707) -- 0:01:27
453000 -- [-1396.443] (-1398.864) (-1403.330) (-1401.139) * (-1400.736) [-1401.691] (-1406.557) (-1404.367) -- 0:01:26
453500 -- (-1404.722) [-1398.799] (-1404.307) (-1397.388) * [-1399.570] (-1398.975) (-1410.716) (-1401.312) -- 0:01:27
454000 -- [-1402.309] (-1403.984) (-1400.185) (-1399.939) * (-1410.230) (-1396.673) (-1411.099) [-1399.366] -- 0:01:27
454500 -- [-1403.254] (-1399.133) (-1402.455) (-1402.227) * (-1399.053) [-1402.379] (-1408.515) (-1400.366) -- 0:01:27
455000 -- [-1396.813] (-1399.355) (-1398.078) (-1401.316) * (-1398.751) [-1396.606] (-1402.505) (-1399.726) -- 0:01:27
Average standard deviation of split frequencies: 0.020676
455500 -- (-1395.315) (-1401.122) [-1402.260] (-1403.768) * (-1399.223) [-1395.445] (-1417.052) (-1402.840) -- 0:01:27
456000 -- [-1396.471] (-1402.190) (-1400.259) (-1399.079) * (-1401.758) (-1397.635) [-1403.472] (-1408.397) -- 0:01:27
456500 -- (-1398.026) [-1398.443] (-1407.950) (-1403.132) * (-1405.875) [-1397.287] (-1403.132) (-1397.434) -- 0:01:26
457000 -- [-1403.422] (-1409.468) (-1406.046) (-1399.586) * [-1401.556] (-1405.296) (-1406.270) (-1399.922) -- 0:01:26
457500 -- (-1403.323) (-1408.657) (-1405.735) [-1401.570] * [-1404.260] (-1401.547) (-1413.538) (-1398.883) -- 0:01:26
458000 -- [-1405.376] (-1405.139) (-1400.926) (-1408.344) * [-1398.813] (-1396.519) (-1401.979) (-1402.653) -- 0:01:26
458500 -- (-1403.242) [-1401.154] (-1399.093) (-1403.458) * (-1400.361) [-1401.927] (-1400.288) (-1396.623) -- 0:01:26
459000 -- [-1407.334] (-1404.687) (-1396.641) (-1403.610) * (-1400.087) [-1403.048] (-1398.017) (-1401.552) -- 0:01:26
459500 -- (-1399.121) (-1397.290) [-1398.580] (-1406.425) * (-1403.583) (-1401.045) (-1401.494) [-1397.709] -- 0:01:27
460000 -- [-1397.269] (-1397.799) (-1397.232) (-1412.941) * [-1400.035] (-1399.276) (-1399.195) (-1401.146) -- 0:01:26
Average standard deviation of split frequencies: 0.023024
460500 -- (-1405.462) [-1401.247] (-1394.940) (-1411.757) * [-1410.548] (-1400.880) (-1399.824) (-1400.625) -- 0:01:26
461000 -- (-1403.952) [-1396.894] (-1402.430) (-1408.976) * (-1404.601) (-1401.178) (-1403.606) [-1402.281] -- 0:01:26
461500 -- (-1407.449) [-1403.829] (-1402.589) (-1407.788) * (-1399.967) (-1396.570) (-1408.169) [-1399.718] -- 0:01:26
462000 -- (-1406.837) (-1398.542) [-1403.244] (-1407.737) * (-1396.611) [-1398.017] (-1397.782) (-1398.154) -- 0:01:26
462500 -- (-1403.407) (-1403.130) (-1409.968) [-1404.013] * (-1400.563) [-1400.278] (-1402.559) (-1402.229) -- 0:01:26
463000 -- (-1400.004) [-1395.878] (-1398.819) (-1401.305) * [-1400.897] (-1402.293) (-1407.402) (-1402.040) -- 0:01:25
463500 -- (-1399.364) (-1397.454) [-1399.639] (-1402.554) * [-1401.101] (-1401.000) (-1399.506) (-1406.086) -- 0:01:25
464000 -- (-1405.078) (-1401.941) [-1406.226] (-1401.948) * (-1406.223) (-1403.563) (-1393.458) [-1397.501] -- 0:01:25
464500 -- (-1400.890) [-1402.751] (-1405.295) (-1396.900) * (-1402.274) (-1400.248) (-1397.877) [-1400.384] -- 0:01:25
465000 -- (-1403.536) [-1407.909] (-1403.205) (-1400.473) * (-1401.547) (-1398.287) (-1399.164) [-1398.450] -- 0:01:25
Average standard deviation of split frequencies: 0.021749
465500 -- (-1400.465) [-1409.307] (-1402.922) (-1400.526) * (-1403.203) (-1401.944) [-1399.081] (-1402.419) -- 0:01:24
466000 -- [-1397.717] (-1399.575) (-1405.061) (-1402.603) * (-1398.763) (-1400.095) [-1398.328] (-1400.416) -- 0:01:25
466500 -- (-1401.745) (-1405.409) [-1401.567] (-1400.372) * (-1406.927) (-1405.946) (-1404.191) [-1398.853] -- 0:01:25
467000 -- (-1409.387) (-1403.179) (-1398.529) [-1398.746] * (-1397.006) (-1405.454) [-1394.382] (-1400.795) -- 0:01:25
467500 -- [-1396.787] (-1404.498) (-1400.180) (-1399.442) * (-1403.408) (-1399.731) [-1398.099] (-1405.798) -- 0:01:25
468000 -- (-1396.905) (-1407.001) (-1397.671) [-1396.851] * (-1400.424) (-1406.721) [-1398.039] (-1398.648) -- 0:01:25
468500 -- (-1406.309) (-1405.378) (-1399.828) [-1395.965] * (-1404.934) (-1405.319) [-1401.197] (-1409.516) -- 0:01:25
469000 -- (-1398.557) [-1403.212] (-1399.246) (-1397.606) * (-1396.595) (-1402.847) (-1399.267) [-1398.487] -- 0:01:24
469500 -- (-1401.444) (-1399.011) [-1401.119] (-1400.712) * (-1399.680) (-1402.454) (-1405.946) [-1397.792] -- 0:01:24
470000 -- (-1401.073) (-1398.954) (-1397.606) [-1399.893] * [-1415.986] (-1405.703) (-1398.965) (-1400.540) -- 0:01:24
Average standard deviation of split frequencies: 0.022034
470500 -- (-1401.208) (-1400.033) (-1397.050) [-1399.229] * (-1401.620) (-1403.773) [-1399.154] (-1408.154) -- 0:01:24
471000 -- (-1400.269) [-1395.111] (-1402.698) (-1399.422) * [-1399.199] (-1399.373) (-1401.761) (-1404.557) -- 0:01:24
471500 -- (-1401.408) (-1401.758) (-1402.674) [-1404.238] * (-1399.268) (-1406.861) [-1400.042] (-1395.476) -- 0:01:24
472000 -- (-1400.946) (-1398.498) (-1401.885) [-1396.331] * (-1400.647) (-1398.047) [-1402.304] (-1398.989) -- 0:01:25
472500 -- (-1402.131) [-1395.895] (-1402.119) (-1404.813) * (-1411.814) (-1402.337) (-1394.950) [-1402.189] -- 0:01:24
473000 -- (-1399.119) (-1398.773) [-1398.804] (-1401.000) * (-1400.535) [-1398.783] (-1395.642) (-1400.380) -- 0:01:24
473500 -- (-1398.764) (-1405.450) (-1402.765) [-1394.985] * (-1407.318) (-1399.393) (-1398.219) [-1397.335] -- 0:01:24
474000 -- (-1400.372) (-1404.735) (-1400.051) [-1399.326] * (-1400.055) [-1403.810] (-1402.641) (-1400.701) -- 0:01:24
474500 -- (-1400.961) (-1403.897) [-1400.787] (-1400.783) * (-1400.666) (-1400.829) (-1400.315) [-1394.840] -- 0:01:24
475000 -- [-1400.845] (-1396.477) (-1398.203) (-1398.665) * [-1399.878] (-1408.674) (-1409.266) (-1397.481) -- 0:01:24
Average standard deviation of split frequencies: 0.021292
475500 -- (-1400.096) (-1398.367) (-1402.592) [-1399.241] * (-1397.036) (-1403.659) (-1402.082) [-1399.071] -- 0:01:23
476000 -- [-1400.641] (-1395.211) (-1400.245) (-1397.394) * [-1396.095] (-1399.455) (-1398.376) (-1400.936) -- 0:01:23
476500 -- [-1403.379] (-1399.771) (-1406.270) (-1401.714) * (-1400.873) (-1400.696) (-1399.693) [-1399.777] -- 0:01:23
477000 -- (-1398.626) (-1404.565) [-1401.426] (-1401.624) * (-1401.811) (-1397.398) [-1396.530] (-1403.870) -- 0:01:23
477500 -- (-1402.636) [-1403.946] (-1404.404) (-1399.878) * (-1397.964) (-1401.087) [-1400.967] (-1401.774) -- 0:01:23
478000 -- [-1397.335] (-1401.254) (-1399.962) (-1403.301) * [-1394.568] (-1395.352) (-1395.927) (-1395.355) -- 0:01:22
478500 -- [-1400.979] (-1403.673) (-1399.678) (-1397.883) * [-1395.506] (-1396.237) (-1400.439) (-1396.410) -- 0:01:23
479000 -- [-1396.116] (-1403.682) (-1398.762) (-1401.748) * [-1398.034] (-1393.672) (-1396.205) (-1403.369) -- 0:01:23
479500 -- (-1402.811) [-1403.915] (-1397.476) (-1396.829) * [-1394.683] (-1398.927) (-1401.192) (-1399.374) -- 0:01:23
480000 -- (-1400.196) [-1406.627] (-1414.792) (-1398.800) * (-1403.797) [-1395.727] (-1402.869) (-1403.119) -- 0:01:23
Average standard deviation of split frequencies: 0.021576
480500 -- (-1402.662) [-1399.864] (-1403.822) (-1401.162) * (-1397.366) (-1402.749) (-1399.275) [-1397.693] -- 0:01:23
481000 -- [-1397.537] (-1399.952) (-1403.766) (-1407.996) * [-1399.594] (-1398.060) (-1402.548) (-1396.611) -- 0:01:23
481500 -- [-1397.484] (-1404.186) (-1397.578) (-1403.718) * [-1396.471] (-1402.378) (-1402.321) (-1396.045) -- 0:01:22
482000 -- [-1399.358] (-1401.715) (-1397.174) (-1404.226) * (-1402.845) (-1401.174) [-1398.654] (-1399.959) -- 0:01:22
482500 -- [-1400.172] (-1402.403) (-1397.698) (-1402.746) * (-1398.780) (-1403.372) [-1402.755] (-1398.361) -- 0:01:22
483000 -- [-1401.262] (-1405.250) (-1401.419) (-1403.991) * (-1407.930) (-1396.077) (-1401.705) [-1396.958] -- 0:01:22
483500 -- [-1398.292] (-1397.344) (-1407.371) (-1405.058) * (-1405.736) (-1400.180) (-1402.723) [-1401.770] -- 0:01:22
484000 -- (-1401.646) [-1398.938] (-1411.366) (-1402.613) * (-1400.457) (-1396.167) (-1401.789) [-1405.244] -- 0:01:22
484500 -- (-1402.081) (-1399.155) (-1403.136) [-1398.037] * (-1409.590) (-1402.372) [-1401.343] (-1402.058) -- 0:01:22
485000 -- (-1397.782) [-1402.077] (-1401.456) (-1407.334) * (-1401.901) [-1394.806] (-1402.780) (-1404.907) -- 0:01:22
Average standard deviation of split frequencies: 0.021824
485500 -- (-1394.404) (-1408.623) [-1404.195] (-1400.330) * (-1398.777) [-1396.577] (-1402.195) (-1402.763) -- 0:01:22
486000 -- [-1397.996] (-1399.427) (-1413.130) (-1396.560) * (-1403.224) (-1399.852) [-1398.324] (-1405.906) -- 0:01:22
486500 -- (-1399.436) [-1399.968] (-1415.972) (-1399.341) * [-1397.697] (-1400.938) (-1400.885) (-1400.491) -- 0:01:22
487000 -- [-1395.456] (-1404.669) (-1406.597) (-1395.708) * (-1397.497) (-1399.305) [-1399.555] (-1403.521) -- 0:01:22
487500 -- (-1398.290) [-1395.296] (-1409.692) (-1396.630) * (-1400.119) (-1396.078) [-1397.542] (-1406.946) -- 0:01:22
488000 -- [-1402.257] (-1404.833) (-1408.249) (-1395.231) * (-1399.365) (-1401.072) (-1401.457) [-1402.067] -- 0:01:21
488500 -- (-1401.839) (-1413.394) (-1407.754) [-1399.836] * [-1394.756] (-1397.730) (-1399.687) (-1401.697) -- 0:01:21
489000 -- [-1400.703] (-1401.747) (-1411.479) (-1397.932) * (-1397.515) [-1400.356] (-1396.399) (-1399.349) -- 0:01:21
489500 -- (-1401.317) (-1404.712) [-1403.984] (-1399.910) * [-1397.703] (-1403.578) (-1398.753) (-1399.613) -- 0:01:21
490000 -- [-1395.825] (-1401.659) (-1404.479) (-1396.563) * [-1396.148] (-1401.586) (-1397.688) (-1404.430) -- 0:01:21
Average standard deviation of split frequencies: 0.019215
490500 -- [-1396.429] (-1407.769) (-1399.967) (-1398.350) * (-1397.640) (-1396.830) [-1398.360] (-1400.733) -- 0:01:21
491000 -- [-1398.937] (-1403.681) (-1401.981) (-1408.842) * [-1402.373] (-1406.538) (-1397.755) (-1400.780) -- 0:01:21
491500 -- (-1398.860) (-1405.878) [-1397.191] (-1403.716) * (-1406.206) (-1397.004) (-1410.598) [-1401.428] -- 0:01:21
492000 -- (-1397.989) (-1399.858) (-1404.443) [-1398.300] * (-1398.277) [-1394.726] (-1403.858) (-1395.294) -- 0:01:21
492500 -- [-1396.121] (-1401.280) (-1401.788) (-1399.260) * [-1397.394] (-1398.568) (-1403.710) (-1402.572) -- 0:01:21
493000 -- (-1397.051) [-1398.347] (-1403.960) (-1406.263) * (-1402.595) (-1400.247) (-1397.122) [-1403.664] -- 0:01:21
493500 -- (-1398.383) (-1400.940) (-1402.763) [-1406.612] * (-1400.178) (-1398.552) (-1400.615) [-1401.553] -- 0:01:21
494000 -- (-1404.535) (-1407.453) [-1403.313] (-1397.276) * (-1400.267) [-1397.093] (-1399.731) (-1398.472) -- 0:01:20
494500 -- [-1398.349] (-1403.304) (-1405.280) (-1397.329) * (-1408.318) [-1399.594] (-1396.718) (-1403.392) -- 0:01:20
495000 -- (-1403.588) (-1403.159) (-1405.528) [-1393.882] * (-1399.165) [-1396.250] (-1397.090) (-1402.944) -- 0:01:20
Average standard deviation of split frequencies: 0.015682
495500 -- (-1397.934) (-1399.484) (-1410.920) [-1397.556] * (-1404.110) (-1398.254) [-1398.300] (-1401.378) -- 0:01:20
496000 -- (-1401.613) [-1402.486] (-1399.405) (-1403.812) * [-1399.858] (-1395.989) (-1398.626) (-1401.912) -- 0:01:20
496500 -- (-1403.502) (-1399.480) [-1398.885] (-1402.118) * [-1396.231] (-1397.902) (-1402.421) (-1400.664) -- 0:01:20
497000 -- (-1400.144) (-1401.322) (-1399.476) [-1406.404] * [-1401.818] (-1395.074) (-1399.864) (-1400.944) -- 0:01:20
497500 -- (-1404.768) (-1402.094) (-1400.131) [-1400.994] * (-1400.473) (-1399.905) [-1401.628] (-1397.999) -- 0:01:20
498000 -- (-1399.477) [-1400.779] (-1398.802) (-1399.360) * (-1398.218) (-1394.463) (-1403.886) [-1401.310] -- 0:01:20
498500 -- (-1405.223) [-1401.584] (-1395.228) (-1398.323) * (-1397.276) [-1396.001] (-1406.019) (-1397.787) -- 0:01:20
499000 -- (-1396.153) (-1398.839) [-1402.370] (-1398.869) * [-1396.286] (-1400.998) (-1404.174) (-1399.127) -- 0:01:20
499500 -- (-1394.267) [-1403.700] (-1400.955) (-1402.021) * (-1398.319) (-1403.017) [-1407.711] (-1400.955) -- 0:01:20
500000 -- (-1404.585) (-1405.243) [-1397.669] (-1403.288) * (-1406.105) [-1404.482] (-1408.427) (-1406.297) -- 0:01:20
Average standard deviation of split frequencies: 0.016006
500500 -- [-1407.390] (-1405.389) (-1402.521) (-1411.181) * (-1400.851) (-1405.859) [-1399.853] (-1400.342) -- 0:01:19
501000 -- (-1402.877) (-1401.824) (-1398.320) [-1399.311] * [-1400.545] (-1402.069) (-1400.636) (-1408.388) -- 0:01:19
501500 -- [-1399.772] (-1398.409) (-1401.910) (-1401.838) * (-1408.619) [-1402.672] (-1399.347) (-1406.328) -- 0:01:19
502000 -- [-1396.774] (-1400.960) (-1404.480) (-1407.953) * (-1400.022) (-1415.727) (-1398.892) [-1407.051] -- 0:01:19
502500 -- [-1393.798] (-1399.034) (-1399.795) (-1406.405) * (-1418.227) [-1403.373] (-1394.403) (-1399.276) -- 0:01:19
503000 -- [-1397.992] (-1397.609) (-1405.348) (-1399.020) * (-1402.924) (-1404.803) [-1398.791] (-1401.761) -- 0:01:19
503500 -- (-1403.705) [-1400.043] (-1401.513) (-1398.564) * (-1401.914) (-1404.552) (-1405.776) [-1397.173] -- 0:01:19
504000 -- (-1399.154) [-1397.263] (-1398.265) (-1394.547) * (-1402.723) (-1399.787) [-1398.980] (-1394.849) -- 0:01:19
504500 -- (-1408.432) (-1401.900) [-1401.382] (-1398.101) * (-1402.632) (-1397.939) (-1398.027) [-1400.643] -- 0:01:19
505000 -- (-1398.878) [-1400.847] (-1398.757) (-1397.642) * (-1406.381) (-1402.817) (-1402.935) [-1396.497] -- 0:01:19
Average standard deviation of split frequencies: 0.018167
505500 -- (-1394.996) [-1395.860] (-1399.773) (-1400.704) * [-1399.856] (-1406.482) (-1398.954) (-1395.950) -- 0:01:19
506000 -- (-1401.467) [-1402.803] (-1405.419) (-1410.198) * (-1407.191) (-1399.313) (-1401.869) [-1402.940] -- 0:01:19
506500 -- (-1402.255) [-1403.257] (-1402.646) (-1396.659) * [-1394.291] (-1399.953) (-1399.905) (-1396.923) -- 0:01:18
507000 -- [-1396.423] (-1403.103) (-1407.348) (-1400.456) * [-1398.567] (-1402.350) (-1399.336) (-1397.934) -- 0:01:18
507500 -- (-1398.436) (-1407.572) (-1403.087) [-1397.389] * [-1394.907] (-1404.881) (-1401.132) (-1398.528) -- 0:01:18
508000 -- (-1398.792) (-1404.566) [-1399.336] (-1396.222) * (-1403.631) (-1401.189) (-1400.826) [-1398.594] -- 0:01:18
508500 -- (-1395.750) (-1399.732) (-1398.002) [-1399.035] * (-1400.943) (-1404.834) (-1399.667) [-1402.896] -- 0:01:18
509000 -- [-1396.838] (-1399.418) (-1395.723) (-1405.202) * (-1398.549) [-1399.742] (-1399.538) (-1395.746) -- 0:01:18
509500 -- (-1397.451) (-1408.070) [-1400.173] (-1398.734) * (-1397.766) (-1404.605) [-1400.916] (-1397.533) -- 0:01:17
510000 -- [-1397.324] (-1397.181) (-1399.806) (-1399.893) * (-1398.547) (-1399.097) (-1398.425) [-1399.191] -- 0:01:18
Average standard deviation of split frequencies: 0.017539
510500 -- (-1403.538) (-1397.381) (-1406.379) [-1401.201] * (-1404.261) (-1396.373) [-1401.325] (-1401.750) -- 0:01:18
511000 -- (-1404.090) (-1400.781) [-1400.862] (-1402.160) * (-1397.490) [-1395.654] (-1402.658) (-1402.668) -- 0:01:18
511500 -- (-1403.557) (-1397.996) (-1402.453) [-1398.246] * (-1397.249) (-1403.044) (-1400.325) [-1398.951] -- 0:01:18
512000 -- (-1404.687) (-1397.979) [-1404.642] (-1400.610) * (-1397.686) (-1398.698) [-1398.321] (-1396.065) -- 0:01:18
512500 -- (-1405.505) (-1399.535) (-1402.717) [-1400.367] * (-1398.173) (-1406.580) [-1407.771] (-1407.991) -- 0:01:18
513000 -- (-1400.020) (-1399.611) [-1400.963] (-1403.785) * (-1398.541) [-1399.808] (-1403.971) (-1400.682) -- 0:01:17
513500 -- (-1399.335) [-1401.216] (-1396.793) (-1402.823) * (-1398.839) (-1398.385) (-1399.835) [-1397.798] -- 0:01:17
514000 -- (-1401.992) [-1399.718] (-1402.006) (-1397.963) * (-1398.959) (-1401.607) (-1397.254) [-1401.427] -- 0:01:17
514500 -- (-1406.168) (-1400.166) [-1394.662] (-1400.294) * (-1399.890) (-1407.012) [-1397.078] (-1402.276) -- 0:01:17
515000 -- (-1398.470) (-1403.635) [-1403.483] (-1401.534) * (-1399.928) (-1402.606) [-1398.983] (-1403.605) -- 0:01:17
Average standard deviation of split frequencies: 0.016444
515500 -- [-1400.333] (-1398.511) (-1410.240) (-1397.765) * (-1400.451) (-1405.401) (-1397.480) [-1403.564] -- 0:01:17
516000 -- (-1405.418) (-1399.355) [-1400.664] (-1403.563) * (-1398.908) (-1403.627) (-1397.513) [-1397.469] -- 0:01:17
516500 -- (-1397.907) [-1396.842] (-1409.108) (-1398.294) * (-1399.501) (-1400.659) [-1400.150] (-1404.171) -- 0:01:17
517000 -- (-1398.025) (-1404.129) [-1397.656] (-1402.282) * (-1399.597) (-1404.159) [-1400.798] (-1395.063) -- 0:01:17
517500 -- (-1403.877) (-1406.160) (-1405.077) [-1398.998] * (-1399.211) (-1402.740) [-1398.775] (-1397.766) -- 0:01:17
518000 -- (-1395.872) (-1397.794) [-1398.578] (-1401.663) * (-1400.372) (-1404.748) [-1402.686] (-1401.144) -- 0:01:17
518500 -- (-1399.067) (-1402.703) [-1402.147] (-1397.956) * (-1407.113) [-1400.570] (-1399.860) (-1402.519) -- 0:01:17
519000 -- (-1404.462) (-1406.945) (-1400.844) [-1406.538] * (-1401.029) (-1401.958) (-1402.949) [-1403.302] -- 0:01:16
519500 -- (-1398.631) (-1412.273) (-1404.253) [-1400.853] * (-1398.444) (-1400.332) [-1399.877] (-1400.793) -- 0:01:16
520000 -- (-1395.365) (-1403.844) [-1396.245] (-1402.374) * [-1398.118] (-1404.715) (-1399.525) (-1406.032) -- 0:01:16
Average standard deviation of split frequencies: 0.016750
520500 -- [-1398.255] (-1403.583) (-1399.002) (-1397.307) * [-1393.767] (-1401.336) (-1399.632) (-1411.035) -- 0:01:16
521000 -- (-1404.116) (-1400.224) [-1398.429] (-1405.075) * (-1393.138) [-1401.038] (-1399.603) (-1405.952) -- 0:01:16
521500 -- (-1395.744) (-1403.325) (-1397.148) [-1398.243] * (-1397.089) (-1397.116) [-1397.270] (-1405.116) -- 0:01:16
522000 -- [-1397.863] (-1398.921) (-1402.435) (-1401.416) * [-1399.985] (-1396.341) (-1398.012) (-1402.574) -- 0:01:16
522500 -- (-1394.061) (-1398.249) (-1400.175) [-1400.159] * (-1405.734) (-1406.882) (-1404.003) [-1398.645] -- 0:01:16
523000 -- [-1395.336] (-1399.099) (-1397.579) (-1401.746) * (-1398.960) (-1407.938) (-1398.923) [-1396.579] -- 0:01:16
523500 -- (-1399.311) (-1404.116) (-1400.706) [-1402.714] * (-1400.927) [-1399.771] (-1400.966) (-1400.001) -- 0:01:16
524000 -- (-1397.818) [-1408.264] (-1397.291) (-1399.868) * (-1403.809) (-1398.813) [-1395.802] (-1407.231) -- 0:01:16
524500 -- (-1404.929) (-1403.887) [-1396.571] (-1401.976) * (-1396.335) (-1398.261) [-1402.083] (-1399.883) -- 0:01:16
525000 -- (-1407.319) [-1399.320] (-1401.297) (-1411.563) * [-1399.697] (-1400.113) (-1406.206) (-1397.973) -- 0:01:16
Average standard deviation of split frequencies: 0.018372
525500 -- (-1397.514) [-1399.597] (-1408.228) (-1404.123) * [-1393.409] (-1400.965) (-1400.741) (-1397.832) -- 0:01:15
526000 -- (-1402.174) (-1401.348) (-1402.362) [-1400.328] * (-1398.913) [-1401.445] (-1403.901) (-1402.023) -- 0:01:15
526500 -- (-1397.129) (-1404.245) (-1404.740) [-1398.187] * (-1395.114) [-1402.020] (-1398.896) (-1397.518) -- 0:01:15
527000 -- (-1404.384) (-1398.912) [-1402.421] (-1397.871) * (-1396.675) (-1398.167) (-1398.865) [-1400.991] -- 0:01:15
527500 -- (-1397.084) (-1408.479) [-1402.233] (-1405.558) * (-1396.451) [-1399.527] (-1401.836) (-1402.836) -- 0:01:15
528000 -- (-1395.951) (-1408.831) [-1399.232] (-1402.033) * (-1402.862) (-1401.391) [-1397.387] (-1397.875) -- 0:01:15
528500 -- [-1396.438] (-1407.084) (-1403.708) (-1401.417) * (-1407.560) [-1395.286] (-1393.333) (-1404.226) -- 0:01:15
529000 -- (-1396.987) (-1408.275) (-1397.569) [-1403.727] * (-1402.521) [-1393.760] (-1395.828) (-1400.300) -- 0:01:15
529500 -- (-1405.016) [-1399.945] (-1405.542) (-1403.687) * (-1398.160) [-1396.742] (-1401.701) (-1394.996) -- 0:01:15
530000 -- [-1401.975] (-1398.866) (-1399.813) (-1403.372) * [-1403.733] (-1404.872) (-1409.715) (-1403.226) -- 0:01:15
Average standard deviation of split frequencies: 0.017767
530500 -- (-1401.312) (-1404.194) (-1402.169) [-1396.842] * (-1407.519) [-1403.378] (-1399.475) (-1397.938) -- 0:01:15
531000 -- (-1401.142) (-1402.191) (-1403.882) [-1396.167] * (-1403.378) (-1398.968) (-1399.079) [-1397.529] -- 0:01:15
531500 -- (-1406.262) (-1400.118) [-1401.730] (-1397.917) * [-1396.848] (-1401.400) (-1400.491) (-1399.550) -- 0:01:14
532000 -- (-1401.958) (-1402.165) (-1401.939) [-1395.908] * (-1397.441) [-1399.989] (-1406.267) (-1405.882) -- 0:01:14
532500 -- (-1405.242) [-1401.037] (-1395.594) (-1394.914) * (-1396.337) (-1400.121) [-1401.848] (-1403.402) -- 0:01:14
533000 -- (-1408.976) (-1396.964) [-1394.729] (-1401.264) * (-1403.897) (-1403.311) [-1397.635] (-1406.545) -- 0:01:14
533500 -- (-1405.270) (-1400.155) [-1401.185] (-1405.104) * [-1398.763] (-1400.725) (-1398.429) (-1396.931) -- 0:01:14
534000 -- [-1396.276] (-1408.608) (-1404.408) (-1399.606) * [-1397.314] (-1400.420) (-1398.723) (-1401.812) -- 0:01:14
534500 -- [-1400.208] (-1407.340) (-1408.200) (-1397.732) * (-1401.679) (-1401.852) [-1402.741] (-1398.821) -- 0:01:14
535000 -- (-1398.140) [-1398.800] (-1405.553) (-1398.729) * (-1398.482) [-1412.091] (-1400.513) (-1396.212) -- 0:01:14
Average standard deviation of split frequencies: 0.017590
535500 -- (-1404.446) [-1396.993] (-1408.969) (-1401.942) * (-1398.237) (-1402.856) [-1396.738] (-1397.827) -- 0:01:14
536000 -- (-1403.320) [-1400.551] (-1402.451) (-1401.873) * (-1395.920) (-1397.233) [-1395.279] (-1396.618) -- 0:01:14
536500 -- [-1399.522] (-1402.386) (-1396.149) (-1398.735) * (-1401.228) [-1396.079] (-1398.192) (-1399.914) -- 0:01:14
537000 -- (-1393.990) (-1397.756) [-1402.989] (-1401.301) * (-1400.644) [-1398.341] (-1397.284) (-1399.763) -- 0:01:14
537500 -- [-1397.268] (-1399.558) (-1401.389) (-1396.032) * [-1402.196] (-1401.677) (-1403.328) (-1404.001) -- 0:01:14
538000 -- (-1396.551) [-1394.615] (-1400.422) (-1396.370) * (-1399.660) (-1397.830) (-1405.294) [-1399.571] -- 0:01:13
538500 -- (-1396.221) (-1399.384) [-1405.759] (-1396.404) * (-1406.157) (-1399.125) [-1396.895] (-1399.779) -- 0:01:13
539000 -- [-1398.117] (-1398.331) (-1401.056) (-1400.770) * (-1403.670) (-1396.314) (-1395.913) [-1397.485] -- 0:01:13
539500 -- (-1400.887) (-1399.235) (-1399.827) [-1398.171] * (-1398.079) [-1401.528] (-1397.421) (-1402.148) -- 0:01:13
540000 -- (-1398.973) (-1397.029) [-1399.370] (-1405.346) * (-1399.487) (-1397.059) [-1399.936] (-1409.370) -- 0:01:13
Average standard deviation of split frequencies: 0.017002
540500 -- (-1403.333) [-1399.173] (-1406.684) (-1398.965) * (-1405.878) (-1396.951) (-1404.053) [-1400.465] -- 0:01:13
541000 -- (-1398.322) (-1399.460) [-1395.984] (-1401.847) * (-1402.851) [-1400.646] (-1401.597) (-1397.915) -- 0:01:13
541500 -- (-1397.045) (-1404.199) [-1399.804] (-1402.290) * [-1398.754] (-1405.451) (-1397.188) (-1403.374) -- 0:01:13
542000 -- [-1402.866] (-1402.902) (-1401.900) (-1400.882) * [-1403.904] (-1414.418) (-1401.279) (-1401.460) -- 0:01:13
542500 -- [-1403.360] (-1401.235) (-1398.876) (-1400.038) * (-1396.218) [-1397.274] (-1405.467) (-1397.593) -- 0:01:13
543000 -- (-1406.965) (-1399.209) (-1399.882) [-1398.739] * (-1396.231) (-1403.925) (-1400.793) [-1398.517] -- 0:01:13
543500 -- (-1405.048) [-1399.634] (-1400.419) (-1402.864) * (-1396.155) (-1402.617) (-1404.182) [-1399.484] -- 0:01:13
544000 -- (-1396.827) [-1397.775] (-1406.494) (-1398.805) * (-1396.889) (-1402.869) (-1403.475) [-1399.444] -- 0:01:12
544500 -- [-1403.885] (-1399.248) (-1399.282) (-1409.651) * [-1399.775] (-1408.268) (-1395.684) (-1401.053) -- 0:01:12
545000 -- [-1398.480] (-1405.753) (-1401.098) (-1402.459) * (-1399.237) (-1402.826) [-1399.175] (-1403.745) -- 0:01:12
Average standard deviation of split frequencies: 0.016404
545500 -- (-1398.318) (-1396.005) [-1395.390] (-1401.025) * [-1404.431] (-1397.210) (-1399.064) (-1400.362) -- 0:01:12
546000 -- (-1399.266) [-1398.826] (-1395.503) (-1398.698) * (-1404.607) [-1399.774] (-1398.482) (-1405.880) -- 0:01:12
546500 -- (-1404.888) (-1400.250) [-1396.890] (-1398.120) * (-1410.813) (-1399.144) [-1399.476] (-1401.373) -- 0:01:12
547000 -- (-1400.843) (-1404.652) [-1404.121] (-1405.989) * (-1403.986) (-1397.080) [-1402.501] (-1399.236) -- 0:01:12
547500 -- (-1402.440) (-1400.812) (-1404.587) [-1403.248] * (-1400.500) [-1398.545] (-1398.839) (-1396.556) -- 0:01:12
548000 -- (-1401.399) (-1400.552) (-1398.118) [-1400.661] * [-1399.514] (-1407.232) (-1403.457) (-1402.448) -- 0:01:12
548500 -- (-1402.933) [-1404.703] (-1399.757) (-1401.642) * (-1404.089) (-1399.051) [-1400.869] (-1401.793) -- 0:01:12
549000 -- (-1403.841) [-1397.538] (-1402.884) (-1396.152) * (-1405.444) [-1395.126] (-1414.978) (-1401.711) -- 0:01:12
549500 -- (-1404.455) (-1397.676) [-1402.184] (-1396.922) * (-1401.984) (-1401.054) [-1407.038] (-1401.322) -- 0:01:12
550000 -- (-1405.722) (-1406.005) (-1397.233) [-1396.473] * [-1394.943] (-1400.969) (-1410.016) (-1398.110) -- 0:01:12
Average standard deviation of split frequencies: 0.016265
550500 -- (-1396.655) [-1402.913] (-1396.476) (-1396.900) * (-1398.446) (-1396.840) (-1409.427) [-1402.829] -- 0:01:11
551000 -- [-1396.193] (-1410.163) (-1400.404) (-1398.863) * (-1398.926) [-1394.194] (-1407.792) (-1397.775) -- 0:01:11
551500 -- (-1402.407) (-1409.066) (-1396.710) [-1398.617] * (-1401.029) [-1395.649] (-1408.378) (-1410.625) -- 0:01:11
552000 -- (-1397.808) (-1403.164) (-1402.897) [-1399.639] * (-1398.391) [-1402.532] (-1405.673) (-1405.103) -- 0:01:11
552500 -- [-1397.893] (-1403.411) (-1402.737) (-1402.204) * [-1396.728] (-1399.998) (-1403.452) (-1398.761) -- 0:01:11
553000 -- [-1396.414] (-1399.113) (-1404.516) (-1400.093) * [-1395.190] (-1403.293) (-1404.286) (-1393.848) -- 0:01:11
553500 -- [-1396.158] (-1402.465) (-1401.264) (-1398.550) * (-1399.521) (-1397.280) (-1399.843) [-1401.521] -- 0:01:11
554000 -- (-1397.444) [-1401.909] (-1399.480) (-1400.612) * (-1400.368) [-1395.004] (-1401.596) (-1399.825) -- 0:01:11
554500 -- [-1400.851] (-1396.642) (-1400.206) (-1405.886) * (-1401.141) (-1398.324) [-1398.771] (-1399.856) -- 0:01:11
555000 -- (-1400.425) [-1397.468] (-1397.595) (-1395.799) * [-1397.868] (-1407.049) (-1400.407) (-1401.224) -- 0:01:11
Average standard deviation of split frequencies: 0.014837
555500 -- (-1403.453) (-1404.594) [-1399.102] (-1402.537) * (-1398.103) [-1395.371] (-1399.123) (-1402.745) -- 0:01:11
556000 -- (-1403.866) (-1399.648) [-1397.653] (-1397.281) * (-1399.759) (-1402.956) [-1403.230] (-1399.028) -- 0:01:11
556500 -- (-1403.654) (-1401.749) [-1395.380] (-1398.647) * (-1407.001) (-1396.214) [-1403.157] (-1399.332) -- 0:01:10
557000 -- [-1396.084] (-1400.731) (-1400.610) (-1396.891) * (-1406.267) (-1401.930) [-1403.297] (-1405.151) -- 0:01:10
557500 -- (-1399.092) [-1397.469] (-1399.411) (-1394.263) * [-1393.978] (-1397.968) (-1399.312) (-1403.783) -- 0:01:10
558000 -- (-1402.361) [-1398.219] (-1399.799) (-1404.120) * (-1410.816) [-1395.314] (-1402.112) (-1395.615) -- 0:01:10
558500 -- (-1403.293) (-1400.358) [-1398.030] (-1396.059) * (-1406.589) (-1404.251) (-1400.723) [-1395.719] -- 0:01:10
559000 -- [-1397.737] (-1397.917) (-1398.319) (-1398.483) * [-1406.501] (-1401.577) (-1400.508) (-1401.168) -- 0:01:10
559500 -- (-1401.920) [-1398.257] (-1400.302) (-1403.020) * [-1403.870] (-1400.024) (-1410.252) (-1399.245) -- 0:01:10
560000 -- (-1409.546) [-1398.902] (-1400.358) (-1399.842) * [-1409.203] (-1400.752) (-1405.380) (-1395.040) -- 0:01:10
Average standard deviation of split frequencies: 0.016395
560500 -- (-1412.377) (-1402.987) (-1399.370) [-1400.054] * (-1413.246) (-1403.132) [-1400.791] (-1398.342) -- 0:01:10
561000 -- (-1409.087) [-1399.315] (-1399.808) (-1400.913) * (-1409.158) [-1399.741] (-1400.293) (-1395.186) -- 0:01:10
561500 -- (-1400.821) (-1406.526) [-1396.077] (-1407.076) * [-1403.120] (-1401.909) (-1402.063) (-1399.966) -- 0:01:10
562000 -- [-1397.580] (-1410.096) (-1404.915) (-1399.387) * [-1405.771] (-1397.066) (-1401.527) (-1401.197) -- 0:01:10
562500 -- (-1409.001) [-1402.110] (-1404.890) (-1397.285) * [-1402.582] (-1399.173) (-1409.645) (-1393.736) -- 0:01:10
563000 -- (-1394.411) (-1401.229) [-1402.781] (-1399.235) * [-1400.418] (-1398.706) (-1407.709) (-1398.114) -- 0:01:09
563500 -- (-1399.364) (-1405.621) (-1404.966) [-1399.342] * (-1400.483) [-1398.804] (-1405.409) (-1396.698) -- 0:01:09
564000 -- (-1396.610) [-1398.102] (-1402.839) (-1403.698) * (-1402.249) (-1396.819) (-1402.930) [-1396.113] -- 0:01:09
564500 -- [-1399.305] (-1402.558) (-1401.232) (-1406.501) * (-1405.402) (-1399.170) (-1401.320) [-1400.327] -- 0:01:09
565000 -- (-1400.494) (-1399.133) [-1397.965] (-1397.748) * (-1405.405) [-1397.413] (-1401.506) (-1396.811) -- 0:01:09
Average standard deviation of split frequencies: 0.015825
565500 -- (-1402.927) (-1401.934) (-1400.594) [-1401.498] * (-1398.639) [-1399.512] (-1406.479) (-1399.333) -- 0:01:09
566000 -- (-1402.118) (-1404.615) (-1400.853) [-1401.176] * (-1401.281) [-1397.826] (-1399.449) (-1400.357) -- 0:01:09
566500 -- (-1396.749) [-1400.456] (-1401.551) (-1404.652) * (-1407.875) (-1397.633) [-1407.586] (-1404.647) -- 0:01:09
567000 -- (-1396.614) (-1395.488) [-1400.537] (-1399.428) * (-1398.292) (-1396.029) (-1405.203) [-1395.076] -- 0:01:09
567500 -- (-1400.834) [-1398.164] (-1405.163) (-1402.727) * [-1406.717] (-1398.264) (-1398.891) (-1396.618) -- 0:01:09
568000 -- (-1401.400) (-1397.341) [-1398.255] (-1402.358) * (-1396.662) (-1396.540) (-1398.944) [-1397.169] -- 0:01:09
568500 -- (-1396.638) (-1399.051) (-1404.621) [-1397.887] * (-1394.130) (-1402.031) [-1397.859] (-1406.037) -- 0:01:09
569000 -- (-1409.032) (-1401.192) (-1401.960) [-1401.278] * (-1401.145) [-1403.473] (-1400.062) (-1398.623) -- 0:01:08
569500 -- (-1407.381) [-1396.725] (-1398.234) (-1404.078) * (-1403.661) (-1399.531) (-1401.241) [-1401.915] -- 0:01:08
570000 -- (-1400.388) [-1394.433] (-1397.773) (-1398.711) * (-1401.771) (-1401.028) [-1401.423] (-1397.595) -- 0:01:08
Average standard deviation of split frequencies: 0.016521
570500 -- [-1399.458] (-1397.433) (-1407.438) (-1400.091) * (-1404.464) (-1403.426) (-1406.165) [-1397.507] -- 0:01:08
571000 -- (-1396.265) (-1398.567) [-1404.003] (-1402.156) * (-1394.790) [-1402.986] (-1410.602) (-1399.825) -- 0:01:08
571500 -- (-1395.781) (-1400.020) (-1400.916) [-1398.514] * [-1398.567] (-1396.943) (-1409.678) (-1398.208) -- 0:01:08
572000 -- (-1402.039) (-1406.020) [-1402.242] (-1404.872) * (-1401.690) [-1410.059] (-1414.408) (-1403.459) -- 0:01:08
572500 -- [-1399.148] (-1395.899) (-1401.811) (-1400.734) * (-1398.541) (-1402.020) (-1400.680) [-1402.518] -- 0:01:08
573000 -- (-1400.059) (-1399.877) (-1402.959) [-1403.347] * [-1398.832] (-1408.623) (-1400.449) (-1396.594) -- 0:01:08
573500 -- [-1399.096] (-1403.232) (-1397.292) (-1402.908) * [-1398.335] (-1398.264) (-1404.096) (-1399.090) -- 0:01:08
574000 -- [-1394.414] (-1399.239) (-1397.200) (-1403.885) * (-1398.269) (-1401.886) (-1398.634) [-1401.542] -- 0:01:08
574500 -- [-1396.850] (-1405.836) (-1405.537) (-1394.869) * (-1402.183) [-1400.451] (-1400.080) (-1398.963) -- 0:01:08
575000 -- (-1401.708) [-1397.759] (-1408.306) (-1400.506) * (-1406.855) [-1403.465] (-1396.695) (-1397.051) -- 0:01:08
Average standard deviation of split frequencies: 0.015550
575500 -- (-1407.346) (-1400.025) [-1405.394] (-1406.189) * (-1398.843) (-1398.014) [-1398.714] (-1396.374) -- 0:01:07
576000 -- (-1399.945) [-1402.346] (-1400.630) (-1405.284) * (-1400.970) (-1394.712) (-1401.327) [-1401.879] -- 0:01:07
576500 -- (-1396.916) (-1403.050) [-1396.674] (-1398.812) * [-1400.515] (-1401.386) (-1408.301) (-1396.100) -- 0:01:07
577000 -- [-1395.594] (-1401.455) (-1410.385) (-1401.654) * (-1397.330) [-1401.117] (-1402.897) (-1406.398) -- 0:01:07
577500 -- [-1398.796] (-1399.810) (-1400.355) (-1401.139) * [-1399.795] (-1397.207) (-1404.439) (-1397.789) -- 0:01:07
578000 -- [-1398.638] (-1404.038) (-1399.452) (-1397.376) * (-1401.599) (-1395.860) (-1402.407) [-1401.210] -- 0:01:07
578500 -- (-1396.792) [-1398.096] (-1401.065) (-1402.131) * (-1399.606) [-1399.574] (-1401.461) (-1402.517) -- 0:01:07
579000 -- (-1405.837) [-1398.375] (-1399.510) (-1396.430) * [-1400.051] (-1401.875) (-1406.679) (-1402.089) -- 0:01:07
579500 -- (-1403.870) (-1400.122) (-1407.469) [-1397.876] * (-1399.815) [-1398.587] (-1399.274) (-1399.064) -- 0:01:07
580000 -- (-1401.198) (-1408.703) (-1401.701) [-1398.695] * [-1396.360] (-1413.334) (-1402.437) (-1401.368) -- 0:01:07
Average standard deviation of split frequencies: 0.015831
580500 -- (-1400.515) [-1397.737] (-1406.040) (-1407.336) * (-1395.399) (-1398.253) [-1398.035] (-1403.662) -- 0:01:07
581000 -- (-1397.458) [-1400.180] (-1398.003) (-1403.299) * (-1399.274) [-1401.773] (-1396.977) (-1402.910) -- 0:01:07
581500 -- (-1394.335) (-1397.731) [-1399.135] (-1398.340) * [-1398.731] (-1395.545) (-1401.900) (-1400.110) -- 0:01:06
582000 -- (-1402.748) (-1397.520) [-1400.822] (-1401.108) * [-1399.693] (-1397.277) (-1399.478) (-1403.067) -- 0:01:06
582500 -- (-1413.712) (-1398.678) (-1399.621) [-1400.067] * (-1402.393) (-1401.124) (-1402.690) [-1399.511] -- 0:01:06
583000 -- [-1398.671] (-1398.017) (-1398.513) (-1403.223) * [-1396.741] (-1399.837) (-1397.995) (-1403.971) -- 0:01:06
583500 -- (-1399.605) [-1400.087] (-1397.978) (-1403.810) * [-1397.262] (-1406.428) (-1400.664) (-1408.778) -- 0:01:06
584000 -- (-1400.513) [-1407.694] (-1402.497) (-1404.373) * (-1405.181) (-1403.449) (-1394.646) [-1407.245] -- 0:01:06
584500 -- (-1404.359) [-1397.330] (-1401.824) (-1399.053) * (-1398.158) (-1401.107) [-1400.581] (-1404.791) -- 0:01:06
585000 -- (-1397.381) (-1396.443) (-1397.155) [-1396.373] * (-1398.189) (-1402.559) [-1396.024] (-1406.240) -- 0:01:06
Average standard deviation of split frequencies: 0.016491
585500 -- [-1399.162] (-1402.552) (-1399.622) (-1394.874) * [-1394.562] (-1394.803) (-1396.338) (-1401.895) -- 0:01:06
586000 -- (-1402.368) (-1404.228) (-1394.004) [-1395.929] * (-1398.311) (-1406.190) (-1396.532) [-1398.983] -- 0:01:06
586500 -- [-1396.340] (-1399.116) (-1399.875) (-1396.278) * (-1403.844) (-1403.567) (-1402.762) [-1398.584] -- 0:01:06
587000 -- [-1398.922] (-1399.077) (-1394.633) (-1403.023) * (-1401.707) (-1406.235) [-1396.923] (-1402.395) -- 0:01:06
587500 -- (-1399.649) [-1397.066] (-1396.748) (-1408.811) * [-1403.813] (-1401.900) (-1402.127) (-1401.648) -- 0:01:06
588000 -- [-1406.908] (-1399.712) (-1399.510) (-1403.865) * (-1402.447) [-1400.534] (-1401.392) (-1399.012) -- 0:01:05
588500 -- (-1396.017) [-1396.640] (-1402.119) (-1405.269) * (-1405.690) [-1400.761] (-1396.788) (-1399.807) -- 0:01:05
589000 -- [-1396.513] (-1403.359) (-1398.601) (-1400.491) * (-1398.526) (-1403.242) [-1399.937] (-1401.790) -- 0:01:05
589500 -- [-1401.364] (-1400.042) (-1402.108) (-1404.456) * [-1399.230] (-1400.309) (-1398.245) (-1401.859) -- 0:01:05
590000 -- (-1395.271) (-1399.382) (-1405.538) [-1400.699] * [-1396.975] (-1400.704) (-1395.560) (-1406.063) -- 0:01:05
Average standard deviation of split frequencies: 0.015962
590500 -- (-1402.816) [-1400.352] (-1403.618) (-1403.646) * (-1395.828) (-1400.210) [-1397.543] (-1406.196) -- 0:01:05
591000 -- (-1395.403) (-1400.361) (-1399.631) [-1399.425] * (-1402.536) [-1397.022] (-1397.809) (-1404.355) -- 0:01:05
591500 -- (-1397.973) (-1400.951) (-1396.529) [-1400.333] * (-1404.780) (-1397.705) [-1395.206] (-1402.061) -- 0:01:05
592000 -- (-1405.594) [-1397.093] (-1404.282) (-1402.982) * (-1402.292) [-1399.510] (-1402.392) (-1404.022) -- 0:01:05
592500 -- [-1395.038] (-1401.289) (-1403.446) (-1403.021) * (-1400.426) (-1396.887) [-1396.211] (-1417.137) -- 0:01:05
593000 -- (-1407.305) [-1400.961] (-1396.383) (-1399.050) * (-1405.110) (-1396.379) (-1396.356) [-1406.806] -- 0:01:05
593500 -- (-1411.185) (-1399.647) (-1407.772) [-1397.950] * (-1399.917) (-1402.281) (-1399.362) [-1403.826] -- 0:01:05
594000 -- (-1400.981) (-1407.237) (-1401.476) [-1396.020] * (-1398.081) (-1401.311) [-1398.753] (-1400.037) -- 0:01:04
594500 -- (-1401.167) (-1403.925) [-1399.444] (-1407.164) * (-1400.065) [-1401.257] (-1396.918) (-1409.269) -- 0:01:04
595000 -- (-1402.714) (-1400.135) (-1397.674) [-1404.014] * (-1397.326) [-1396.919] (-1404.037) (-1404.954) -- 0:01:04
Average standard deviation of split frequencies: 0.015028
595500 -- (-1396.131) (-1400.437) (-1395.266) [-1397.798] * (-1400.381) (-1401.696) (-1403.472) [-1405.751] -- 0:01:04
596000 -- (-1398.446) (-1397.342) [-1396.862] (-1400.720) * (-1400.059) [-1398.121] (-1403.794) (-1406.673) -- 0:01:04
596500 -- (-1402.583) (-1401.508) (-1405.536) [-1397.865] * (-1397.366) [-1395.160] (-1401.091) (-1403.845) -- 0:01:04
597000 -- (-1399.789) (-1401.440) (-1397.542) [-1397.980] * (-1401.690) (-1404.091) (-1397.479) [-1398.831] -- 0:01:04
597500 -- (-1404.837) [-1401.917] (-1399.966) (-1397.561) * (-1399.950) (-1403.609) [-1399.290] (-1401.957) -- 0:01:04
598000 -- [-1406.721] (-1401.111) (-1397.344) (-1398.317) * (-1395.627) (-1401.825) [-1399.925] (-1402.888) -- 0:01:04
598500 -- [-1396.361] (-1402.122) (-1400.271) (-1398.855) * [-1400.028] (-1404.935) (-1409.122) (-1402.832) -- 0:01:04
599000 -- [-1398.984] (-1401.444) (-1404.633) (-1401.150) * [-1397.311] (-1408.203) (-1400.819) (-1408.183) -- 0:01:04
599500 -- (-1405.195) (-1403.730) [-1404.226] (-1400.856) * [-1397.389] (-1406.708) (-1402.162) (-1404.424) -- 0:01:04
600000 -- [-1399.486] (-1401.947) (-1394.906) (-1402.829) * [-1394.414] (-1403.373) (-1399.791) (-1404.996) -- 0:01:04
Average standard deviation of split frequencies: 0.012557
600500 -- (-1403.459) (-1404.286) [-1398.898] (-1398.736) * (-1401.796) (-1406.586) [-1400.183] (-1406.088) -- 0:01:03
601000 -- (-1402.061) (-1403.688) (-1404.130) [-1398.345] * (-1400.239) (-1403.076) [-1395.830] (-1395.941) -- 0:01:03
601500 -- (-1398.005) (-1404.771) (-1400.379) [-1402.177] * (-1406.542) (-1401.261) (-1399.697) [-1403.733] -- 0:01:03
602000 -- (-1397.319) (-1402.627) [-1395.169] (-1402.871) * (-1398.624) (-1404.727) (-1408.186) [-1395.401] -- 0:01:03
602500 -- (-1403.160) (-1400.403) [-1396.081] (-1400.180) * (-1397.302) [-1398.639] (-1400.837) (-1394.635) -- 0:01:03
603000 -- (-1400.047) [-1397.101] (-1401.172) (-1395.914) * [-1402.700] (-1400.238) (-1400.184) (-1395.288) -- 0:01:03
603500 -- (-1398.506) (-1402.144) [-1405.169] (-1408.182) * [-1400.867] (-1409.513) (-1405.743) (-1405.045) -- 0:01:03
604000 -- (-1397.043) (-1401.733) [-1398.273] (-1396.787) * [-1395.033] (-1403.545) (-1398.562) (-1401.912) -- 0:01:03
604500 -- (-1403.312) (-1402.033) (-1398.875) [-1401.984] * (-1401.391) [-1399.262] (-1397.776) (-1398.863) -- 0:01:03
605000 -- [-1404.971] (-1397.071) (-1407.740) (-1404.746) * [-1399.032] (-1400.433) (-1398.646) (-1405.797) -- 0:01:03
Average standard deviation of split frequencies: 0.013224
605500 -- (-1400.746) (-1400.267) (-1395.444) [-1397.429] * [-1396.826] (-1405.511) (-1398.674) (-1399.773) -- 0:01:03
606000 -- (-1398.763) [-1402.792] (-1407.557) (-1401.521) * (-1400.215) (-1402.244) [-1396.891] (-1404.185) -- 0:01:03
606500 -- (-1397.677) (-1399.168) (-1402.536) [-1397.477] * (-1398.268) (-1404.475) [-1401.794] (-1406.734) -- 0:01:02
607000 -- (-1403.876) (-1402.119) [-1397.761] (-1401.442) * (-1402.015) (-1405.489) (-1401.484) [-1407.766] -- 0:01:02
607500 -- (-1399.045) (-1397.150) [-1396.710] (-1397.067) * (-1407.971) (-1404.909) [-1394.770] (-1398.591) -- 0:01:02
608000 -- [-1397.783] (-1398.009) (-1403.743) (-1398.361) * (-1407.029) (-1399.350) [-1395.157] (-1403.222) -- 0:01:02
608500 -- (-1396.215) (-1398.197) (-1403.298) [-1397.473] * (-1402.307) [-1402.825] (-1399.344) (-1401.120) -- 0:01:02
609000 -- (-1400.709) (-1403.681) (-1405.819) [-1398.726] * (-1397.079) (-1408.235) (-1401.419) [-1399.594] -- 0:01:02
609500 -- (-1402.161) [-1398.044] (-1407.546) (-1399.185) * [-1403.402] (-1404.198) (-1400.152) (-1399.391) -- 0:01:02
610000 -- (-1399.591) (-1398.038) [-1399.140] (-1401.979) * (-1398.706) (-1402.704) (-1400.026) [-1395.386] -- 0:01:02
Average standard deviation of split frequencies: 0.013123
610500 -- (-1402.345) (-1400.729) (-1401.773) [-1399.250] * [-1396.924] (-1402.278) (-1400.650) (-1403.351) -- 0:01:02
611000 -- [-1398.032] (-1398.580) (-1398.087) (-1401.385) * [-1400.142] (-1399.983) (-1401.525) (-1397.448) -- 0:01:02
611500 -- [-1397.229] (-1404.683) (-1401.322) (-1397.006) * [-1397.613] (-1394.943) (-1399.205) (-1398.919) -- 0:01:02
612000 -- (-1398.877) (-1405.018) [-1399.995] (-1401.143) * (-1401.385) (-1405.542) (-1398.344) [-1398.013] -- 0:01:02
612500 -- [-1398.706] (-1408.314) (-1400.389) (-1402.011) * (-1396.827) (-1401.494) [-1400.559] (-1398.334) -- 0:01:02
613000 -- (-1400.099) (-1401.482) (-1404.336) [-1399.718] * (-1402.693) (-1398.711) (-1398.860) [-1399.231] -- 0:01:01
613500 -- (-1406.616) [-1397.424] (-1399.258) (-1398.308) * (-1400.154) (-1393.108) (-1395.546) [-1398.444] -- 0:01:01
614000 -- (-1401.086) (-1400.024) [-1396.974] (-1403.233) * (-1403.604) (-1395.543) (-1399.249) [-1396.553] -- 0:01:01
614500 -- (-1400.954) (-1398.844) [-1399.177] (-1404.308) * (-1399.872) [-1402.273] (-1397.906) (-1396.145) -- 0:01:01
615000 -- (-1402.950) (-1409.177) (-1400.053) [-1403.152] * (-1409.670) [-1397.776] (-1403.886) (-1399.142) -- 0:01:01
Average standard deviation of split frequencies: 0.012244
615500 -- [-1400.315] (-1405.676) (-1404.136) (-1398.159) * (-1400.546) [-1402.456] (-1406.006) (-1401.425) -- 0:01:01
616000 -- (-1401.011) (-1400.518) [-1402.114] (-1400.833) * (-1413.202) [-1397.076] (-1400.326) (-1401.568) -- 0:01:01
616500 -- (-1405.216) [-1399.603] (-1398.380) (-1397.563) * (-1405.358) [-1396.952] (-1401.713) (-1399.998) -- 0:01:01
617000 -- (-1401.509) (-1396.371) (-1402.102) [-1402.236] * (-1406.679) (-1395.732) (-1403.774) [-1397.385] -- 0:01:01
617500 -- (-1402.031) (-1395.808) (-1395.672) [-1402.439] * (-1402.718) [-1393.913] (-1403.076) (-1398.569) -- 0:01:01
618000 -- (-1402.284) [-1397.880] (-1400.497) (-1405.926) * (-1398.489) (-1394.706) [-1401.178] (-1404.191) -- 0:01:01
618500 -- (-1407.889) (-1395.942) [-1397.341] (-1401.455) * [-1403.783] (-1393.734) (-1405.813) (-1405.626) -- 0:01:01
619000 -- (-1397.781) (-1405.753) (-1400.933) [-1398.212] * (-1404.921) (-1396.802) [-1393.641] (-1407.836) -- 0:01:00
619500 -- [-1404.507] (-1405.133) (-1400.852) (-1401.640) * [-1402.092] (-1400.199) (-1406.724) (-1403.985) -- 0:01:00
620000 -- (-1402.412) [-1398.417] (-1399.952) (-1401.653) * (-1399.854) [-1397.393] (-1408.584) (-1399.507) -- 0:01:00
Average standard deviation of split frequencies: 0.010633
620500 -- (-1398.287) (-1404.737) (-1395.721) [-1399.632] * (-1399.881) (-1399.141) (-1397.471) [-1398.493] -- 0:01:00
621000 -- (-1402.328) (-1405.880) [-1397.795] (-1401.402) * [-1400.713] (-1406.227) (-1401.556) (-1400.544) -- 0:01:00
621500 -- (-1402.966) [-1397.840] (-1399.021) (-1397.760) * (-1398.918) (-1403.471) (-1401.586) [-1399.277] -- 0:01:00
622000 -- [-1398.571] (-1395.634) (-1403.199) (-1401.622) * (-1397.351) (-1399.793) (-1402.154) [-1403.686] -- 0:01:00
622500 -- (-1401.760) [-1399.616] (-1401.753) (-1408.013) * (-1397.953) (-1400.345) [-1399.817] (-1400.294) -- 0:01:00
623000 -- (-1401.381) (-1398.787) [-1399.977] (-1401.767) * [-1399.800] (-1400.609) (-1401.142) (-1397.009) -- 0:01:00
623500 -- [-1395.118] (-1399.647) (-1397.657) (-1400.651) * [-1399.237] (-1402.956) (-1399.320) (-1396.773) -- 0:01:00
624000 -- (-1399.092) (-1405.287) [-1395.138] (-1397.887) * (-1399.676) (-1403.175) (-1398.827) [-1395.242] -- 0:01:00
624500 -- (-1397.587) (-1403.980) (-1393.125) [-1397.029] * (-1396.049) (-1404.014) (-1396.303) [-1396.875] -- 0:01:00
625000 -- (-1399.482) (-1401.553) (-1397.129) [-1398.624] * [-1402.204] (-1404.483) (-1397.799) (-1412.835) -- 0:01:00
Average standard deviation of split frequencies: 0.010543
625500 -- (-1402.135) (-1401.588) (-1396.472) [-1398.167] * [-1400.961] (-1397.309) (-1400.731) (-1405.598) -- 0:00:59
626000 -- (-1399.470) (-1401.162) [-1398.838] (-1396.713) * [-1397.354] (-1398.219) (-1407.310) (-1399.886) -- 0:00:59
626500 -- [-1405.307] (-1397.522) (-1404.076) (-1405.529) * [-1396.802] (-1400.889) (-1402.774) (-1399.006) -- 0:00:59
627000 -- (-1398.473) (-1398.707) (-1404.036) [-1396.259] * (-1401.770) (-1402.476) [-1403.755] (-1395.176) -- 0:00:59
627500 -- (-1400.756) [-1399.880] (-1401.850) (-1401.540) * (-1399.843) (-1409.624) [-1403.513] (-1401.769) -- 0:00:59
628000 -- (-1405.830) [-1397.166] (-1394.931) (-1399.477) * (-1411.480) (-1410.737) (-1399.544) [-1401.474] -- 0:00:59
628500 -- (-1414.816) (-1399.305) [-1396.091] (-1397.646) * (-1402.283) (-1400.816) [-1397.146] (-1402.195) -- 0:00:59
629000 -- (-1410.089) [-1395.073] (-1401.736) (-1403.032) * (-1402.817) (-1397.884) [-1395.905] (-1398.794) -- 0:00:59
629500 -- (-1399.924) (-1401.172) (-1397.399) [-1396.778] * (-1401.428) (-1401.462) (-1402.639) [-1402.701] -- 0:00:59
630000 -- [-1403.190] (-1398.171) (-1396.513) (-1398.327) * (-1396.975) [-1399.383] (-1400.264) (-1400.434) -- 0:00:59
Average standard deviation of split frequencies: 0.011212
630500 -- (-1403.576) [-1397.831] (-1398.559) (-1400.428) * (-1399.819) [-1399.888] (-1400.627) (-1405.853) -- 0:00:59
631000 -- (-1396.754) (-1408.261) (-1397.945) [-1397.075] * [-1399.339] (-1401.599) (-1399.843) (-1399.486) -- 0:00:59
631500 -- (-1398.101) (-1402.762) [-1399.814] (-1401.317) * [-1405.701] (-1400.370) (-1400.803) (-1401.487) -- 0:00:58
632000 -- [-1397.632] (-1407.536) (-1400.884) (-1400.994) * (-1407.031) (-1399.507) [-1398.287] (-1401.539) -- 0:00:58
632500 -- [-1401.367] (-1397.819) (-1398.377) (-1398.694) * (-1397.031) (-1399.061) [-1397.997] (-1399.702) -- 0:00:58
633000 -- (-1405.519) [-1399.106] (-1400.942) (-1397.428) * (-1398.857) [-1396.943] (-1396.384) (-1399.647) -- 0:00:58
633500 -- (-1408.132) (-1402.600) (-1405.370) [-1395.391] * (-1397.971) (-1400.548) [-1398.330] (-1401.183) -- 0:00:58
634000 -- (-1402.529) (-1394.737) (-1398.211) [-1400.116] * [-1404.293] (-1395.655) (-1402.257) (-1410.561) -- 0:00:58
634500 -- [-1403.810] (-1396.548) (-1401.328) (-1401.536) * (-1402.834) [-1396.512] (-1395.575) (-1403.549) -- 0:00:58
635000 -- [-1406.390] (-1403.304) (-1405.547) (-1396.363) * (-1406.482) (-1398.255) [-1401.972] (-1399.165) -- 0:00:58
Average standard deviation of split frequencies: 0.010006
635500 -- (-1400.111) [-1397.906] (-1405.577) (-1394.844) * (-1405.571) [-1392.875] (-1395.709) (-1407.852) -- 0:00:58
636000 -- [-1397.539] (-1404.496) (-1406.530) (-1401.815) * [-1402.456] (-1395.048) (-1402.869) (-1399.163) -- 0:00:58
636500 -- [-1401.083] (-1399.981) (-1406.875) (-1403.663) * (-1401.630) [-1398.716] (-1403.280) (-1396.739) -- 0:00:58
637000 -- [-1403.461] (-1402.873) (-1405.010) (-1404.129) * (-1403.027) (-1395.987) (-1409.284) [-1401.619] -- 0:00:58
637500 -- (-1399.925) (-1406.916) [-1406.558] (-1401.772) * (-1398.897) (-1397.622) (-1399.362) [-1398.606] -- 0:00:58
638000 -- (-1406.588) [-1393.996] (-1401.491) (-1399.115) * (-1394.642) (-1396.145) [-1394.749] (-1409.087) -- 0:00:57
638500 -- (-1404.293) [-1397.540] (-1397.659) (-1398.554) * (-1398.823) (-1413.127) (-1398.846) [-1399.682] -- 0:00:57
639000 -- [-1399.826] (-1398.240) (-1397.438) (-1402.133) * (-1409.306) [-1401.362] (-1397.141) (-1396.315) -- 0:00:57
639500 -- (-1401.186) (-1404.415) (-1398.096) [-1396.052] * (-1397.258) (-1403.889) [-1403.637] (-1398.520) -- 0:00:57
640000 -- [-1402.486] (-1408.590) (-1398.792) (-1402.634) * (-1400.068) (-1402.647) (-1395.693) [-1400.360] -- 0:00:57
Average standard deviation of split frequencies: 0.008830
640500 -- (-1401.114) (-1404.516) (-1401.344) [-1401.333] * (-1406.996) [-1394.940] (-1402.950) (-1397.556) -- 0:00:57
641000 -- (-1398.025) (-1402.425) [-1396.587] (-1406.993) * (-1402.394) [-1399.081] (-1399.845) (-1401.082) -- 0:00:57
641500 -- [-1403.185] (-1403.958) (-1397.199) (-1398.076) * (-1404.295) (-1401.422) [-1402.213] (-1396.853) -- 0:00:57
642000 -- [-1397.385] (-1403.443) (-1397.225) (-1400.791) * (-1405.572) (-1404.120) (-1406.180) [-1396.316] -- 0:00:57
642500 -- (-1394.241) [-1404.495] (-1397.499) (-1397.369) * [-1399.729] (-1399.561) (-1396.935) (-1404.441) -- 0:00:57
643000 -- (-1397.969) (-1400.840) [-1400.101] (-1401.642) * (-1397.207) (-1403.308) [-1396.072] (-1401.952) -- 0:00:57
643500 -- (-1398.201) (-1402.723) (-1402.469) [-1398.530] * (-1408.933) (-1414.923) (-1401.979) [-1401.093] -- 0:00:57
644000 -- (-1405.204) [-1400.801] (-1399.801) (-1399.068) * (-1411.775) (-1396.477) (-1396.978) [-1403.400] -- 0:00:56
644500 -- [-1402.651] (-1403.630) (-1402.860) (-1396.219) * (-1404.028) (-1401.278) (-1404.456) [-1399.939] -- 0:00:56
645000 -- (-1397.810) (-1401.997) [-1402.560] (-1400.624) * (-1416.199) (-1403.496) [-1395.944] (-1399.183) -- 0:00:56
Average standard deviation of split frequencies: 0.008027
645500 -- [-1397.356] (-1398.484) (-1399.875) (-1403.434) * (-1403.947) (-1402.581) [-1398.925] (-1400.113) -- 0:00:56
646000 -- [-1396.175] (-1401.934) (-1403.555) (-1403.819) * (-1401.622) [-1401.679] (-1403.411) (-1405.206) -- 0:00:56
646500 -- [-1395.634] (-1395.307) (-1401.398) (-1403.828) * (-1396.431) (-1401.604) (-1404.210) [-1402.658] -- 0:00:56
647000 -- (-1400.291) (-1399.709) [-1398.697] (-1401.373) * (-1400.947) (-1400.733) [-1397.902] (-1404.715) -- 0:00:56
647500 -- (-1398.440) (-1403.103) (-1404.267) [-1401.512] * [-1401.887] (-1397.350) (-1401.574) (-1398.755) -- 0:00:56
648000 -- [-1398.271] (-1400.954) (-1400.710) (-1415.021) * [-1398.862] (-1397.712) (-1406.780) (-1406.060) -- 0:00:56
648500 -- [-1398.329] (-1403.947) (-1398.424) (-1403.542) * (-1398.617) [-1396.969] (-1397.827) (-1407.262) -- 0:00:56
649000 -- (-1395.512) [-1398.328] (-1401.645) (-1402.195) * (-1399.235) [-1402.285] (-1397.557) (-1406.915) -- 0:00:56
649500 -- (-1397.183) [-1399.893] (-1400.757) (-1406.706) * (-1402.081) (-1399.594) (-1404.553) [-1400.199] -- 0:00:56
650000 -- [-1399.567] (-1407.915) (-1401.814) (-1399.526) * (-1403.539) [-1402.309] (-1401.332) (-1403.670) -- 0:00:56
Average standard deviation of split frequencies: 0.006520
650500 -- [-1398.505] (-1394.141) (-1401.948) (-1396.707) * (-1402.033) [-1397.639] (-1395.126) (-1403.476) -- 0:00:55
651000 -- [-1399.396] (-1405.428) (-1403.373) (-1394.650) * (-1403.179) [-1396.054] (-1401.438) (-1399.066) -- 0:00:55
651500 -- (-1407.113) (-1400.548) [-1403.702] (-1397.430) * (-1397.229) (-1399.517) [-1398.682] (-1398.670) -- 0:00:55
652000 -- (-1400.825) (-1404.073) (-1399.376) [-1397.180] * (-1397.705) (-1404.158) (-1405.144) [-1395.332] -- 0:00:55
652500 -- (-1403.428) (-1403.960) [-1401.786] (-1398.304) * (-1399.778) (-1398.345) (-1407.804) [-1393.763] -- 0:00:55
653000 -- (-1409.496) (-1404.447) [-1400.382] (-1400.373) * (-1404.030) (-1393.955) (-1399.682) [-1396.474] -- 0:00:55
653500 -- (-1404.408) (-1404.978) (-1408.196) [-1395.845] * [-1400.639] (-1400.395) (-1404.533) (-1396.645) -- 0:00:55
654000 -- (-1407.391) (-1404.706) (-1402.681) [-1393.571] * (-1398.863) [-1399.892] (-1398.470) (-1397.907) -- 0:00:55
654500 -- (-1403.476) (-1408.430) (-1401.362) [-1395.008] * (-1400.368) (-1403.839) [-1408.813] (-1402.259) -- 0:00:55
655000 -- [-1402.486] (-1399.503) (-1401.577) (-1397.096) * (-1397.000) (-1400.793) (-1409.202) [-1395.341] -- 0:00:55
Average standard deviation of split frequencies: 0.006108
655500 -- (-1400.485) (-1409.537) (-1398.718) [-1398.327] * (-1406.530) [-1399.872] (-1402.628) (-1401.018) -- 0:00:55
656000 -- [-1402.641] (-1401.883) (-1399.384) (-1403.042) * (-1413.050) [-1397.995] (-1404.875) (-1399.437) -- 0:00:55
656500 -- (-1401.623) [-1404.902] (-1413.992) (-1400.886) * (-1410.772) [-1402.825] (-1401.068) (-1402.552) -- 0:00:54
657000 -- (-1403.956) [-1395.949] (-1413.861) (-1399.985) * [-1407.254] (-1397.898) (-1406.018) (-1403.462) -- 0:00:54
657500 -- [-1399.081] (-1401.362) (-1412.425) (-1396.782) * (-1402.487) (-1397.939) (-1395.647) [-1406.457] -- 0:00:54
658000 -- (-1401.961) (-1399.946) (-1412.918) [-1400.230] * (-1410.009) [-1403.629] (-1398.326) (-1396.853) -- 0:00:54
658500 -- (-1400.782) (-1402.272) (-1402.788) [-1399.414] * (-1407.668) (-1404.274) [-1401.363] (-1402.357) -- 0:00:54
659000 -- [-1400.410] (-1403.024) (-1399.277) (-1398.425) * [-1400.499] (-1404.531) (-1406.193) (-1405.699) -- 0:00:54
659500 -- [-1399.817] (-1404.295) (-1397.298) (-1397.908) * (-1403.255) [-1403.039] (-1405.578) (-1404.118) -- 0:00:54
660000 -- (-1396.488) (-1412.384) (-1397.811) [-1399.500] * (-1403.248) (-1404.576) (-1396.907) [-1397.453] -- 0:00:54
Average standard deviation of split frequencies: 0.005708
660500 -- (-1399.936) [-1401.440] (-1397.523) (-1398.646) * [-1399.279] (-1403.870) (-1398.544) (-1400.512) -- 0:00:54
661000 -- (-1396.474) (-1401.999) [-1398.570] (-1399.301) * (-1401.810) (-1407.221) (-1401.612) [-1400.326] -- 0:00:54
661500 -- (-1404.086) (-1399.033) (-1398.556) [-1398.048] * (-1398.500) (-1403.712) [-1398.422] (-1396.289) -- 0:00:54
662000 -- (-1402.887) [-1399.557] (-1398.848) (-1405.644) * (-1399.417) (-1416.794) (-1395.453) [-1400.052] -- 0:00:54
662500 -- [-1400.594] (-1405.436) (-1401.230) (-1399.409) * (-1399.394) (-1404.278) [-1395.084] (-1397.443) -- 0:00:54
663000 -- [-1403.179] (-1400.191) (-1400.437) (-1400.792) * (-1406.270) (-1400.758) [-1398.326] (-1398.640) -- 0:00:53
663500 -- (-1400.540) (-1397.521) (-1400.176) [-1404.798] * (-1403.642) (-1400.555) [-1400.650] (-1401.346) -- 0:00:53
664000 -- (-1402.928) (-1416.361) [-1395.921] (-1401.500) * (-1395.942) (-1400.941) (-1402.109) [-1398.431] -- 0:00:53
664500 -- (-1402.437) [-1401.916] (-1396.215) (-1397.395) * [-1397.024] (-1401.766) (-1407.493) (-1401.886) -- 0:00:53
665000 -- (-1397.851) (-1396.600) [-1396.275] (-1409.310) * (-1401.041) (-1402.493) [-1400.557] (-1401.211) -- 0:00:53
Average standard deviation of split frequencies: 0.006370
665500 -- (-1399.368) [-1402.739] (-1399.439) (-1398.429) * (-1401.747) (-1396.921) (-1400.541) [-1405.657] -- 0:00:53
666000 -- [-1396.781] (-1407.708) (-1399.977) (-1398.575) * [-1401.851] (-1403.821) (-1404.659) (-1402.471) -- 0:00:53
666500 -- (-1397.755) (-1402.752) [-1400.603] (-1401.220) * [-1398.295] (-1401.176) (-1402.121) (-1401.171) -- 0:00:53
667000 -- [-1397.198] (-1399.190) (-1400.640) (-1415.814) * (-1402.252) [-1399.846] (-1401.997) (-1398.694) -- 0:00:53
667500 -- (-1403.528) (-1405.491) (-1400.516) [-1404.604] * (-1396.141) [-1402.262] (-1395.993) (-1399.043) -- 0:00:53
668000 -- (-1402.858) [-1400.592] (-1402.643) (-1398.021) * [-1399.881] (-1398.889) (-1398.992) (-1400.607) -- 0:00:53
668500 -- (-1402.676) (-1403.017) (-1399.031) [-1403.423] * [-1398.247] (-1401.406) (-1407.088) (-1398.208) -- 0:00:53
669000 -- (-1406.639) (-1396.799) [-1396.397] (-1401.271) * (-1399.199) [-1398.694] (-1402.958) (-1401.372) -- 0:00:52
669500 -- (-1404.567) (-1404.066) (-1404.654) [-1403.560] * (-1406.460) [-1400.328] (-1400.360) (-1401.900) -- 0:00:52
670000 -- (-1399.351) (-1401.636) [-1403.245] (-1398.539) * (-1409.684) [-1397.820] (-1399.254) (-1405.338) -- 0:00:52
Average standard deviation of split frequencies: 0.006677
670500 -- [-1404.134] (-1400.263) (-1399.277) (-1402.509) * (-1406.541) (-1401.156) [-1398.409] (-1397.487) -- 0:00:52
671000 -- (-1403.819) (-1400.464) (-1403.297) [-1397.304] * (-1399.052) (-1397.777) (-1399.365) [-1401.438] -- 0:00:52
671500 -- (-1402.048) (-1397.370) (-1401.671) [-1399.884] * [-1401.131] (-1400.035) (-1399.191) (-1402.885) -- 0:00:52
672000 -- (-1402.312) [-1399.723] (-1400.422) (-1405.387) * (-1396.501) [-1397.910] (-1401.063) (-1397.352) -- 0:00:52
672500 -- [-1401.020] (-1396.189) (-1409.600) (-1403.360) * (-1399.806) (-1397.491) [-1404.860] (-1401.143) -- 0:00:52
673000 -- (-1409.053) (-1401.823) (-1399.319) [-1400.611] * (-1398.302) (-1398.574) [-1398.841] (-1406.522) -- 0:00:52
673500 -- [-1400.195] (-1405.234) (-1403.766) (-1398.447) * (-1404.831) (-1401.627) (-1403.506) [-1413.002] -- 0:00:52
674000 -- (-1402.450) [-1395.811] (-1402.018) (-1398.543) * (-1400.113) (-1396.426) (-1399.882) [-1397.593] -- 0:00:52
674500 -- (-1404.534) (-1400.128) (-1398.095) [-1402.291] * (-1398.891) (-1399.889) (-1399.418) [-1402.781] -- 0:00:52
675000 -- (-1405.488) (-1398.699) (-1397.712) [-1406.983] * (-1396.527) (-1403.915) [-1398.607] (-1400.094) -- 0:00:52
Average standard deviation of split frequencies: 0.007322
675500 -- (-1396.932) (-1396.778) [-1400.878] (-1400.412) * [-1398.806] (-1401.528) (-1405.929) (-1397.526) -- 0:00:51
676000 -- (-1394.819) (-1398.968) (-1404.356) [-1402.111] * [-1399.398] (-1396.933) (-1398.708) (-1395.887) -- 0:00:51
676500 -- (-1401.656) [-1402.687] (-1395.586) (-1400.043) * (-1399.969) (-1400.008) [-1397.194] (-1402.248) -- 0:00:51
677000 -- (-1404.577) [-1402.838] (-1404.313) (-1400.478) * [-1400.339] (-1401.390) (-1396.522) (-1398.403) -- 0:00:51
677500 -- [-1397.012] (-1406.695) (-1401.622) (-1403.559) * (-1403.413) (-1396.363) [-1398.468] (-1409.866) -- 0:00:51
678000 -- (-1407.897) (-1399.035) (-1399.256) [-1401.015] * (-1413.102) (-1400.164) [-1399.070] (-1402.309) -- 0:00:51
678500 -- (-1402.416) (-1414.126) (-1407.213) [-1399.191] * (-1406.063) (-1399.020) (-1400.051) [-1403.300] -- 0:00:51
679000 -- (-1399.631) (-1404.496) (-1397.508) [-1399.139] * (-1401.129) (-1399.451) [-1399.593] (-1402.116) -- 0:00:51
679500 -- (-1393.971) (-1405.866) [-1397.691] (-1400.194) * [-1400.614] (-1397.751) (-1398.623) (-1398.483) -- 0:00:51
680000 -- (-1394.287) (-1398.903) (-1400.842) [-1396.185] * (-1405.711) (-1400.200) (-1401.509) [-1404.687] -- 0:00:51
Average standard deviation of split frequencies: 0.006926
680500 -- (-1401.576) [-1400.466] (-1401.974) (-1396.627) * (-1405.441) (-1405.901) (-1400.533) [-1401.322] -- 0:00:51
681000 -- (-1405.828) (-1395.895) [-1402.819] (-1399.523) * (-1403.868) (-1402.558) [-1397.675] (-1398.825) -- 0:00:51
681500 -- (-1401.706) [-1399.622] (-1399.980) (-1403.740) * (-1401.677) (-1408.365) (-1396.859) [-1400.474] -- 0:00:50
682000 -- (-1405.244) (-1397.337) (-1404.240) [-1399.596] * [-1403.892] (-1404.175) (-1400.980) (-1405.604) -- 0:00:50
682500 -- (-1395.039) [-1404.037] (-1403.813) (-1407.285) * (-1400.061) (-1404.354) (-1404.756) [-1398.063] -- 0:00:50
683000 -- (-1396.374) [-1399.532] (-1400.889) (-1408.401) * (-1401.229) (-1401.774) [-1402.932] (-1401.142) -- 0:00:50
683500 -- [-1398.178] (-1401.107) (-1404.071) (-1415.446) * (-1406.956) (-1413.085) [-1397.506] (-1400.424) -- 0:00:50
684000 -- (-1400.128) [-1400.639] (-1402.272) (-1407.164) * (-1415.836) (-1404.572) (-1402.151) [-1397.039] -- 0:00:50
684500 -- (-1402.088) [-1400.223] (-1398.413) (-1406.726) * (-1402.518) [-1405.355] (-1403.475) (-1399.190) -- 0:00:50
685000 -- (-1396.503) (-1405.217) (-1400.216) [-1401.367] * (-1404.543) (-1396.662) (-1408.469) [-1401.198] -- 0:00:50
Average standard deviation of split frequencies: 0.007559
685500 -- [-1398.624] (-1402.905) (-1401.625) (-1403.502) * (-1402.779) [-1399.624] (-1401.617) (-1397.058) -- 0:00:50
686000 -- [-1401.221] (-1401.527) (-1400.107) (-1399.506) * (-1396.336) (-1405.637) (-1405.320) [-1399.550] -- 0:00:50
686500 -- (-1405.733) (-1400.863) (-1405.122) [-1398.244] * (-1402.202) [-1399.982] (-1401.407) (-1402.823) -- 0:00:50
687000 -- [-1401.037] (-1402.732) (-1405.784) (-1402.284) * (-1403.368) (-1401.496) [-1399.435] (-1401.812) -- 0:00:50
687500 -- (-1404.702) (-1402.812) (-1400.266) [-1395.342] * (-1397.020) (-1399.771) [-1395.424] (-1401.717) -- 0:00:50
688000 -- (-1401.429) (-1399.933) [-1398.436] (-1410.796) * [-1395.732] (-1401.641) (-1407.073) (-1397.546) -- 0:00:49
688500 -- (-1398.345) (-1405.320) [-1398.742] (-1403.814) * (-1399.169) (-1395.312) [-1402.730] (-1395.434) -- 0:00:49
689000 -- [-1399.568] (-1399.204) (-1403.573) (-1404.604) * [-1399.636] (-1405.905) (-1403.181) (-1401.781) -- 0:00:49
689500 -- (-1403.491) (-1398.285) [-1394.922] (-1402.993) * (-1400.940) (-1405.205) (-1400.152) [-1400.169] -- 0:00:49
690000 -- (-1402.027) (-1396.376) [-1394.751] (-1405.040) * (-1399.659) [-1396.548] (-1403.126) (-1402.081) -- 0:00:49
Average standard deviation of split frequencies: 0.008190
690500 -- [-1399.640] (-1406.896) (-1398.724) (-1402.448) * [-1399.848] (-1397.325) (-1397.187) (-1401.021) -- 0:00:49
691000 -- (-1399.973) (-1401.923) [-1400.467] (-1403.607) * [-1398.105] (-1394.953) (-1397.095) (-1401.655) -- 0:00:49
691500 -- (-1402.594) (-1400.425) [-1397.994] (-1404.584) * (-1398.852) (-1400.340) [-1405.550] (-1403.135) -- 0:00:49
692000 -- (-1407.990) (-1406.723) [-1404.671] (-1408.067) * [-1395.332] (-1402.624) (-1405.798) (-1415.293) -- 0:00:49
692500 -- (-1405.153) (-1401.065) [-1403.952] (-1406.703) * (-1399.057) (-1405.545) [-1400.945] (-1406.445) -- 0:00:49
693000 -- (-1399.415) [-1398.140] (-1405.370) (-1401.341) * (-1403.153) (-1396.599) (-1400.748) [-1400.306] -- 0:00:49
693500 -- (-1401.013) [-1396.252] (-1401.052) (-1400.984) * [-1398.650] (-1404.037) (-1407.140) (-1398.806) -- 0:00:49
694000 -- (-1398.666) [-1397.551] (-1403.614) (-1402.947) * (-1400.650) [-1398.945] (-1403.441) (-1406.166) -- 0:00:48
694500 -- [-1400.895] (-1401.225) (-1397.116) (-1401.085) * (-1406.528) [-1400.603] (-1399.633) (-1399.387) -- 0:00:48
695000 -- [-1397.659] (-1397.500) (-1401.004) (-1401.601) * (-1399.998) [-1400.438] (-1398.269) (-1404.995) -- 0:00:48
Average standard deviation of split frequencies: 0.007450
695500 -- [-1398.067] (-1397.945) (-1398.260) (-1397.465) * [-1395.320] (-1398.009) (-1402.065) (-1400.361) -- 0:00:48
696000 -- (-1400.221) [-1396.717] (-1406.241) (-1402.199) * (-1401.987) (-1401.466) (-1399.894) [-1399.576] -- 0:00:48
696500 -- (-1397.139) (-1402.962) [-1397.702] (-1407.323) * [-1394.238] (-1407.979) (-1399.675) (-1406.905) -- 0:00:48
697000 -- (-1396.694) (-1398.384) [-1399.519] (-1403.707) * (-1396.113) (-1399.099) [-1393.969] (-1405.434) -- 0:00:48
697500 -- [-1398.109] (-1396.215) (-1399.248) (-1410.364) * (-1398.519) (-1402.217) [-1398.124] (-1399.203) -- 0:00:48
698000 -- [-1396.766] (-1401.399) (-1399.822) (-1403.140) * (-1399.975) [-1402.868] (-1401.493) (-1401.259) -- 0:00:48
698500 -- (-1399.562) (-1399.930) (-1401.888) [-1399.966] * [-1401.879] (-1401.444) (-1398.492) (-1399.817) -- 0:00:48
699000 -- (-1394.816) (-1406.725) [-1399.957] (-1400.068) * (-1402.657) (-1397.104) (-1401.974) [-1397.703] -- 0:00:48
699500 -- (-1405.373) [-1395.684] (-1403.305) (-1401.398) * (-1405.438) (-1403.252) (-1403.824) [-1397.121] -- 0:00:48
700000 -- (-1399.508) [-1407.022] (-1396.123) (-1397.529) * [-1395.745] (-1401.316) (-1401.819) (-1400.348) -- 0:00:48
Average standard deviation of split frequencies: 0.007737
700500 -- (-1401.953) (-1398.732) [-1398.900] (-1399.022) * [-1398.760] (-1408.204) (-1399.321) (-1395.345) -- 0:00:47
701000 -- (-1396.348) (-1396.177) [-1398.061] (-1398.367) * (-1399.636) (-1405.997) [-1394.879] (-1397.221) -- 0:00:47
701500 -- (-1397.787) (-1399.148) (-1398.280) [-1398.102] * (-1399.187) (-1400.361) [-1404.745] (-1400.357) -- 0:00:47
702000 -- (-1396.050) (-1400.365) (-1396.573) [-1397.546] * (-1401.465) (-1397.978) [-1398.577] (-1396.816) -- 0:00:47
702500 -- (-1404.172) [-1401.334] (-1406.900) (-1399.634) * (-1399.684) (-1406.431) (-1403.827) [-1401.152] -- 0:00:47
703000 -- (-1399.755) [-1398.468] (-1398.452) (-1397.559) * (-1396.062) (-1398.280) [-1401.276] (-1398.121) -- 0:00:47
703500 -- [-1397.686] (-1400.624) (-1401.625) (-1411.265) * (-1397.831) [-1398.912] (-1402.459) (-1402.373) -- 0:00:47
704000 -- [-1399.481] (-1394.825) (-1403.882) (-1399.142) * (-1403.594) [-1401.884] (-1403.988) (-1398.921) -- 0:00:47
704500 -- (-1398.260) [-1398.091] (-1404.189) (-1405.944) * [-1396.581] (-1396.562) (-1401.188) (-1411.700) -- 0:00:47
705000 -- (-1400.082) [-1397.395] (-1395.367) (-1402.565) * (-1405.140) [-1397.542] (-1398.919) (-1399.446) -- 0:00:47
Average standard deviation of split frequencies: 0.007011
705500 -- (-1399.588) [-1399.318] (-1403.035) (-1401.707) * (-1411.441) (-1405.620) [-1398.714] (-1399.281) -- 0:00:47
706000 -- [-1395.154] (-1402.016) (-1398.361) (-1406.717) * (-1399.361) (-1403.851) (-1397.534) [-1405.304] -- 0:00:47
706500 -- [-1398.257] (-1397.300) (-1397.693) (-1402.052) * (-1405.950) (-1404.069) [-1403.426] (-1405.217) -- 0:00:46
707000 -- (-1404.531) [-1402.171] (-1401.132) (-1404.801) * (-1400.187) [-1396.716] (-1398.031) (-1404.968) -- 0:00:46
707500 -- (-1401.385) (-1404.496) (-1403.006) [-1399.215] * (-1401.691) (-1403.661) [-1394.980] (-1398.955) -- 0:00:46
708000 -- (-1399.423) (-1402.669) [-1403.008] (-1397.909) * (-1417.110) (-1400.112) [-1401.469] (-1397.724) -- 0:00:46
708500 -- (-1398.908) (-1398.537) (-1408.728) [-1399.068] * (-1402.400) [-1400.073] (-1398.904) (-1399.877) -- 0:00:46
709000 -- (-1402.628) (-1410.605) (-1401.523) [-1399.880] * (-1401.033) (-1397.497) (-1398.139) [-1395.020] -- 0:00:46
709500 -- (-1394.745) [-1399.837] (-1398.582) (-1398.174) * (-1397.975) (-1401.618) [-1397.732] (-1398.923) -- 0:00:46
710000 -- [-1401.538] (-1400.750) (-1400.748) (-1403.514) * [-1398.674] (-1404.049) (-1396.979) (-1401.976) -- 0:00:46
Average standard deviation of split frequencies: 0.007297
710500 -- (-1397.209) (-1397.666) [-1396.965] (-1403.345) * (-1410.915) (-1408.681) (-1410.311) [-1395.785] -- 0:00:46
711000 -- [-1396.869] (-1403.559) (-1397.115) (-1402.265) * (-1411.904) [-1406.180] (-1402.490) (-1397.342) -- 0:00:46
711500 -- (-1399.042) [-1396.147] (-1402.788) (-1400.530) * (-1407.106) [-1400.014] (-1401.259) (-1398.567) -- 0:00:46
712000 -- (-1402.564) [-1396.301] (-1404.005) (-1403.238) * (-1402.118) (-1401.296) (-1407.224) [-1396.187] -- 0:00:46
712500 -- (-1399.228) [-1400.362] (-1399.754) (-1403.732) * (-1398.419) (-1398.815) [-1397.179] (-1394.458) -- 0:00:46
713000 -- (-1398.786) [-1401.815] (-1401.439) (-1402.034) * (-1401.823) (-1399.098) (-1407.377) [-1402.945] -- 0:00:45
713500 -- (-1397.062) (-1407.463) [-1399.678] (-1400.590) * [-1398.303] (-1401.717) (-1401.357) (-1400.337) -- 0:00:45
714000 -- (-1400.505) (-1408.017) (-1397.529) [-1405.370] * [-1397.380] (-1395.813) (-1403.214) (-1401.653) -- 0:00:45
714500 -- [-1400.298] (-1399.459) (-1395.634) (-1406.624) * (-1408.319) (-1403.618) [-1404.376] (-1401.596) -- 0:00:45
715000 -- [-1400.485] (-1401.741) (-1399.903) (-1400.980) * (-1398.891) (-1401.768) (-1406.263) [-1400.325] -- 0:00:45
Average standard deviation of split frequencies: 0.007242
715500 -- [-1397.494] (-1402.786) (-1401.444) (-1398.555) * (-1398.818) (-1398.804) [-1405.711] (-1401.798) -- 0:00:45
716000 -- (-1396.375) (-1406.545) (-1404.581) [-1403.082] * [-1396.581] (-1397.782) (-1405.879) (-1400.754) -- 0:00:45
716500 -- (-1404.382) [-1402.874] (-1401.719) (-1403.724) * (-1398.622) [-1403.074] (-1398.630) (-1396.367) -- 0:00:45
717000 -- (-1402.343) (-1405.254) (-1402.539) [-1401.625] * [-1403.872] (-1396.457) (-1399.416) (-1398.602) -- 0:00:45
717500 -- [-1403.887] (-1398.265) (-1406.888) (-1409.737) * (-1402.724) (-1400.628) [-1396.237] (-1401.427) -- 0:00:45
718000 -- [-1402.342] (-1401.587) (-1401.598) (-1414.367) * [-1397.334] (-1398.359) (-1407.799) (-1407.116) -- 0:00:45
718500 -- (-1400.662) (-1398.383) [-1404.569] (-1398.370) * [-1395.523] (-1401.557) (-1409.475) (-1404.951) -- 0:00:45
719000 -- [-1400.766] (-1403.317) (-1401.616) (-1398.818) * (-1401.094) (-1403.791) (-1402.769) [-1397.247] -- 0:00:44
719500 -- (-1397.103) (-1404.410) (-1400.285) [-1401.553] * [-1397.476] (-1404.479) (-1396.227) (-1400.740) -- 0:00:44
720000 -- [-1395.566] (-1409.940) (-1404.887) (-1403.095) * (-1401.548) [-1397.250] (-1400.729) (-1399.414) -- 0:00:44
Average standard deviation of split frequencies: 0.007849
720500 -- [-1396.178] (-1408.868) (-1403.301) (-1402.150) * (-1402.994) [-1397.442] (-1404.012) (-1396.737) -- 0:00:44
721000 -- [-1396.807] (-1396.007) (-1400.505) (-1397.259) * (-1407.832) (-1397.964) (-1400.256) [-1397.688] -- 0:00:44
721500 -- (-1401.987) (-1399.513) (-1402.852) [-1394.931] * (-1401.980) (-1400.123) [-1404.635] (-1404.672) -- 0:00:44
722000 -- (-1409.725) [-1400.980] (-1398.980) (-1395.821) * (-1401.338) [-1399.357] (-1405.958) (-1399.916) -- 0:00:44
722500 -- (-1401.555) (-1401.531) [-1402.119] (-1396.144) * [-1394.268] (-1398.811) (-1400.723) (-1407.594) -- 0:00:44
723000 -- (-1398.581) (-1398.465) (-1402.715) [-1396.445] * (-1399.858) [-1397.290] (-1412.432) (-1402.447) -- 0:00:44
723500 -- (-1395.994) (-1400.700) (-1404.470) [-1396.059] * (-1399.269) [-1398.440] (-1403.310) (-1404.536) -- 0:00:44
724000 -- (-1398.674) [-1394.445] (-1406.359) (-1402.740) * (-1404.382) [-1395.177] (-1405.644) (-1403.142) -- 0:00:44
724500 -- (-1395.919) (-1398.006) (-1401.935) [-1397.291] * [-1408.932] (-1401.419) (-1402.156) (-1395.990) -- 0:00:44
725000 -- (-1400.669) (-1396.906) (-1399.845) [-1399.253] * (-1401.099) [-1398.774] (-1409.562) (-1404.391) -- 0:00:44
Average standard deviation of split frequencies: 0.007467
725500 -- [-1397.121] (-1398.936) (-1404.863) (-1400.120) * [-1400.477] (-1400.299) (-1402.977) (-1400.452) -- 0:00:43
726000 -- (-1399.081) [-1402.632] (-1405.806) (-1408.554) * [-1397.661] (-1403.463) (-1409.631) (-1403.821) -- 0:00:43
726500 -- [-1399.725] (-1402.213) (-1398.809) (-1405.255) * (-1396.372) (-1403.996) [-1407.680] (-1402.969) -- 0:00:43
727000 -- (-1399.766) (-1400.733) [-1395.059] (-1396.626) * [-1399.479] (-1397.539) (-1401.133) (-1403.090) -- 0:00:43
727500 -- [-1401.342] (-1398.225) (-1399.966) (-1402.356) * [-1406.715] (-1401.072) (-1402.575) (-1398.832) -- 0:00:43
728000 -- (-1398.437) (-1397.084) [-1400.379] (-1401.511) * [-1397.136] (-1405.533) (-1401.852) (-1395.602) -- 0:00:43
728500 -- (-1402.688) (-1401.738) (-1399.847) [-1397.980] * (-1397.925) (-1403.285) (-1403.574) [-1396.312] -- 0:00:43
729000 -- (-1411.248) (-1401.039) [-1400.366] (-1399.550) * [-1399.575] (-1398.307) (-1395.822) (-1401.128) -- 0:00:43
729500 -- (-1402.421) [-1405.146] (-1399.591) (-1397.299) * [-1394.943] (-1403.513) (-1403.304) (-1396.846) -- 0:00:43
730000 -- (-1398.508) (-1407.164) (-1400.522) [-1395.620] * (-1394.884) [-1401.891] (-1396.863) (-1403.045) -- 0:00:43
Average standard deviation of split frequencies: 0.007419
730500 -- (-1402.459) (-1401.508) (-1403.957) [-1394.061] * (-1398.977) (-1406.713) [-1399.250] (-1402.902) -- 0:00:43
731000 -- (-1402.539) (-1400.614) (-1408.489) [-1395.588] * (-1399.110) (-1407.558) [-1405.136] (-1405.975) -- 0:00:43
731500 -- (-1398.533) (-1403.242) (-1404.220) [-1394.633] * (-1397.515) [-1411.260] (-1402.047) (-1404.471) -- 0:00:42
732000 -- [-1401.148] (-1402.793) (-1411.746) (-1396.821) * [-1398.844] (-1408.901) (-1400.882) (-1403.982) -- 0:00:42
732500 -- [-1397.706] (-1397.597) (-1400.943) (-1398.031) * [-1398.771] (-1402.350) (-1405.422) (-1396.178) -- 0:00:42
733000 -- (-1399.273) (-1401.286) (-1399.528) [-1398.878] * (-1398.908) (-1402.002) [-1399.203] (-1399.636) -- 0:00:42
733500 -- [-1398.098] (-1402.130) (-1400.039) (-1399.951) * (-1401.785) (-1399.520) (-1397.124) [-1394.154] -- 0:00:42
734000 -- [-1396.075] (-1398.325) (-1409.598) (-1397.881) * (-1397.785) (-1396.255) (-1402.690) [-1396.816] -- 0:00:42
734500 -- (-1402.407) [-1397.676] (-1405.139) (-1399.572) * [-1398.195] (-1397.964) (-1407.596) (-1405.432) -- 0:00:42
735000 -- (-1401.879) (-1395.973) [-1396.153] (-1398.933) * (-1401.775) (-1400.167) [-1404.897] (-1401.139) -- 0:00:42
Average standard deviation of split frequencies: 0.007366
735500 -- (-1401.820) (-1400.632) [-1397.426] (-1397.023) * (-1409.465) (-1398.897) [-1399.397] (-1404.461) -- 0:00:42
736000 -- [-1400.744] (-1401.781) (-1403.677) (-1401.897) * [-1401.108] (-1404.514) (-1403.488) (-1408.721) -- 0:00:42
736500 -- (-1396.272) [-1400.427] (-1403.773) (-1398.521) * [-1404.389] (-1404.985) (-1405.187) (-1402.300) -- 0:00:42
737000 -- (-1399.302) (-1398.755) (-1399.988) [-1395.308] * (-1405.253) [-1404.976] (-1401.107) (-1400.550) -- 0:00:42
737500 -- (-1396.743) (-1405.362) [-1406.386] (-1398.397) * (-1403.304) (-1399.103) (-1400.189) [-1395.504] -- 0:00:42
738000 -- [-1396.093] (-1403.715) (-1400.402) (-1397.257) * (-1400.756) [-1409.030] (-1398.380) (-1406.023) -- 0:00:41
738500 -- (-1399.103) (-1409.168) [-1399.585] (-1406.286) * (-1399.315) (-1406.392) (-1399.608) [-1398.377] -- 0:00:41
739000 -- (-1400.463) (-1403.130) [-1394.567] (-1403.381) * (-1400.691) (-1403.683) (-1398.605) [-1398.324] -- 0:00:41
739500 -- (-1404.373) [-1399.667] (-1400.269) (-1399.040) * (-1397.216) (-1404.892) [-1397.043] (-1399.659) -- 0:00:41
740000 -- [-1403.333] (-1397.708) (-1403.075) (-1406.730) * (-1398.697) (-1411.472) (-1400.798) [-1404.960] -- 0:00:41
Average standard deviation of split frequencies: 0.007956
740500 -- (-1400.141) [-1397.690] (-1404.276) (-1401.267) * [-1396.102] (-1398.133) (-1396.595) (-1400.382) -- 0:00:41
741000 -- (-1402.458) [-1396.865] (-1398.855) (-1404.261) * (-1396.664) (-1402.899) [-1399.141] (-1405.867) -- 0:00:41
741500 -- [-1397.525] (-1402.751) (-1398.956) (-1400.367) * [-1395.420] (-1402.107) (-1397.539) (-1403.406) -- 0:00:41
742000 -- (-1401.274) [-1401.748] (-1399.869) (-1411.635) * (-1401.890) (-1398.645) [-1400.499] (-1402.893) -- 0:00:41
742500 -- (-1396.485) (-1406.314) [-1407.024] (-1398.244) * (-1402.395) (-1408.628) (-1401.267) [-1400.958] -- 0:00:41
743000 -- (-1400.040) (-1406.421) [-1403.074] (-1399.115) * [-1401.727] (-1401.260) (-1402.485) (-1400.879) -- 0:00:41
743500 -- (-1402.970) (-1398.884) (-1402.103) [-1398.622] * (-1403.658) [-1398.136] (-1407.542) (-1400.242) -- 0:00:41
744000 -- (-1403.959) [-1401.918] (-1397.133) (-1397.633) * [-1395.739] (-1403.858) (-1396.648) (-1396.730) -- 0:00:40
744500 -- (-1400.091) (-1400.198) (-1405.050) [-1400.429] * (-1400.940) (-1409.815) [-1396.974] (-1399.328) -- 0:00:40
745000 -- (-1401.433) [-1400.039] (-1403.362) (-1400.170) * (-1405.505) [-1404.718] (-1401.118) (-1399.910) -- 0:00:40
Average standard deviation of split frequencies: 0.007899
745500 -- (-1406.276) (-1397.405) [-1397.927] (-1404.807) * (-1397.200) (-1403.047) (-1400.592) [-1394.279] -- 0:00:40
746000 -- (-1400.745) (-1405.566) [-1393.985] (-1401.439) * (-1394.493) [-1395.657] (-1401.150) (-1404.913) -- 0:00:40
746500 -- [-1395.386] (-1397.775) (-1399.434) (-1404.600) * (-1403.818) [-1397.626] (-1404.734) (-1402.397) -- 0:00:40
747000 -- [-1395.982] (-1400.485) (-1407.541) (-1397.524) * (-1399.547) (-1398.698) (-1399.383) [-1398.458] -- 0:00:40
747500 -- (-1397.711) (-1404.067) [-1402.423] (-1397.762) * (-1401.905) [-1400.705] (-1401.061) (-1395.114) -- 0:00:40
748000 -- (-1397.545) [-1403.752] (-1404.391) (-1399.074) * [-1399.102] (-1400.413) (-1398.658) (-1408.817) -- 0:00:40
748500 -- (-1401.307) (-1402.117) [-1404.462] (-1394.517) * (-1400.271) (-1400.225) (-1397.610) [-1399.544] -- 0:00:40
749000 -- (-1396.940) [-1400.282] (-1399.384) (-1400.703) * (-1399.452) (-1400.983) (-1399.687) [-1398.657] -- 0:00:40
749500 -- [-1397.042] (-1400.412) (-1398.632) (-1401.411) * (-1399.981) (-1393.650) [-1399.122] (-1397.202) -- 0:00:40
750000 -- [-1399.387] (-1407.726) (-1402.854) (-1405.412) * (-1401.150) [-1394.639] (-1406.772) (-1401.449) -- 0:00:40
Average standard deviation of split frequencies: 0.006908
750500 -- (-1396.261) (-1401.380) (-1408.688) [-1400.115] * (-1399.251) [-1394.510] (-1401.297) (-1401.945) -- 0:00:39
751000 -- (-1399.344) [-1398.883] (-1401.221) (-1398.993) * [-1396.546] (-1394.001) (-1401.487) (-1406.219) -- 0:00:39
751500 -- (-1400.210) (-1399.599) (-1406.980) [-1397.254] * [-1397.706] (-1394.259) (-1396.980) (-1408.011) -- 0:00:39
752000 -- (-1406.170) (-1397.693) [-1401.419] (-1405.198) * [-1396.590] (-1405.836) (-1399.942) (-1400.792) -- 0:00:39
752500 -- [-1397.458] (-1399.192) (-1398.811) (-1398.196) * (-1400.666) (-1404.328) [-1397.737] (-1401.295) -- 0:00:39
753000 -- (-1396.822) [-1401.011] (-1400.669) (-1403.557) * (-1396.822) (-1403.980) (-1404.267) [-1400.243] -- 0:00:39
753500 -- (-1399.128) [-1408.248] (-1401.764) (-1404.229) * (-1402.083) (-1400.629) (-1403.945) [-1402.364] -- 0:00:39
754000 -- [-1397.308] (-1403.507) (-1401.174) (-1403.189) * [-1399.558] (-1411.384) (-1410.294) (-1397.714) -- 0:00:39
754500 -- (-1401.023) (-1407.049) [-1405.239] (-1399.230) * (-1405.834) (-1397.246) (-1406.734) [-1399.397] -- 0:00:39
755000 -- (-1396.333) (-1399.004) [-1396.672] (-1404.137) * (-1397.940) [-1398.147] (-1402.826) (-1397.039) -- 0:00:39
Average standard deviation of split frequencies: 0.006859
755500 -- (-1398.465) [-1397.816] (-1401.930) (-1399.685) * (-1401.774) (-1395.741) [-1398.941] (-1397.667) -- 0:00:39
756000 -- (-1405.544) (-1397.703) [-1399.969] (-1400.486) * (-1400.701) [-1399.147] (-1407.082) (-1402.539) -- 0:00:39
756500 -- (-1407.042) (-1400.701) (-1398.014) [-1402.610] * [-1398.816] (-1402.136) (-1401.550) (-1402.729) -- 0:00:38
757000 -- (-1409.307) [-1398.511] (-1398.567) (-1404.513) * (-1397.173) [-1403.434] (-1404.799) (-1395.983) -- 0:00:38
757500 -- (-1402.542) [-1398.244] (-1399.990) (-1403.613) * (-1404.420) [-1395.746] (-1407.163) (-1399.081) -- 0:00:38
758000 -- (-1402.013) (-1397.382) (-1392.720) [-1399.441] * [-1396.834] (-1402.089) (-1399.626) (-1398.910) -- 0:00:38
758500 -- (-1401.401) (-1407.806) [-1397.867] (-1403.706) * (-1406.793) (-1409.993) (-1404.397) [-1394.451] -- 0:00:38
759000 -- (-1404.353) (-1406.027) (-1398.383) [-1402.584] * (-1404.815) [-1400.563] (-1403.320) (-1396.872) -- 0:00:38
759500 -- [-1400.819] (-1397.399) (-1402.651) (-1401.191) * (-1402.651) (-1395.964) [-1396.768] (-1400.215) -- 0:00:38
760000 -- (-1405.735) (-1400.249) (-1402.308) [-1402.565] * (-1400.404) (-1404.149) [-1396.906] (-1399.663) -- 0:00:38
Average standard deviation of split frequencies: 0.007437
760500 -- (-1400.727) (-1398.879) (-1401.835) [-1398.118] * [-1401.098] (-1404.710) (-1396.213) (-1405.887) -- 0:00:38
761000 -- (-1397.941) (-1398.273) [-1396.410] (-1410.055) * (-1407.545) (-1408.028) [-1398.711] (-1397.387) -- 0:00:38
761500 -- (-1401.092) [-1400.074] (-1396.592) (-1409.062) * (-1402.229) (-1405.265) (-1401.257) [-1401.105] -- 0:00:38
762000 -- (-1397.380) (-1397.205) (-1397.751) [-1398.662] * (-1401.806) [-1398.761] (-1408.772) (-1405.420) -- 0:00:38
762500 -- (-1403.411) (-1400.088) [-1402.098] (-1403.020) * (-1404.581) [-1398.896] (-1409.168) (-1399.907) -- 0:00:38
763000 -- (-1403.435) [-1399.561] (-1398.686) (-1397.864) * (-1399.508) (-1405.708) [-1395.459] (-1401.851) -- 0:00:37
763500 -- [-1396.566] (-1395.557) (-1400.922) (-1402.888) * (-1396.054) (-1400.869) (-1400.338) [-1398.505] -- 0:00:37
764000 -- (-1400.019) [-1399.279] (-1397.552) (-1405.968) * (-1399.357) (-1401.267) [-1397.561] (-1397.839) -- 0:00:37
764500 -- [-1396.078] (-1401.121) (-1404.149) (-1400.217) * [-1404.315] (-1397.176) (-1409.281) (-1400.770) -- 0:00:37
765000 -- [-1397.402] (-1401.256) (-1407.642) (-1397.452) * (-1397.756) (-1397.806) (-1396.931) [-1396.743] -- 0:00:37
Average standard deviation of split frequencies: 0.007693
765500 -- (-1398.475) (-1399.765) [-1395.350] (-1397.034) * (-1400.118) (-1410.305) [-1397.401] (-1403.563) -- 0:00:37
766000 -- (-1403.505) (-1397.289) [-1396.579] (-1401.079) * [-1397.849] (-1402.694) (-1403.465) (-1403.159) -- 0:00:37
766500 -- (-1403.548) [-1400.919] (-1398.340) (-1402.430) * (-1402.028) [-1401.581] (-1400.870) (-1398.275) -- 0:00:37
767000 -- (-1401.507) (-1402.029) [-1399.137] (-1397.637) * (-1409.483) (-1398.759) [-1395.306] (-1398.410) -- 0:00:37
767500 -- (-1403.692) [-1399.157] (-1401.642) (-1395.633) * [-1407.088] (-1397.839) (-1399.451) (-1401.242) -- 0:00:37
768000 -- [-1398.609] (-1398.564) (-1401.408) (-1401.552) * (-1406.007) (-1401.250) (-1404.284) [-1397.792] -- 0:00:37
768500 -- (-1406.496) (-1398.008) [-1402.929] (-1400.549) * (-1407.152) (-1400.027) (-1396.809) [-1395.052] -- 0:00:37
769000 -- (-1396.052) (-1404.990) (-1396.424) [-1396.809] * [-1402.304] (-1401.877) (-1397.091) (-1397.820) -- 0:00:36
769500 -- [-1395.423] (-1402.033) (-1399.117) (-1400.904) * (-1406.123) (-1399.728) (-1402.491) [-1400.340] -- 0:00:36
770000 -- (-1396.982) (-1406.341) (-1400.644) [-1401.516] * (-1408.963) (-1403.319) (-1398.785) [-1397.475] -- 0:00:36
Average standard deviation of split frequencies: 0.007034
770500 -- (-1397.364) (-1398.787) (-1400.124) [-1395.289] * (-1403.871) (-1405.424) (-1397.481) [-1397.328] -- 0:00:36
771000 -- (-1396.946) [-1401.590] (-1399.006) (-1398.578) * [-1401.772] (-1402.911) (-1406.602) (-1397.007) -- 0:00:36
771500 -- [-1397.694] (-1405.240) (-1405.851) (-1395.997) * (-1406.929) (-1404.077) [-1398.230] (-1401.876) -- 0:00:36
772000 -- (-1400.371) (-1405.891) (-1396.063) [-1396.758] * (-1404.422) (-1405.719) [-1398.851] (-1396.588) -- 0:00:36
772500 -- (-1402.011) (-1396.837) (-1397.134) [-1397.355] * [-1404.343] (-1399.802) (-1401.230) (-1396.059) -- 0:00:36
773000 -- [-1403.882] (-1402.900) (-1402.585) (-1400.700) * (-1402.436) (-1406.289) (-1402.507) [-1399.562] -- 0:00:36
773500 -- (-1403.993) (-1401.187) [-1394.598] (-1399.703) * [-1397.644] (-1409.511) (-1398.164) (-1398.519) -- 0:00:36
774000 -- (-1398.716) (-1401.554) [-1403.744] (-1402.731) * (-1396.249) (-1401.847) (-1409.467) [-1400.293] -- 0:00:36
774500 -- (-1394.678) [-1404.898] (-1398.389) (-1397.617) * (-1402.444) [-1396.559] (-1397.986) (-1396.567) -- 0:00:36
775000 -- (-1396.566) (-1398.665) (-1407.535) [-1400.562] * (-1398.756) [-1407.564] (-1412.629) (-1405.113) -- 0:00:36
Average standard deviation of split frequencies: 0.006986
775500 -- [-1395.922] (-1397.838) (-1403.801) (-1402.067) * (-1402.203) (-1400.974) (-1402.214) [-1398.264] -- 0:00:35
776000 -- (-1404.005) [-1393.873] (-1399.540) (-1400.355) * [-1404.697] (-1408.058) (-1400.394) (-1404.828) -- 0:00:35
776500 -- (-1395.295) (-1402.405) [-1399.871] (-1401.791) * (-1401.057) (-1400.108) (-1398.748) [-1396.251] -- 0:00:35
777000 -- [-1398.685] (-1398.030) (-1406.170) (-1403.377) * (-1404.031) [-1399.907] (-1397.275) (-1395.785) -- 0:00:35
777500 -- (-1399.835) (-1401.761) [-1397.490] (-1398.968) * [-1401.334] (-1400.352) (-1398.379) (-1396.632) -- 0:00:35
778000 -- (-1398.266) (-1396.796) (-1399.384) [-1397.034] * [-1396.546] (-1406.004) (-1396.878) (-1401.220) -- 0:00:35
778500 -- (-1401.795) (-1402.867) (-1403.621) [-1398.400] * (-1400.806) (-1402.456) (-1397.158) [-1398.189] -- 0:00:35
779000 -- (-1400.603) [-1402.940] (-1402.013) (-1399.746) * (-1401.140) (-1403.376) (-1404.117) [-1394.885] -- 0:00:35
779500 -- [-1397.693] (-1400.469) (-1396.724) (-1400.385) * (-1399.060) [-1404.124] (-1408.035) (-1403.487) -- 0:00:35
780000 -- [-1397.016] (-1402.145) (-1400.402) (-1403.949) * (-1399.348) (-1400.990) (-1416.646) [-1398.751] -- 0:00:35
Average standard deviation of split frequencies: 0.006340
780500 -- (-1396.210) (-1404.752) (-1401.015) [-1396.321] * (-1408.737) (-1408.283) [-1399.479] (-1400.046) -- 0:00:35
781000 -- [-1403.437] (-1399.363) (-1396.555) (-1397.884) * (-1398.418) [-1397.178] (-1405.735) (-1405.655) -- 0:00:35
781500 -- (-1394.628) [-1394.330] (-1404.996) (-1397.949) * [-1401.151] (-1398.175) (-1402.250) (-1401.792) -- 0:00:34
782000 -- [-1395.629] (-1395.479) (-1400.042) (-1399.947) * (-1401.132) [-1398.867] (-1400.566) (-1405.106) -- 0:00:34
782500 -- [-1396.917] (-1398.063) (-1396.730) (-1399.089) * (-1398.028) (-1402.764) [-1401.238] (-1408.208) -- 0:00:34
783000 -- (-1399.414) (-1400.059) [-1400.266] (-1401.232) * [-1396.698] (-1402.314) (-1398.998) (-1414.307) -- 0:00:34
783500 -- [-1396.183] (-1399.773) (-1399.188) (-1396.724) * [-1405.592] (-1399.911) (-1401.634) (-1406.707) -- 0:00:34
784000 -- (-1400.254) [-1400.645] (-1413.283) (-1404.977) * (-1398.288) (-1403.660) (-1401.804) [-1399.973] -- 0:00:34
784500 -- (-1397.871) (-1397.904) (-1403.687) [-1394.861] * (-1397.809) (-1400.467) (-1403.160) [-1399.968] -- 0:00:34
785000 -- (-1398.974) (-1397.346) [-1398.279] (-1402.722) * [-1400.364] (-1403.619) (-1403.476) (-1406.955) -- 0:00:34
Average standard deviation of split frequencies: 0.006597
785500 -- [-1398.115] (-1398.527) (-1399.296) (-1400.391) * (-1398.123) (-1404.833) (-1399.654) [-1402.243] -- 0:00:34
786000 -- (-1401.386) (-1403.524) (-1403.506) [-1398.891] * [-1398.772] (-1401.715) (-1400.474) (-1396.622) -- 0:00:34
786500 -- [-1396.136] (-1404.544) (-1397.271) (-1397.635) * (-1398.890) (-1403.262) [-1400.062] (-1398.042) -- 0:00:34
787000 -- (-1400.759) (-1410.939) (-1407.238) [-1404.140] * (-1404.663) (-1395.683) [-1398.565] (-1400.419) -- 0:00:34
787500 -- (-1406.366) (-1409.763) [-1400.329] (-1403.641) * [-1400.996] (-1401.508) (-1396.077) (-1398.324) -- 0:00:34
788000 -- (-1401.450) (-1406.609) (-1404.096) [-1397.934] * (-1399.754) [-1398.312] (-1400.067) (-1401.980) -- 0:00:33
788500 -- (-1398.545) (-1410.010) (-1396.543) [-1396.680] * (-1409.953) (-1402.753) (-1402.354) [-1406.588] -- 0:00:33
789000 -- [-1396.764] (-1402.028) (-1403.265) (-1398.306) * (-1406.437) (-1403.615) [-1397.366] (-1398.783) -- 0:00:33
789500 -- [-1397.135] (-1399.596) (-1403.625) (-1396.258) * [-1405.992] (-1404.572) (-1397.050) (-1403.093) -- 0:00:33
790000 -- (-1406.686) (-1400.136) [-1402.546] (-1398.734) * (-1400.367) [-1404.440] (-1398.906) (-1401.402) -- 0:00:33
Average standard deviation of split frequencies: 0.005962
790500 -- [-1401.963] (-1402.424) (-1404.344) (-1397.755) * (-1400.749) (-1405.944) [-1397.800] (-1408.405) -- 0:00:33
791000 -- (-1405.394) (-1399.593) [-1400.411] (-1396.019) * (-1404.293) [-1394.247] (-1406.379) (-1407.511) -- 0:00:33
791500 -- (-1407.403) (-1399.702) [-1398.065] (-1405.235) * (-1405.132) (-1396.468) [-1400.416] (-1405.368) -- 0:00:33
792000 -- (-1402.241) (-1405.815) [-1398.745] (-1397.216) * (-1399.792) [-1397.988] (-1399.369) (-1404.160) -- 0:00:33
792500 -- (-1407.365) (-1402.897) [-1401.861] (-1398.419) * [-1399.799] (-1399.547) (-1401.574) (-1410.454) -- 0:00:33
793000 -- (-1403.792) [-1397.390] (-1399.361) (-1401.469) * (-1399.550) (-1397.421) [-1398.222] (-1402.311) -- 0:00:33
793500 -- [-1406.688] (-1396.149) (-1400.573) (-1409.931) * (-1399.537) (-1402.655) (-1397.110) [-1404.920] -- 0:00:33
794000 -- [-1402.373] (-1400.089) (-1398.336) (-1403.502) * (-1399.482) (-1399.000) (-1399.894) [-1401.792] -- 0:00:32
794500 -- (-1417.608) [-1397.528] (-1395.829) (-1397.807) * (-1397.291) (-1403.042) (-1397.466) [-1400.996] -- 0:00:32
795000 -- (-1408.103) (-1395.257) (-1398.510) [-1399.324] * [-1402.826] (-1400.954) (-1400.551) (-1403.736) -- 0:00:32
Average standard deviation of split frequencies: 0.007107
795500 -- (-1406.140) [-1401.505] (-1401.584) (-1398.880) * [-1399.243] (-1400.381) (-1401.424) (-1395.761) -- 0:00:32
796000 -- (-1399.994) (-1398.046) [-1403.124] (-1404.553) * (-1399.937) (-1405.613) (-1405.817) [-1399.193] -- 0:00:32
796500 -- (-1396.555) (-1404.405) [-1399.688] (-1395.385) * (-1399.499) (-1403.298) (-1401.285) [-1399.352] -- 0:00:32
797000 -- (-1405.479) [-1399.360] (-1405.723) (-1404.676) * (-1404.324) (-1394.906) (-1403.717) [-1399.415] -- 0:00:32
797500 -- (-1399.081) (-1401.683) (-1401.822) [-1398.089] * (-1400.921) [-1400.739] (-1402.917) (-1401.934) -- 0:00:32
798000 -- (-1399.705) [-1398.020] (-1407.447) (-1399.748) * (-1400.088) (-1402.875) (-1408.543) [-1402.009] -- 0:00:32
798500 -- [-1395.596] (-1395.922) (-1403.008) (-1398.430) * (-1404.270) [-1401.122] (-1398.889) (-1402.764) -- 0:00:32
799000 -- (-1399.037) [-1401.509] (-1402.048) (-1402.577) * [-1401.007] (-1399.093) (-1404.653) (-1399.738) -- 0:00:32
799500 -- (-1405.395) [-1395.188] (-1412.887) (-1402.473) * (-1398.608) (-1403.514) [-1399.489] (-1398.111) -- 0:00:32
800000 -- (-1399.760) [-1397.157] (-1402.340) (-1405.811) * (-1403.507) (-1408.562) (-1407.019) [-1401.137] -- 0:00:32
Average standard deviation of split frequencies: 0.006771
800500 -- (-1403.999) (-1402.230) [-1400.827] (-1400.764) * (-1396.263) (-1403.138) (-1398.180) [-1396.557] -- 0:00:31
801000 -- [-1396.750] (-1402.261) (-1399.844) (-1404.042) * (-1398.898) (-1396.059) (-1406.744) [-1403.089] -- 0:00:31
801500 -- (-1402.758) (-1407.766) [-1396.661] (-1398.037) * (-1404.729) [-1402.809] (-1401.989) (-1398.905) -- 0:00:31
802000 -- (-1398.132) (-1400.455) (-1396.383) [-1393.425] * [-1403.860] (-1399.439) (-1406.201) (-1399.710) -- 0:00:31
802500 -- (-1397.755) (-1408.194) (-1398.498) [-1401.765] * (-1399.944) [-1399.341] (-1403.646) (-1408.549) -- 0:00:31
803000 -- (-1396.018) (-1399.938) (-1399.983) [-1400.308] * (-1399.358) [-1396.116] (-1405.914) (-1402.996) -- 0:00:31
803500 -- (-1400.572) (-1396.713) (-1397.652) [-1394.740] * (-1402.465) [-1397.308] (-1401.541) (-1401.514) -- 0:00:31
804000 -- (-1399.651) (-1399.062) [-1400.864] (-1403.484) * [-1402.159] (-1400.645) (-1398.762) (-1394.704) -- 0:00:31
804500 -- [-1398.708] (-1397.292) (-1399.151) (-1399.627) * (-1396.489) (-1396.736) [-1404.994] (-1396.834) -- 0:00:31
805000 -- (-1397.509) [-1400.189] (-1403.377) (-1403.900) * (-1396.743) (-1394.606) (-1396.741) [-1399.608] -- 0:00:31
Average standard deviation of split frequencies: 0.006434
805500 -- (-1403.691) (-1399.898) (-1399.014) [-1398.952] * (-1402.041) (-1396.476) (-1397.355) [-1399.292] -- 0:00:31
806000 -- (-1401.778) (-1398.092) [-1395.522] (-1399.437) * (-1399.904) (-1399.290) [-1394.875] (-1403.841) -- 0:00:31
806500 -- (-1398.824) (-1400.522) [-1398.943] (-1404.030) * (-1401.354) (-1399.122) [-1393.811] (-1401.774) -- 0:00:30
807000 -- (-1404.663) (-1399.871) (-1402.656) [-1402.387] * (-1399.520) (-1398.519) (-1399.967) [-1399.809] -- 0:00:30
807500 -- (-1396.998) (-1395.676) (-1396.831) [-1401.086] * (-1400.617) (-1400.093) [-1401.293] (-1402.394) -- 0:00:30
808000 -- (-1399.375) (-1405.450) (-1400.002) [-1399.196] * [-1396.547] (-1398.954) (-1403.796) (-1405.403) -- 0:00:30
808500 -- [-1396.414] (-1403.809) (-1402.877) (-1396.013) * (-1395.191) [-1402.110] (-1398.469) (-1400.273) -- 0:00:30
809000 -- (-1400.204) (-1399.416) (-1404.537) [-1402.926] * [-1397.799] (-1400.867) (-1404.675) (-1401.418) -- 0:00:30
809500 -- (-1404.036) (-1401.597) (-1397.574) [-1397.418] * (-1403.393) (-1398.862) (-1400.839) [-1398.048] -- 0:00:30
810000 -- (-1407.591) (-1399.237) [-1401.926] (-1397.756) * (-1397.323) [-1395.646] (-1396.485) (-1403.457) -- 0:00:30
Average standard deviation of split frequencies: 0.006687
810500 -- [-1403.805] (-1400.246) (-1403.411) (-1401.397) * (-1400.442) (-1394.685) (-1398.778) [-1403.698] -- 0:00:30
811000 -- [-1397.218] (-1399.940) (-1398.581) (-1396.860) * (-1397.893) (-1398.018) [-1396.252] (-1398.523) -- 0:00:30
811500 -- (-1398.131) [-1400.452] (-1405.779) (-1398.747) * [-1406.721] (-1400.476) (-1398.695) (-1407.971) -- 0:00:30
812000 -- (-1398.345) (-1402.519) (-1401.220) [-1396.801] * (-1411.072) (-1398.078) [-1399.139] (-1396.461) -- 0:00:30
812500 -- [-1398.353] (-1400.785) (-1399.340) (-1398.787) * (-1404.139) (-1402.682) [-1400.137] (-1395.622) -- 0:00:30
813000 -- (-1403.124) (-1401.633) (-1400.104) [-1393.918] * [-1403.098] (-1401.405) (-1396.185) (-1402.970) -- 0:00:29
813500 -- [-1397.837] (-1399.152) (-1407.532) (-1400.558) * (-1405.819) (-1402.039) (-1403.684) [-1399.547] -- 0:00:29
814000 -- (-1400.248) (-1402.098) (-1403.123) [-1398.878] * (-1403.312) (-1404.222) [-1400.265] (-1401.299) -- 0:00:29
814500 -- [-1405.182] (-1400.652) (-1403.897) (-1398.137) * (-1399.810) (-1398.215) (-1403.161) [-1398.499] -- 0:00:29
815000 -- (-1404.927) [-1398.162] (-1403.520) (-1397.493) * [-1401.268] (-1401.606) (-1396.195) (-1404.878) -- 0:00:29
Average standard deviation of split frequencies: 0.006932
815500 -- [-1403.275] (-1401.838) (-1400.060) (-1396.783) * (-1405.232) (-1404.910) (-1405.091) [-1400.239] -- 0:00:29
816000 -- [-1398.935] (-1400.239) (-1395.339) (-1405.198) * (-1413.746) (-1404.681) (-1405.801) [-1394.771] -- 0:00:29
816500 -- (-1404.327) (-1400.635) [-1402.852] (-1400.456) * (-1403.014) (-1407.187) (-1405.104) [-1400.340] -- 0:00:29
817000 -- (-1401.293) [-1400.229] (-1403.941) (-1397.613) * (-1398.841) (-1402.486) [-1397.800] (-1401.180) -- 0:00:29
817500 -- (-1401.809) (-1396.875) [-1399.043] (-1397.213) * (-1402.077) (-1401.266) [-1399.474] (-1404.050) -- 0:00:29
818000 -- (-1400.397) (-1400.090) [-1397.520] (-1398.693) * (-1400.802) [-1397.433] (-1402.507) (-1397.360) -- 0:00:29
818500 -- (-1398.010) (-1397.841) (-1397.818) [-1398.318] * (-1411.822) [-1399.096] (-1401.211) (-1399.700) -- 0:00:29
819000 -- (-1401.961) (-1400.034) [-1395.718] (-1404.010) * (-1400.491) (-1397.627) [-1396.515] (-1403.599) -- 0:00:28
819500 -- (-1398.768) (-1399.276) (-1402.120) [-1398.644] * [-1400.185] (-1398.845) (-1396.953) (-1406.195) -- 0:00:28
820000 -- (-1405.626) (-1401.085) (-1403.996) [-1398.923] * (-1397.999) (-1398.903) (-1403.881) [-1400.624] -- 0:00:28
Average standard deviation of split frequencies: 0.006893
820500 -- (-1399.639) (-1401.446) (-1401.588) [-1397.037] * (-1408.029) (-1397.985) [-1407.148] (-1394.745) -- 0:00:28
821000 -- [-1399.218] (-1402.205) (-1406.332) (-1399.941) * (-1401.933) (-1402.224) (-1402.849) [-1395.503] -- 0:00:28
821500 -- (-1402.607) (-1402.504) (-1406.404) [-1406.102] * (-1399.829) (-1403.881) [-1396.893] (-1403.086) -- 0:00:28
822000 -- (-1400.086) (-1405.037) (-1400.943) [-1397.386] * (-1403.847) (-1402.086) (-1399.018) [-1395.488] -- 0:00:28
822500 -- (-1396.864) [-1401.311] (-1399.016) (-1401.746) * (-1399.714) (-1400.092) (-1407.040) [-1392.573] -- 0:00:28
823000 -- (-1400.381) [-1399.678] (-1401.640) (-1403.890) * (-1403.251) (-1409.925) [-1402.147] (-1402.148) -- 0:00:28
823500 -- [-1400.862] (-1401.909) (-1397.856) (-1401.110) * (-1400.625) (-1403.372) (-1395.944) [-1397.369] -- 0:00:28
824000 -- (-1399.155) [-1402.673] (-1397.573) (-1399.063) * (-1401.538) [-1395.822] (-1397.385) (-1399.514) -- 0:00:28
824500 -- (-1398.392) (-1400.615) (-1398.931) [-1398.564] * (-1398.743) [-1398.597] (-1400.487) (-1405.939) -- 0:00:28
825000 -- (-1397.247) [-1401.207] (-1403.595) (-1394.948) * (-1401.402) (-1401.084) [-1403.681] (-1400.572) -- 0:00:28
Average standard deviation of split frequencies: 0.007419
825500 -- (-1403.394) [-1401.393] (-1402.401) (-1403.202) * (-1405.439) (-1402.129) [-1404.634] (-1402.401) -- 0:00:27
826000 -- (-1401.619) [-1398.359] (-1403.512) (-1406.855) * (-1400.271) [-1393.891] (-1398.829) (-1407.320) -- 0:00:27
826500 -- (-1401.011) (-1395.074) (-1395.770) [-1400.195] * (-1404.452) [-1393.762] (-1410.182) (-1395.718) -- 0:00:27
827000 -- [-1400.673] (-1398.326) (-1396.764) (-1399.045) * (-1400.270) (-1402.435) (-1407.230) [-1397.960] -- 0:00:27
827500 -- (-1398.954) (-1399.026) (-1401.602) [-1398.044] * (-1407.190) (-1395.747) [-1399.855] (-1400.080) -- 0:00:27
828000 -- [-1401.815] (-1403.585) (-1404.087) (-1396.124) * (-1399.939) (-1396.903) (-1401.303) [-1393.511] -- 0:00:27
828500 -- (-1396.988) (-1404.004) [-1402.313] (-1400.392) * (-1398.267) (-1403.687) [-1402.529] (-1405.885) -- 0:00:27
829000 -- (-1402.435) (-1401.378) [-1395.616] (-1396.295) * (-1397.720) [-1396.146] (-1410.167) (-1402.785) -- 0:00:27
829500 -- (-1396.912) (-1399.745) [-1396.668] (-1396.674) * [-1402.575] (-1399.362) (-1403.831) (-1407.558) -- 0:00:27
830000 -- (-1399.802) (-1406.224) (-1399.377) [-1396.887] * (-1404.435) (-1410.471) (-1409.708) [-1397.761] -- 0:00:27
Average standard deviation of split frequencies: 0.006810
830500 -- (-1401.914) [-1399.435] (-1400.831) (-1399.943) * (-1396.911) [-1410.029] (-1416.471) (-1402.128) -- 0:00:27
831000 -- (-1404.024) (-1396.508) [-1399.262] (-1399.235) * (-1395.224) (-1412.739) (-1406.793) [-1400.515] -- 0:00:27
831500 -- (-1401.737) [-1398.218] (-1401.194) (-1401.596) * [-1395.818] (-1407.182) (-1404.752) (-1402.719) -- 0:00:26
832000 -- (-1406.338) (-1408.649) [-1402.726] (-1401.914) * (-1402.996) (-1410.987) (-1409.480) [-1398.412] -- 0:00:26
832500 -- (-1400.650) [-1402.685] (-1400.600) (-1399.660) * (-1405.387) (-1398.219) (-1403.897) [-1397.308] -- 0:00:26
833000 -- (-1402.548) (-1397.443) (-1400.739) [-1397.586] * (-1399.302) (-1401.153) [-1396.092] (-1398.060) -- 0:00:26
833500 -- (-1405.565) [-1396.484] (-1403.085) (-1398.280) * (-1395.662) (-1405.578) (-1398.611) [-1399.265] -- 0:00:26
834000 -- (-1401.094) [-1398.638] (-1405.937) (-1399.452) * [-1394.678] (-1404.617) (-1400.481) (-1406.841) -- 0:00:26
834500 -- (-1399.959) [-1397.375] (-1399.433) (-1401.099) * (-1399.709) (-1406.746) [-1401.860] (-1402.601) -- 0:00:26
835000 -- (-1400.823) (-1397.683) [-1397.582] (-1399.571) * (-1401.021) [-1404.296] (-1404.853) (-1400.316) -- 0:00:26
Average standard deviation of split frequencies: 0.006767
835500 -- (-1400.560) (-1405.987) (-1396.220) [-1402.587] * [-1402.938] (-1396.983) (-1408.876) (-1401.509) -- 0:00:26
836000 -- (-1399.497) (-1396.826) [-1404.581] (-1410.498) * (-1399.677) (-1402.861) [-1397.692] (-1401.984) -- 0:00:26
836500 -- (-1398.320) (-1395.668) [-1402.718] (-1401.576) * (-1404.962) (-1401.956) [-1404.153] (-1398.563) -- 0:00:26
837000 -- (-1400.346) [-1395.545] (-1394.880) (-1395.647) * (-1395.397) (-1394.796) (-1401.031) [-1400.987] -- 0:00:26
837500 -- (-1402.046) (-1403.056) (-1398.847) [-1397.193] * (-1398.080) (-1401.501) [-1398.398] (-1401.233) -- 0:00:26
838000 -- (-1399.846) (-1394.162) (-1399.551) [-1403.863] * (-1394.634) (-1398.687) (-1404.894) [-1403.413] -- 0:00:25
838500 -- (-1402.651) (-1399.557) [-1399.454] (-1401.987) * [-1396.304] (-1394.935) (-1403.119) (-1406.033) -- 0:00:25
839000 -- (-1399.488) (-1403.848) [-1402.940] (-1408.874) * (-1402.889) [-1394.477] (-1401.547) (-1404.327) -- 0:00:25
839500 -- [-1399.562] (-1405.519) (-1401.272) (-1401.562) * (-1400.692) [-1395.401] (-1402.462) (-1400.351) -- 0:00:25
840000 -- (-1402.956) [-1396.905] (-1405.974) (-1395.879) * (-1396.287) (-1403.873) (-1412.476) [-1404.468] -- 0:00:25
Average standard deviation of split frequencies: 0.008411
840500 -- (-1401.080) (-1399.366) (-1400.010) [-1394.603] * [-1394.212] (-1402.377) (-1411.927) (-1399.358) -- 0:00:25
841000 -- (-1408.111) (-1398.744) [-1397.707] (-1404.031) * (-1394.427) [-1398.246] (-1407.666) (-1398.523) -- 0:00:25
841500 -- (-1402.437) [-1407.054] (-1397.542) (-1399.177) * (-1398.205) (-1398.530) (-1406.962) [-1399.474] -- 0:00:25
842000 -- (-1400.194) (-1394.075) [-1399.844] (-1399.131) * (-1397.588) (-1404.045) (-1407.996) [-1404.093] -- 0:00:25
842500 -- (-1397.938) (-1398.665) (-1401.085) [-1401.090] * [-1393.955] (-1402.617) (-1411.523) (-1402.014) -- 0:00:25
843000 -- (-1407.743) (-1402.758) (-1405.985) [-1398.178] * (-1403.055) [-1397.928] (-1407.749) (-1404.330) -- 0:00:25
843500 -- [-1404.577] (-1398.134) (-1404.097) (-1400.924) * (-1402.704) [-1395.062] (-1407.337) (-1407.850) -- 0:00:25
844000 -- (-1399.529) [-1398.478] (-1404.262) (-1398.377) * (-1402.734) (-1402.421) (-1401.765) [-1400.157] -- 0:00:24
844500 -- [-1399.631] (-1399.824) (-1413.924) (-1401.490) * (-1402.238) [-1402.085] (-1398.468) (-1404.267) -- 0:00:24
845000 -- (-1402.235) (-1398.680) [-1401.101] (-1404.940) * [-1394.462] (-1399.339) (-1409.419) (-1401.461) -- 0:00:24
Average standard deviation of split frequencies: 0.007522
845500 -- (-1402.222) (-1397.117) (-1407.818) [-1395.239] * (-1400.364) (-1401.860) (-1405.572) [-1399.392] -- 0:00:24
846000 -- (-1404.339) (-1403.312) (-1401.058) [-1398.092] * (-1397.995) [-1397.281] (-1406.295) (-1407.915) -- 0:00:24
846500 -- [-1399.689] (-1397.957) (-1399.238) (-1401.079) * [-1399.599] (-1400.500) (-1408.689) (-1403.410) -- 0:00:24
847000 -- (-1399.029) (-1400.878) [-1398.916] (-1402.352) * [-1397.521] (-1415.467) (-1403.492) (-1405.654) -- 0:00:24
847500 -- (-1412.362) [-1394.890] (-1400.445) (-1398.435) * (-1403.389) [-1396.893] (-1403.513) (-1404.165) -- 0:00:24
848000 -- (-1400.444) [-1403.993] (-1396.034) (-1402.145) * (-1407.401) (-1404.750) (-1401.060) [-1400.671] -- 0:00:24
848500 -- [-1400.281] (-1397.454) (-1395.960) (-1408.359) * [-1399.454] (-1409.804) (-1405.025) (-1408.760) -- 0:00:24
849000 -- (-1402.959) [-1399.911] (-1394.774) (-1405.975) * (-1400.157) [-1402.504] (-1409.899) (-1408.692) -- 0:00:24
849500 -- (-1411.035) (-1396.165) [-1404.003] (-1400.726) * [-1397.691] (-1404.100) (-1397.237) (-1405.222) -- 0:00:24
850000 -- (-1399.862) [-1397.633] (-1403.444) (-1400.811) * (-1399.331) [-1403.435] (-1404.972) (-1412.813) -- 0:00:24
Average standard deviation of split frequencies: 0.006927
850500 -- (-1397.646) (-1397.240) [-1396.468] (-1400.655) * (-1395.736) [-1398.409] (-1400.805) (-1411.931) -- 0:00:23
851000 -- (-1406.168) (-1398.187) (-1402.901) [-1398.400] * (-1399.923) [-1399.401] (-1404.262) (-1412.854) -- 0:00:23
851500 -- (-1398.362) (-1396.115) [-1401.226] (-1403.820) * (-1401.265) (-1401.471) [-1402.502] (-1409.113) -- 0:00:23
852000 -- (-1394.991) (-1396.009) (-1404.924) [-1400.152] * [-1401.521] (-1404.135) (-1397.807) (-1398.546) -- 0:00:23
852500 -- (-1397.611) [-1398.367] (-1396.185) (-1397.729) * (-1400.409) (-1399.519) (-1399.998) [-1401.038] -- 0:00:23
853000 -- (-1400.396) (-1402.506) [-1399.391] (-1399.919) * (-1396.794) (-1395.910) (-1400.044) [-1398.261] -- 0:00:23
853500 -- (-1404.347) (-1395.965) (-1397.606) [-1394.755] * (-1399.249) (-1398.005) (-1407.577) [-1401.404] -- 0:00:23
854000 -- (-1402.762) (-1399.042) [-1398.930] (-1396.592) * (-1397.491) (-1396.599) (-1398.199) [-1396.801] -- 0:00:23
854500 -- [-1404.096] (-1404.962) (-1397.729) (-1403.752) * (-1396.215) (-1399.367) (-1400.388) [-1397.896] -- 0:00:23
855000 -- (-1408.546) (-1405.609) [-1397.181] (-1399.747) * (-1401.219) (-1399.074) (-1403.294) [-1395.641] -- 0:00:23
Average standard deviation of split frequencies: 0.007435
855500 -- (-1398.987) [-1395.620] (-1398.884) (-1402.260) * (-1398.677) (-1401.878) [-1396.008] (-1400.945) -- 0:00:23
856000 -- (-1400.655) (-1400.852) [-1401.747] (-1395.768) * [-1398.999] (-1411.390) (-1398.354) (-1396.102) -- 0:00:23
856500 -- (-1402.351) (-1402.702) (-1398.032) [-1396.729] * (-1404.990) (-1406.530) (-1402.048) [-1398.761] -- 0:00:22
857000 -- [-1398.924] (-1400.403) (-1394.062) (-1398.948) * (-1403.177) (-1399.196) (-1399.815) [-1395.935] -- 0:00:22
857500 -- (-1401.764) (-1398.569) [-1394.630] (-1398.690) * [-1399.163] (-1397.352) (-1406.591) (-1395.903) -- 0:00:22
858000 -- (-1401.346) (-1399.828) (-1398.150) [-1396.523] * (-1398.972) [-1404.267] (-1404.448) (-1402.250) -- 0:00:22
858500 -- (-1407.384) (-1401.505) (-1398.555) [-1401.062] * (-1406.762) (-1396.904) [-1404.210] (-1403.204) -- 0:00:22
859000 -- (-1400.224) (-1399.461) [-1405.441] (-1406.106) * (-1404.168) (-1409.186) (-1404.398) [-1399.490] -- 0:00:22
859500 -- [-1400.453] (-1401.554) (-1398.316) (-1404.633) * [-1402.084] (-1403.794) (-1404.201) (-1409.199) -- 0:00:22
860000 -- [-1403.568] (-1394.404) (-1406.531) (-1405.565) * (-1403.455) (-1408.904) [-1398.640] (-1404.762) -- 0:00:22
Average standard deviation of split frequencies: 0.006573
860500 -- (-1400.234) (-1401.146) [-1401.681] (-1400.236) * (-1404.725) [-1401.322] (-1397.134) (-1402.870) -- 0:00:22
861000 -- (-1407.081) (-1401.702) (-1400.124) [-1404.792] * (-1404.229) (-1396.824) [-1400.641] (-1413.794) -- 0:00:22
861500 -- (-1398.763) (-1400.329) [-1401.221] (-1407.372) * (-1402.540) (-1403.159) [-1400.132] (-1407.824) -- 0:00:22
862000 -- [-1402.893] (-1402.618) (-1399.934) (-1398.442) * [-1399.073] (-1399.372) (-1409.627) (-1399.913) -- 0:00:22
862500 -- (-1400.580) (-1413.109) (-1402.147) [-1398.689] * (-1398.868) [-1398.367] (-1407.182) (-1403.460) -- 0:00:22
863000 -- (-1408.620) (-1401.254) (-1401.501) [-1403.910] * (-1402.653) [-1396.874] (-1400.161) (-1399.841) -- 0:00:21
863500 -- (-1408.414) [-1404.115] (-1402.084) (-1402.262) * (-1402.229) (-1400.371) [-1395.197] (-1399.019) -- 0:00:21
864000 -- (-1403.794) (-1402.350) (-1396.952) [-1395.511] * [-1402.630] (-1401.377) (-1395.497) (-1401.438) -- 0:00:21
864500 -- [-1399.898] (-1408.455) (-1398.873) (-1401.027) * (-1405.256) (-1405.999) (-1401.917) [-1397.638] -- 0:00:21
865000 -- (-1401.676) (-1405.482) [-1398.669] (-1396.565) * (-1412.339) (-1396.256) [-1396.136] (-1399.866) -- 0:00:21
Average standard deviation of split frequencies: 0.007077
865500 -- (-1400.783) (-1404.918) [-1399.805] (-1397.459) * (-1411.810) [-1394.753] (-1398.883) (-1404.801) -- 0:00:21
866000 -- (-1401.477) (-1400.334) [-1393.728] (-1395.295) * (-1413.728) [-1397.003] (-1401.579) (-1401.239) -- 0:00:21
866500 -- (-1405.862) (-1408.636) (-1396.831) [-1395.686] * (-1411.631) (-1399.612) [-1398.787] (-1400.068) -- 0:00:21
867000 -- [-1400.181] (-1398.888) (-1399.523) (-1398.243) * (-1413.886) [-1398.045] (-1396.149) (-1400.593) -- 0:00:21
867500 -- [-1401.925] (-1398.702) (-1398.817) (-1397.899) * (-1402.294) [-1399.245] (-1395.726) (-1400.559) -- 0:00:21
868000 -- [-1395.099] (-1409.542) (-1401.025) (-1397.961) * (-1400.512) (-1402.988) [-1406.145] (-1397.985) -- 0:00:21
868500 -- (-1394.698) [-1399.520] (-1406.064) (-1400.580) * (-1404.629) (-1403.918) (-1405.198) [-1408.456] -- 0:00:21
869000 -- [-1401.860] (-1398.439) (-1398.574) (-1401.614) * [-1400.743] (-1398.133) (-1396.503) (-1394.138) -- 0:00:20
869500 -- [-1399.007] (-1399.126) (-1397.481) (-1404.869) * (-1400.407) (-1401.220) (-1397.599) [-1398.921] -- 0:00:20
870000 -- (-1403.656) (-1402.402) [-1396.861] (-1404.827) * (-1405.648) (-1398.622) (-1402.808) [-1400.125] -- 0:00:20
Average standard deviation of split frequencies: 0.007580
870500 -- (-1404.138) (-1400.967) [-1398.460] (-1401.810) * (-1403.503) (-1403.257) [-1398.321] (-1396.224) -- 0:00:20
871000 -- (-1398.084) (-1396.100) [-1398.070] (-1401.540) * [-1397.583] (-1401.435) (-1399.234) (-1400.686) -- 0:00:20
871500 -- (-1403.564) (-1400.383) (-1400.129) [-1399.949] * (-1401.780) (-1397.374) (-1399.426) [-1399.202] -- 0:00:20
872000 -- [-1399.986] (-1401.003) (-1402.381) (-1394.213) * [-1397.554] (-1404.602) (-1398.275) (-1403.689) -- 0:00:20
872500 -- [-1402.418] (-1396.776) (-1404.835) (-1404.204) * (-1396.354) [-1396.757] (-1396.457) (-1398.243) -- 0:00:20
873000 -- [-1401.413] (-1399.198) (-1409.398) (-1404.598) * [-1392.438] (-1397.745) (-1400.005) (-1397.436) -- 0:00:20
873500 -- (-1401.188) (-1404.426) (-1408.942) [-1395.274] * (-1397.349) (-1400.801) [-1400.097] (-1402.170) -- 0:00:20
874000 -- [-1400.566] (-1405.732) (-1401.835) (-1402.461) * (-1403.729) (-1402.108) [-1400.282] (-1402.354) -- 0:00:20
874500 -- (-1406.302) (-1402.579) [-1395.185] (-1398.527) * (-1398.553) (-1397.262) [-1401.911] (-1401.029) -- 0:00:20
875000 -- (-1401.775) (-1398.976) (-1402.994) [-1396.809] * (-1402.852) [-1394.519] (-1400.975) (-1399.125) -- 0:00:20
Average standard deviation of split frequencies: 0.006458
875500 -- (-1407.095) (-1400.368) (-1398.640) [-1398.570] * (-1403.994) (-1401.485) (-1409.280) [-1395.522] -- 0:00:19
876000 -- (-1408.273) [-1401.190] (-1401.111) (-1400.398) * (-1404.562) (-1400.226) (-1408.238) [-1396.566] -- 0:00:19
876500 -- (-1400.025) (-1402.784) (-1400.016) [-1400.209] * (-1402.378) [-1405.361] (-1409.497) (-1396.142) -- 0:00:19
877000 -- [-1405.043] (-1405.209) (-1395.849) (-1405.086) * (-1410.465) [-1397.155] (-1404.515) (-1402.585) -- 0:00:19
877500 -- (-1403.019) [-1397.226] (-1397.149) (-1398.204) * (-1400.407) [-1398.932] (-1409.452) (-1397.834) -- 0:00:19
878000 -- (-1407.220) [-1398.727] (-1409.060) (-1398.804) * (-1402.016) [-1400.657] (-1405.812) (-1400.401) -- 0:00:19
878500 -- (-1399.320) [-1398.822] (-1403.912) (-1399.300) * (-1405.890) [-1399.178] (-1399.977) (-1399.533) -- 0:00:19
879000 -- (-1399.496) [-1397.322] (-1402.641) (-1401.722) * (-1410.767) [-1395.049] (-1399.656) (-1398.059) -- 0:00:19
879500 -- (-1401.035) (-1401.092) [-1399.676] (-1403.797) * (-1396.301) (-1398.578) (-1399.020) [-1397.135] -- 0:00:19
880000 -- [-1398.620] (-1397.149) (-1403.864) (-1403.133) * (-1402.965) (-1406.458) [-1398.692] (-1404.254) -- 0:00:19
Average standard deviation of split frequencies: 0.006156
880500 -- (-1401.958) (-1398.828) [-1403.123] (-1400.756) * (-1404.544) [-1400.076] (-1398.240) (-1407.703) -- 0:00:19
881000 -- (-1401.451) [-1400.229] (-1400.373) (-1403.878) * [-1406.639] (-1404.421) (-1402.047) (-1404.580) -- 0:00:19
881500 -- (-1402.957) (-1400.182) (-1406.740) [-1400.814] * (-1408.329) [-1397.088] (-1402.349) (-1402.458) -- 0:00:18
882000 -- [-1397.165] (-1401.332) (-1408.707) (-1403.832) * [-1400.400] (-1402.885) (-1402.049) (-1401.115) -- 0:00:18
882500 -- [-1404.031] (-1394.186) (-1406.434) (-1400.791) * (-1394.744) (-1408.263) [-1401.418] (-1398.478) -- 0:00:18
883000 -- [-1399.953] (-1404.407) (-1399.560) (-1404.879) * (-1400.227) (-1403.393) (-1400.041) [-1397.258] -- 0:00:18
883500 -- [-1397.272] (-1402.033) (-1397.147) (-1399.249) * [-1402.015] (-1402.771) (-1395.756) (-1404.851) -- 0:00:18
884000 -- [-1396.064] (-1405.407) (-1397.916) (-1403.132) * [-1397.660] (-1405.352) (-1400.621) (-1399.190) -- 0:00:18
884500 -- (-1397.571) [-1402.869] (-1395.336) (-1398.884) * [-1396.174] (-1411.582) (-1403.343) (-1397.427) -- 0:00:18
885000 -- (-1408.318) (-1403.664) (-1396.495) [-1402.908] * (-1398.702) (-1402.945) (-1399.645) [-1400.012] -- 0:00:18
Average standard deviation of split frequencies: 0.006119
885500 -- [-1404.518] (-1400.067) (-1396.210) (-1396.860) * (-1406.778) (-1400.011) [-1397.148] (-1402.138) -- 0:00:18
886000 -- [-1403.632] (-1398.952) (-1397.660) (-1402.671) * (-1405.404) [-1399.833] (-1402.712) (-1402.317) -- 0:00:18
886500 -- (-1410.779) (-1395.429) [-1400.788] (-1404.981) * (-1396.505) [-1395.780] (-1398.486) (-1404.155) -- 0:00:18
887000 -- (-1415.605) [-1397.364] (-1403.402) (-1403.334) * (-1403.549) [-1399.261] (-1400.524) (-1401.157) -- 0:00:18
887500 -- [-1399.699] (-1396.611) (-1401.756) (-1405.704) * (-1397.413) [-1401.283] (-1398.788) (-1409.228) -- 0:00:18
888000 -- (-1399.145) [-1401.226] (-1399.836) (-1405.734) * (-1403.677) [-1397.755] (-1404.871) (-1407.917) -- 0:00:17
888500 -- [-1402.084] (-1413.453) (-1404.310) (-1407.907) * [-1398.344] (-1403.159) (-1396.552) (-1404.360) -- 0:00:17
889000 -- (-1407.736) (-1397.070) [-1400.998] (-1411.197) * (-1400.869) [-1400.033] (-1401.014) (-1406.444) -- 0:00:17
889500 -- [-1400.677] (-1397.584) (-1398.725) (-1409.517) * (-1409.627) (-1400.083) [-1397.706] (-1395.899) -- 0:00:17
890000 -- [-1399.775] (-1406.813) (-1400.474) (-1405.994) * (-1403.057) (-1403.065) (-1398.259) [-1395.656] -- 0:00:17
Average standard deviation of split frequencies: 0.005557
890500 -- [-1402.664] (-1395.666) (-1399.621) (-1400.725) * [-1402.189] (-1396.160) (-1400.638) (-1397.909) -- 0:00:17
891000 -- (-1405.016) (-1396.077) (-1402.664) [-1399.046] * (-1402.419) (-1394.092) [-1403.293] (-1398.689) -- 0:00:17
891500 -- (-1405.588) (-1395.553) [-1403.379] (-1395.657) * (-1401.785) (-1398.145) (-1399.896) [-1400.794] -- 0:00:17
892000 -- (-1398.049) [-1397.205] (-1402.683) (-1406.960) * (-1399.861) (-1409.543) [-1398.324] (-1398.457) -- 0:00:17
892500 -- [-1397.200] (-1401.232) (-1400.492) (-1405.363) * (-1399.393) (-1402.008) (-1400.474) [-1395.023] -- 0:00:17
893000 -- (-1397.793) [-1402.637] (-1399.422) (-1397.779) * [-1401.912] (-1398.144) (-1400.552) (-1398.915) -- 0:00:17
893500 -- (-1405.098) (-1400.506) [-1398.464] (-1400.996) * [-1401.232] (-1398.907) (-1408.142) (-1404.711) -- 0:00:17
894000 -- [-1399.638] (-1401.472) (-1404.997) (-1403.219) * (-1396.591) (-1402.519) (-1400.069) [-1395.938] -- 0:00:16
894500 -- (-1409.469) [-1397.182] (-1403.740) (-1399.465) * (-1396.599) (-1397.105) (-1397.256) [-1404.891] -- 0:00:16
895000 -- [-1405.273] (-1402.901) (-1402.080) (-1399.469) * [-1396.623] (-1398.447) (-1400.035) (-1396.526) -- 0:00:16
Average standard deviation of split frequencies: 0.006577
895500 -- (-1408.909) (-1402.206) (-1403.078) [-1400.502] * (-1401.136) (-1402.026) (-1400.729) [-1399.352] -- 0:00:16
896000 -- (-1399.440) [-1402.899] (-1402.327) (-1400.216) * (-1401.830) (-1404.888) [-1397.849] (-1404.940) -- 0:00:16
896500 -- [-1394.990] (-1409.611) (-1414.701) (-1402.110) * (-1397.903) (-1401.787) [-1402.413] (-1402.585) -- 0:00:16
897000 -- (-1404.104) (-1403.390) (-1398.898) [-1398.380] * (-1403.030) (-1403.369) (-1400.670) [-1397.035] -- 0:00:16
897500 -- (-1404.268) (-1399.761) [-1403.743] (-1403.324) * (-1406.313) (-1403.618) [-1397.571] (-1400.362) -- 0:00:16
898000 -- (-1399.452) (-1397.015) [-1399.497] (-1401.563) * (-1408.855) [-1402.801] (-1398.630) (-1405.086) -- 0:00:16
898500 -- (-1396.585) (-1397.447) (-1402.146) [-1402.050] * (-1401.300) (-1403.872) [-1398.635] (-1398.149) -- 0:00:16
899000 -- (-1396.205) (-1398.098) (-1400.571) [-1399.255] * (-1401.092) [-1401.666] (-1399.315) (-1396.840) -- 0:00:16
899500 -- (-1399.013) (-1396.910) [-1398.450] (-1403.721) * (-1401.898) (-1397.954) (-1401.718) [-1399.734] -- 0:00:16
900000 -- (-1400.881) (-1410.116) [-1398.314] (-1396.115) * [-1397.330] (-1400.144) (-1400.655) (-1399.016) -- 0:00:16
Average standard deviation of split frequencies: 0.006804
900500 -- (-1400.978) (-1399.757) [-1397.424] (-1406.284) * (-1401.563) (-1405.059) [-1399.762] (-1405.159) -- 0:00:15
901000 -- [-1402.954] (-1397.469) (-1400.955) (-1398.856) * (-1398.783) (-1409.559) (-1404.072) [-1403.150] -- 0:00:15
901500 -- [-1399.626] (-1404.657) (-1397.895) (-1395.583) * (-1401.497) (-1402.749) [-1398.109] (-1412.454) -- 0:00:15
902000 -- (-1400.416) (-1407.284) [-1396.519] (-1399.116) * (-1404.474) (-1405.353) (-1400.104) [-1395.165] -- 0:00:15
902500 -- (-1404.706) (-1406.018) [-1395.522] (-1408.738) * (-1401.687) (-1400.166) (-1397.321) [-1398.574] -- 0:00:15
903000 -- (-1405.594) (-1405.488) (-1396.863) [-1399.831] * (-1396.566) [-1402.335] (-1396.139) (-1399.690) -- 0:00:15
903500 -- (-1401.248) (-1401.453) (-1411.723) [-1399.764] * [-1400.110] (-1400.413) (-1398.439) (-1398.054) -- 0:00:15
904000 -- (-1401.850) [-1396.774] (-1398.252) (-1400.475) * (-1396.176) [-1400.415] (-1400.719) (-1396.197) -- 0:00:15
904500 -- (-1412.190) (-1397.556) [-1396.923] (-1398.089) * [-1401.620] (-1394.577) (-1404.558) (-1403.778) -- 0:00:15
905000 -- (-1402.540) (-1399.554) (-1401.356) [-1398.155] * (-1406.871) (-1397.616) [-1401.046] (-1401.764) -- 0:00:15
Average standard deviation of split frequencies: 0.006504
905500 -- (-1398.839) (-1400.547) (-1400.123) [-1403.140] * (-1397.958) (-1396.497) (-1401.705) [-1396.647] -- 0:00:15
906000 -- (-1403.418) (-1404.336) (-1404.804) [-1398.030] * (-1400.134) (-1399.447) (-1398.117) [-1398.536] -- 0:00:15
906500 -- [-1402.493] (-1398.824) (-1398.754) (-1396.876) * (-1396.846) (-1402.602) (-1399.984) [-1396.761] -- 0:00:14
907000 -- [-1399.865] (-1399.622) (-1395.380) (-1397.708) * (-1397.934) (-1403.281) [-1393.435] (-1402.719) -- 0:00:14
907500 -- (-1402.693) (-1401.788) (-1397.796) [-1397.710] * (-1397.569) (-1403.557) (-1400.191) [-1399.814] -- 0:00:14
908000 -- (-1402.648) [-1400.300] (-1398.258) (-1397.758) * (-1396.447) (-1402.807) (-1405.647) [-1396.569] -- 0:00:14
908500 -- (-1406.164) (-1400.588) [-1396.897] (-1400.913) * (-1402.454) (-1406.674) [-1401.874] (-1394.681) -- 0:00:14
909000 -- (-1399.036) (-1402.527) (-1398.150) [-1398.239] * (-1402.975) [-1399.134] (-1400.118) (-1399.617) -- 0:00:14
909500 -- (-1398.834) (-1398.579) [-1398.657] (-1399.093) * [-1397.652] (-1397.899) (-1403.071) (-1396.629) -- 0:00:14
910000 -- (-1396.971) [-1407.673] (-1406.890) (-1401.393) * (-1399.157) [-1398.443] (-1397.779) (-1408.803) -- 0:00:14
Average standard deviation of split frequencies: 0.005435
910500 -- [-1395.461] (-1403.253) (-1399.041) (-1400.715) * (-1400.612) (-1399.139) [-1400.671] (-1396.875) -- 0:00:14
911000 -- (-1396.565) (-1403.765) [-1408.195] (-1399.085) * (-1400.135) (-1399.341) (-1399.663) [-1397.038] -- 0:00:14
911500 -- (-1405.312) (-1396.982) [-1399.032] (-1397.434) * (-1400.328) (-1396.395) (-1396.546) [-1396.929] -- 0:00:14
912000 -- (-1399.506) [-1396.250] (-1400.838) (-1405.646) * (-1407.774) [-1396.546] (-1395.452) (-1401.723) -- 0:00:14
912500 -- (-1397.696) [-1396.362] (-1396.793) (-1397.310) * (-1402.610) (-1399.703) [-1394.381] (-1401.163) -- 0:00:14
913000 -- (-1397.227) [-1397.352] (-1399.464) (-1397.900) * (-1401.565) (-1402.205) (-1393.052) [-1400.491] -- 0:00:13
913500 -- (-1402.084) [-1404.476] (-1400.645) (-1396.227) * (-1399.921) (-1402.109) [-1402.907] (-1397.752) -- 0:00:13
914000 -- (-1398.337) (-1401.175) (-1403.726) [-1404.031] * (-1402.347) (-1405.613) [-1403.230] (-1402.766) -- 0:00:13
914500 -- (-1406.907) [-1398.131] (-1400.288) (-1401.380) * (-1399.744) [-1400.628] (-1399.218) (-1403.502) -- 0:00:13
915000 -- (-1399.331) (-1402.245) [-1402.916] (-1400.268) * (-1403.505) (-1402.068) [-1398.373] (-1409.314) -- 0:00:13
Average standard deviation of split frequencies: 0.005661
915500 -- (-1402.296) [-1408.312] (-1401.154) (-1402.720) * (-1411.732) [-1399.394] (-1399.975) (-1397.964) -- 0:00:13
916000 -- [-1397.852] (-1403.107) (-1400.310) (-1403.983) * (-1402.405) (-1401.068) [-1396.089] (-1403.220) -- 0:00:13
916500 -- [-1405.364] (-1402.581) (-1398.839) (-1402.288) * (-1407.047) (-1399.557) [-1397.125] (-1400.757) -- 0:00:13
917000 -- [-1398.028] (-1396.890) (-1402.279) (-1402.033) * (-1397.634) [-1399.366] (-1404.077) (-1395.979) -- 0:00:13
917500 -- (-1399.196) [-1398.698] (-1405.935) (-1402.730) * (-1398.489) [-1399.767] (-1414.055) (-1403.624) -- 0:00:13
918000 -- [-1405.932] (-1403.997) (-1408.654) (-1401.114) * (-1402.022) [-1400.048] (-1410.012) (-1405.607) -- 0:00:13
918500 -- [-1398.572] (-1405.917) (-1406.937) (-1401.357) * (-1404.135) (-1400.857) [-1402.672] (-1397.227) -- 0:00:13
919000 -- (-1405.104) [-1401.548] (-1407.841) (-1402.642) * (-1399.474) (-1399.884) [-1410.598] (-1400.475) -- 0:00:12
919500 -- (-1397.831) (-1398.911) (-1404.457) [-1401.320] * (-1400.957) [-1399.232] (-1400.454) (-1400.174) -- 0:00:12
920000 -- (-1398.856) (-1404.791) (-1402.731) [-1404.457] * [-1403.411] (-1402.931) (-1398.816) (-1399.462) -- 0:00:12
Average standard deviation of split frequencies: 0.005376
920500 -- (-1401.373) (-1396.262) [-1404.142] (-1406.244) * (-1406.347) (-1396.180) (-1396.117) [-1402.804] -- 0:00:12
921000 -- [-1398.686] (-1403.835) (-1404.332) (-1404.538) * (-1398.976) [-1404.056] (-1402.103) (-1402.003) -- 0:00:12
921500 -- (-1398.005) (-1398.580) [-1396.107] (-1397.916) * (-1401.139) (-1399.180) (-1401.728) [-1401.715] -- 0:00:12
922000 -- (-1399.727) (-1406.858) (-1400.762) [-1397.987] * [-1399.599] (-1394.012) (-1396.234) (-1409.073) -- 0:00:12
922500 -- (-1403.014) (-1398.277) (-1397.791) [-1395.017] * (-1398.352) (-1401.018) (-1397.338) [-1400.567] -- 0:00:12
923000 -- [-1399.969] (-1404.319) (-1401.080) (-1401.171) * (-1397.237) [-1397.486] (-1394.934) (-1398.255) -- 0:00:12
923500 -- (-1400.640) (-1410.559) (-1399.383) [-1399.006] * [-1401.514] (-1399.382) (-1397.088) (-1398.650) -- 0:00:12
924000 -- (-1398.909) [-1394.193] (-1403.084) (-1400.572) * (-1400.232) [-1401.266] (-1395.814) (-1398.887) -- 0:00:12
924500 -- (-1403.900) [-1395.740] (-1403.571) (-1398.991) * (-1398.654) (-1396.928) (-1409.448) [-1399.555] -- 0:00:12
925000 -- (-1408.853) (-1408.138) (-1401.771) [-1395.255] * (-1396.201) (-1406.335) [-1399.358] (-1398.904) -- 0:00:12
Average standard deviation of split frequencies: 0.004327
925500 -- (-1402.198) (-1403.944) (-1407.721) [-1397.577] * (-1397.302) (-1402.927) [-1402.610] (-1400.310) -- 0:00:11
926000 -- (-1402.089) (-1399.388) (-1405.743) [-1402.878] * (-1395.622) [-1402.753] (-1396.859) (-1399.844) -- 0:00:11
926500 -- (-1400.892) [-1398.365] (-1400.286) (-1399.538) * (-1400.972) (-1397.515) [-1398.466] (-1410.504) -- 0:00:11
927000 -- (-1399.519) (-1398.189) (-1401.746) [-1402.639] * (-1397.819) (-1397.527) (-1396.137) [-1397.603] -- 0:00:11
927500 -- (-1398.450) (-1405.615) [-1400.200] (-1404.346) * (-1402.096) (-1400.924) (-1404.278) [-1399.312] -- 0:00:11
928000 -- [-1397.704] (-1405.737) (-1401.662) (-1403.392) * (-1397.542) [-1401.348] (-1402.693) (-1399.233) -- 0:00:11
928500 -- (-1401.640) [-1400.461] (-1398.724) (-1400.588) * [-1402.509] (-1404.245) (-1402.455) (-1398.476) -- 0:00:11
929000 -- [-1399.754] (-1405.782) (-1398.426) (-1398.910) * (-1403.089) (-1400.344) (-1398.859) [-1394.451] -- 0:00:11
929500 -- [-1395.820] (-1399.868) (-1401.454) (-1404.136) * (-1396.964) (-1400.066) [-1397.137] (-1400.157) -- 0:00:11
930000 -- [-1402.226] (-1397.485) (-1404.642) (-1410.843) * (-1394.979) [-1400.330] (-1406.653) (-1402.545) -- 0:00:11
Average standard deviation of split frequencies: 0.005065
930500 -- [-1399.765] (-1398.962) (-1400.458) (-1399.068) * [-1402.164] (-1401.713) (-1405.034) (-1397.944) -- 0:00:11
931000 -- (-1400.744) [-1399.473] (-1404.077) (-1403.802) * (-1403.348) (-1403.665) [-1405.228] (-1397.457) -- 0:00:11
931500 -- [-1397.150] (-1399.604) (-1407.704) (-1397.620) * (-1399.848) [-1403.982] (-1399.416) (-1405.344) -- 0:00:10
932000 -- (-1403.499) (-1401.482) [-1401.352] (-1397.824) * (-1400.973) (-1398.999) (-1396.999) [-1400.148] -- 0:00:10
932500 -- (-1398.589) (-1405.418) (-1405.097) [-1401.371] * (-1402.756) (-1402.993) [-1399.763] (-1399.552) -- 0:00:10
933000 -- (-1402.033) [-1399.348] (-1398.301) (-1400.977) * (-1407.912) (-1412.930) [-1401.254] (-1406.917) -- 0:00:10
933500 -- (-1403.044) (-1402.506) (-1402.668) [-1402.052] * (-1405.807) [-1397.266] (-1398.892) (-1400.360) -- 0:00:10
934000 -- (-1398.121) (-1401.401) [-1401.266] (-1406.002) * (-1407.402) [-1398.405] (-1399.919) (-1396.347) -- 0:00:10
934500 -- (-1397.939) [-1398.771] (-1400.984) (-1405.157) * (-1399.040) (-1405.769) [-1397.258] (-1396.027) -- 0:00:10
935000 -- [-1398.639] (-1397.055) (-1399.980) (-1398.993) * (-1402.805) (-1404.138) (-1404.906) [-1401.885] -- 0:00:10
Average standard deviation of split frequencies: 0.004281
935500 -- (-1399.635) (-1401.483) [-1399.079] (-1402.467) * (-1399.846) [-1402.609] (-1404.523) (-1398.110) -- 0:00:10
936000 -- (-1400.898) (-1400.508) (-1404.181) [-1398.730] * (-1406.292) (-1400.823) [-1400.334] (-1400.203) -- 0:00:10
936500 -- (-1397.441) (-1398.081) (-1407.544) [-1399.921] * (-1397.262) (-1401.110) [-1399.747] (-1395.879) -- 0:00:10
937000 -- (-1401.124) (-1401.317) [-1400.044] (-1401.539) * (-1397.891) (-1404.320) [-1404.922] (-1404.071) -- 0:00:10
937500 -- (-1399.969) (-1403.137) [-1406.043] (-1400.820) * [-1401.804] (-1402.113) (-1401.080) (-1399.689) -- 0:00:10
938000 -- (-1404.134) (-1395.455) (-1402.254) [-1399.458] * (-1400.715) (-1400.646) [-1397.192] (-1404.818) -- 0:00:09
938500 -- (-1405.354) (-1397.873) [-1401.913] (-1397.772) * (-1397.508) (-1398.481) (-1397.340) [-1397.764] -- 0:00:09
939000 -- (-1402.420) [-1395.890] (-1403.118) (-1408.296) * (-1396.509) (-1395.120) [-1399.760] (-1404.735) -- 0:00:09
939500 -- (-1404.132) (-1403.351) [-1398.054] (-1399.787) * (-1396.599) [-1393.551] (-1401.004) (-1401.073) -- 0:00:09
940000 -- (-1401.731) (-1401.294) (-1399.844) [-1396.628] * (-1394.858) (-1399.237) (-1400.838) [-1398.334] -- 0:00:09
Average standard deviation of split frequencies: 0.003759
940500 -- (-1405.545) (-1398.865) (-1402.837) [-1396.389] * (-1398.301) [-1396.090] (-1404.260) (-1409.140) -- 0:00:09
941000 -- (-1404.069) [-1396.012] (-1393.602) (-1405.085) * (-1397.461) (-1399.853) (-1406.858) [-1399.389] -- 0:00:09
941500 -- (-1395.715) (-1398.715) [-1397.600] (-1405.425) * (-1402.273) [-1401.411] (-1405.701) (-1407.404) -- 0:00:09
942000 -- (-1400.701) (-1397.865) [-1398.616] (-1401.154) * [-1402.966] (-1400.545) (-1400.769) (-1412.008) -- 0:00:09
942500 -- [-1399.910] (-1401.543) (-1400.846) (-1402.997) * [-1404.982] (-1401.375) (-1396.765) (-1404.436) -- 0:00:09
943000 -- [-1400.928] (-1396.779) (-1399.681) (-1402.105) * [-1402.539] (-1406.338) (-1400.659) (-1397.972) -- 0:00:09
943500 -- [-1397.989] (-1401.305) (-1404.361) (-1405.133) * (-1403.243) (-1403.699) (-1395.571) [-1401.818] -- 0:00:09
944000 -- (-1397.374) [-1401.194] (-1398.621) (-1398.164) * [-1397.221] (-1405.415) (-1396.773) (-1400.851) -- 0:00:08
944500 -- (-1407.592) [-1397.289] (-1403.908) (-1400.535) * (-1401.719) [-1405.616] (-1396.265) (-1397.580) -- 0:00:08
945000 -- (-1399.209) [-1396.994] (-1404.588) (-1399.130) * [-1398.114] (-1405.402) (-1401.860) (-1404.375) -- 0:00:08
Average standard deviation of split frequencies: 0.003987
945500 -- [-1396.516] (-1400.037) (-1401.860) (-1403.360) * [-1396.682] (-1410.090) (-1396.666) (-1397.040) -- 0:00:08
946000 -- [-1397.475] (-1397.648) (-1410.499) (-1406.403) * (-1399.924) (-1405.333) (-1398.409) [-1397.801] -- 0:00:08
946500 -- (-1398.042) [-1400.317] (-1403.203) (-1401.518) * (-1398.957) (-1410.258) (-1401.877) [-1398.233] -- 0:00:08
947000 -- (-1400.479) [-1400.961] (-1398.368) (-1400.830) * (-1408.760) [-1397.421] (-1403.494) (-1397.361) -- 0:00:08
947500 -- (-1399.612) (-1400.446) (-1409.662) [-1399.070] * (-1401.841) (-1404.377) [-1396.602] (-1398.502) -- 0:00:08
948000 -- (-1397.732) (-1407.136) [-1404.202] (-1404.080) * (-1405.593) (-1400.900) (-1397.023) [-1399.614] -- 0:00:08
948500 -- (-1398.505) (-1402.796) [-1404.715] (-1395.653) * [-1400.337] (-1402.138) (-1399.560) (-1398.434) -- 0:00:08
949000 -- (-1406.158) (-1402.638) (-1400.626) [-1400.912] * (-1401.916) [-1401.660] (-1398.547) (-1397.265) -- 0:00:08
949500 -- (-1401.652) (-1402.505) [-1398.384] (-1404.016) * (-1400.213) (-1397.885) (-1400.846) [-1395.147] -- 0:00:08
950000 -- (-1410.551) (-1396.753) [-1399.171] (-1402.815) * (-1403.107) (-1398.203) [-1400.972] (-1400.509) -- 0:00:08
Average standard deviation of split frequencies: 0.004463
950500 -- (-1411.554) [-1399.078] (-1410.063) (-1409.563) * [-1402.287] (-1400.175) (-1406.132) (-1399.719) -- 0:00:07
951000 -- (-1413.281) (-1397.765) (-1401.826) [-1405.843] * [-1401.813] (-1400.056) (-1402.739) (-1400.974) -- 0:00:07
951500 -- (-1415.849) [-1401.493] (-1402.195) (-1402.454) * (-1409.366) [-1401.881] (-1399.865) (-1402.232) -- 0:00:07
952000 -- (-1410.669) (-1403.478) (-1409.876) [-1395.940] * (-1406.549) (-1398.963) (-1401.181) [-1403.901] -- 0:00:07
952500 -- (-1407.783) [-1398.201] (-1398.920) (-1400.986) * (-1402.988) (-1402.277) [-1401.149] (-1398.687) -- 0:00:07
953000 -- (-1410.083) [-1402.627] (-1396.031) (-1401.367) * [-1397.497] (-1406.667) (-1410.278) (-1404.293) -- 0:00:07
953500 -- (-1406.551) (-1405.423) [-1395.960] (-1395.117) * (-1398.347) (-1402.139) (-1403.403) [-1402.604] -- 0:00:07
954000 -- (-1403.760) (-1402.581) [-1397.689] (-1401.437) * (-1404.260) (-1405.748) (-1400.701) [-1397.940] -- 0:00:07
954500 -- [-1398.564] (-1399.659) (-1398.546) (-1401.730) * (-1403.851) (-1401.422) [-1402.981] (-1398.730) -- 0:00:07
955000 -- (-1399.810) (-1403.009) [-1399.543] (-1399.752) * (-1395.644) (-1396.632) [-1401.034] (-1409.850) -- 0:00:07
Average standard deviation of split frequencies: 0.003698
955500 -- (-1397.203) (-1398.535) (-1403.835) [-1402.451] * (-1406.292) [-1396.818] (-1400.544) (-1407.136) -- 0:00:07
956000 -- (-1397.417) (-1403.433) [-1399.318] (-1397.622) * [-1397.968] (-1399.727) (-1399.184) (-1402.914) -- 0:00:07
956500 -- [-1396.576] (-1403.415) (-1398.228) (-1409.731) * [-1400.059] (-1403.523) (-1397.188) (-1404.459) -- 0:00:06
957000 -- (-1402.193) (-1410.089) [-1398.894] (-1401.168) * (-1395.994) [-1398.631] (-1399.835) (-1401.134) -- 0:00:06
957500 -- [-1399.678] (-1404.290) (-1405.349) (-1397.693) * [-1404.819] (-1400.266) (-1403.138) (-1397.827) -- 0:00:06
958000 -- (-1404.143) (-1402.259) [-1398.370] (-1397.728) * (-1404.746) (-1396.970) (-1401.487) [-1394.684] -- 0:00:06
958500 -- (-1397.303) (-1404.019) (-1409.987) [-1398.403] * [-1397.639] (-1396.127) (-1401.770) (-1397.207) -- 0:00:06
959000 -- (-1403.744) (-1401.890) [-1399.963] (-1399.498) * (-1400.221) [-1401.178] (-1399.734) (-1401.924) -- 0:00:06
959500 -- (-1401.703) (-1399.886) [-1404.532] (-1403.918) * (-1401.259) (-1398.284) [-1398.155] (-1400.942) -- 0:00:06
960000 -- (-1398.757) (-1411.030) [-1400.520] (-1398.192) * (-1406.334) [-1397.602] (-1393.592) (-1404.148) -- 0:00:06
Average standard deviation of split frequencies: 0.003680
960500 -- (-1401.426) [-1401.274] (-1400.837) (-1398.005) * (-1403.151) (-1400.450) (-1400.248) [-1401.786] -- 0:00:06
961000 -- (-1400.588) (-1398.041) (-1396.939) [-1400.167] * (-1399.606) [-1397.573] (-1396.772) (-1405.597) -- 0:00:06
961500 -- [-1398.989] (-1403.060) (-1396.946) (-1397.075) * [-1397.815] (-1398.372) (-1400.879) (-1403.560) -- 0:00:06
962000 -- (-1397.915) (-1400.278) [-1396.595] (-1403.995) * (-1396.738) (-1394.448) (-1406.450) [-1397.243] -- 0:00:06
962500 -- (-1401.697) (-1402.628) [-1400.368] (-1402.925) * (-1401.197) (-1396.918) (-1406.462) [-1398.476] -- 0:00:06
963000 -- (-1402.964) (-1400.771) [-1397.705] (-1405.563) * (-1398.077) (-1400.294) [-1406.150] (-1396.986) -- 0:00:05
963500 -- (-1404.103) (-1405.454) (-1393.342) [-1398.215] * (-1405.266) [-1398.365] (-1403.309) (-1394.471) -- 0:00:05
964000 -- (-1403.231) (-1397.000) [-1395.604] (-1402.096) * (-1402.357) [-1397.162] (-1409.749) (-1404.950) -- 0:00:05
964500 -- (-1413.800) [-1404.088] (-1408.918) (-1407.029) * (-1401.513) (-1399.819) (-1408.628) [-1396.598] -- 0:00:05
965000 -- (-1401.279) [-1398.497] (-1399.719) (-1396.838) * (-1401.841) [-1397.658] (-1406.342) (-1408.771) -- 0:00:05
Average standard deviation of split frequencies: 0.004392
965500 -- (-1401.519) (-1402.288) [-1399.139] (-1400.105) * (-1401.306) (-1400.503) (-1406.279) [-1399.586] -- 0:00:05
966000 -- (-1402.575) (-1402.974) [-1399.381] (-1404.718) * (-1405.822) (-1403.762) [-1398.633] (-1401.252) -- 0:00:05
966500 -- (-1405.027) [-1397.701] (-1404.429) (-1401.633) * [-1394.933] (-1395.149) (-1407.306) (-1400.217) -- 0:00:05
967000 -- (-1397.640) (-1397.744) [-1398.065] (-1404.257) * [-1397.534] (-1398.493) (-1400.445) (-1403.539) -- 0:00:05
967500 -- (-1397.734) (-1402.675) (-1403.653) [-1406.019] * (-1397.707) [-1398.600] (-1403.199) (-1403.601) -- 0:00:05
968000 -- [-1401.318] (-1397.799) (-1402.453) (-1407.074) * [-1396.553] (-1399.473) (-1403.818) (-1400.386) -- 0:00:05
968500 -- (-1399.727) (-1398.176) [-1398.937] (-1402.763) * (-1400.391) (-1399.847) [-1397.632] (-1399.165) -- 0:00:05
969000 -- [-1402.166] (-1406.299) (-1403.052) (-1401.548) * (-1397.494) (-1402.425) [-1401.353] (-1400.057) -- 0:00:04
969500 -- (-1397.972) (-1400.667) (-1399.645) [-1397.583] * (-1406.867) (-1397.064) [-1400.940] (-1406.390) -- 0:00:04
970000 -- (-1397.632) (-1398.712) [-1396.637] (-1404.557) * (-1402.135) [-1401.013] (-1399.838) (-1402.471) -- 0:00:04
Average standard deviation of split frequencies: 0.005099
970500 -- (-1398.852) [-1398.331] (-1401.143) (-1406.324) * (-1398.076) [-1403.353] (-1398.700) (-1409.322) -- 0:00:04
971000 -- (-1402.938) (-1404.021) (-1402.755) [-1400.170] * (-1410.480) [-1398.751] (-1399.992) (-1404.367) -- 0:00:04
971500 -- (-1399.226) [-1398.655] (-1400.354) (-1400.019) * (-1398.779) [-1401.897] (-1402.284) (-1397.056) -- 0:00:04
972000 -- [-1399.222] (-1408.371) (-1399.912) (-1399.743) * (-1399.181) (-1399.696) [-1400.560] (-1403.974) -- 0:00:04
972500 -- (-1397.425) (-1398.587) [-1406.538] (-1393.278) * (-1406.794) (-1398.076) (-1402.391) [-1400.088] -- 0:00:04
973000 -- (-1399.916) [-1396.976] (-1399.117) (-1400.597) * (-1402.474) [-1401.144] (-1402.491) (-1405.623) -- 0:00:04
973500 -- [-1397.207] (-1396.939) (-1403.548) (-1398.785) * (-1398.222) [-1398.431] (-1397.902) (-1403.062) -- 0:00:04
974000 -- (-1406.994) [-1401.090] (-1402.646) (-1400.620) * [-1397.199] (-1408.856) (-1393.694) (-1403.386) -- 0:00:04
974500 -- (-1398.263) [-1401.204] (-1405.397) (-1400.721) * [-1399.238] (-1404.572) (-1395.901) (-1402.346) -- 0:00:04
975000 -- (-1405.116) [-1402.981] (-1400.694) (-1403.438) * (-1401.792) (-1400.025) [-1399.381] (-1401.622) -- 0:00:04
Average standard deviation of split frequencies: 0.005071
975500 -- [-1400.913] (-1398.403) (-1404.548) (-1399.687) * (-1408.454) (-1401.044) (-1398.039) [-1396.457] -- 0:00:03
976000 -- (-1399.872) [-1396.682] (-1400.739) (-1395.676) * (-1406.106) [-1400.370] (-1403.667) (-1398.336) -- 0:00:03
976500 -- (-1407.609) (-1404.724) [-1401.619] (-1402.009) * (-1400.160) [-1398.945] (-1396.516) (-1400.924) -- 0:00:03
977000 -- (-1399.551) [-1403.362] (-1401.353) (-1402.020) * (-1400.649) (-1403.181) [-1399.084] (-1399.159) -- 0:00:03
977500 -- [-1398.038] (-1402.410) (-1396.591) (-1403.383) * (-1404.681) (-1405.374) (-1408.120) [-1399.075] -- 0:00:03
978000 -- [-1398.485] (-1397.641) (-1398.275) (-1393.707) * (-1408.701) [-1399.304] (-1401.183) (-1398.230) -- 0:00:03
978500 -- (-1395.514) [-1400.108] (-1402.425) (-1409.776) * (-1401.029) [-1397.828] (-1400.477) (-1402.693) -- 0:00:03
979000 -- (-1403.649) [-1395.342] (-1404.452) (-1400.646) * (-1405.912) (-1400.530) (-1402.530) [-1397.681] -- 0:00:03
979500 -- (-1405.435) [-1400.116] (-1399.720) (-1400.368) * [-1397.565] (-1403.653) (-1398.841) (-1404.469) -- 0:00:03
980000 -- [-1396.740] (-1403.889) (-1397.216) (-1399.864) * (-1401.828) (-1400.037) (-1401.315) [-1398.392] -- 0:00:03
Average standard deviation of split frequencies: 0.005288
980500 -- (-1405.368) (-1399.715) [-1397.703] (-1398.291) * (-1405.215) (-1403.687) [-1401.509] (-1400.748) -- 0:00:03
981000 -- (-1400.776) (-1404.408) (-1396.979) [-1401.196] * [-1399.359] (-1400.306) (-1402.858) (-1405.962) -- 0:00:03
981500 -- (-1398.871) [-1405.536] (-1402.805) (-1401.797) * [-1399.148] (-1408.279) (-1405.609) (-1399.588) -- 0:00:02
982000 -- (-1405.753) [-1400.997] (-1400.806) (-1393.085) * (-1401.296) [-1398.278] (-1405.757) (-1400.420) -- 0:00:02
982500 -- (-1398.496) [-1403.530] (-1400.422) (-1396.779) * [-1400.695] (-1404.859) (-1400.690) (-1408.827) -- 0:00:02
983000 -- [-1396.792] (-1403.407) (-1399.882) (-1404.184) * [-1397.799] (-1404.877) (-1401.368) (-1407.529) -- 0:00:02
983500 -- (-1401.125) (-1405.378) [-1399.180] (-1401.346) * (-1396.870) (-1395.126) [-1399.419] (-1405.523) -- 0:00:02
984000 -- (-1401.150) (-1409.650) (-1399.636) [-1398.491] * (-1398.883) [-1395.330] (-1401.268) (-1405.112) -- 0:00:02
984500 -- [-1405.118] (-1406.984) (-1402.592) (-1399.183) * (-1404.572) (-1406.665) [-1399.746] (-1407.105) -- 0:00:02
985000 -- (-1395.575) (-1401.688) (-1400.404) [-1402.716] * (-1403.143) (-1405.070) [-1400.594] (-1404.933) -- 0:00:02
Average standard deviation of split frequencies: 0.005976
985500 -- (-1398.377) (-1403.140) [-1400.611] (-1408.676) * (-1405.730) (-1397.680) [-1398.740] (-1399.597) -- 0:00:02
986000 -- (-1405.392) (-1407.732) (-1401.867) [-1396.969] * (-1405.463) [-1397.693] (-1399.500) (-1414.370) -- 0:00:02
986500 -- (-1405.293) [-1402.643] (-1404.302) (-1403.802) * [-1401.294] (-1395.582) (-1398.403) (-1395.705) -- 0:00:02
987000 -- (-1403.286) (-1401.906) (-1397.944) [-1398.548] * (-1402.695) (-1400.928) (-1396.473) [-1398.635] -- 0:00:02
987500 -- (-1404.983) (-1396.287) [-1401.044] (-1394.966) * (-1398.599) (-1402.056) (-1404.358) [-1401.972] -- 0:00:02
988000 -- (-1396.973) (-1398.417) (-1398.924) [-1397.834] * (-1403.752) [-1396.648] (-1405.126) (-1397.448) -- 0:00:01
988500 -- [-1401.864] (-1398.919) (-1398.793) (-1405.218) * (-1405.689) (-1401.557) (-1406.648) [-1394.819] -- 0:00:01
989000 -- (-1400.617) (-1403.893) (-1400.771) [-1402.395] * [-1398.112] (-1402.153) (-1419.714) (-1404.309) -- 0:00:01
989500 -- [-1405.800] (-1415.217) (-1403.824) (-1403.912) * (-1404.520) [-1401.898] (-1406.459) (-1404.293) -- 0:00:01
990000 -- (-1399.258) (-1400.534) [-1395.374] (-1400.419) * (-1402.469) [-1402.270] (-1402.571) (-1398.997) -- 0:00:01
Average standard deviation of split frequencies: 0.006662
990500 -- (-1406.540) (-1399.147) [-1398.472] (-1401.207) * (-1404.151) (-1401.204) (-1399.313) [-1396.072] -- 0:00:01
991000 -- (-1406.404) (-1400.524) [-1400.431] (-1396.133) * (-1397.496) (-1403.165) (-1402.262) [-1399.337] -- 0:00:01
991500 -- (-1406.540) [-1401.140] (-1395.996) (-1396.412) * [-1399.456] (-1400.387) (-1408.893) (-1399.317) -- 0:00:01
992000 -- [-1397.373] (-1403.181) (-1395.738) (-1399.275) * [-1397.135] (-1396.652) (-1409.408) (-1400.204) -- 0:00:01
992500 -- (-1400.097) (-1408.794) (-1395.918) [-1397.697] * (-1406.029) [-1396.337] (-1404.086) (-1405.851) -- 0:00:01
993000 -- (-1399.968) (-1404.552) (-1398.113) [-1397.487] * (-1403.157) (-1403.713) (-1404.622) [-1400.983] -- 0:00:01
993500 -- [-1398.135] (-1394.634) (-1401.398) (-1410.243) * (-1403.515) (-1401.341) [-1394.551] (-1407.254) -- 0:00:01
994000 -- (-1396.245) [-1393.889] (-1399.616) (-1401.148) * (-1403.251) (-1399.078) [-1395.964] (-1406.935) -- 0:00:00
994500 -- (-1404.316) [-1396.300] (-1406.180) (-1411.193) * (-1399.675) [-1396.440] (-1400.630) (-1399.887) -- 0:00:00
995000 -- (-1398.438) (-1397.290) [-1398.447] (-1399.852) * (-1407.412) (-1400.634) (-1406.358) [-1399.378] -- 0:00:00
Average standard deviation of split frequencies: 0.006390
995500 -- [-1396.570] (-1400.916) (-1398.003) (-1401.943) * (-1406.886) [-1396.415] (-1397.972) (-1397.570) -- 0:00:00
996000 -- (-1395.113) [-1397.055] (-1402.633) (-1398.279) * (-1402.937) [-1396.224] (-1397.966) (-1395.331) -- 0:00:00
996500 -- (-1397.916) (-1398.521) [-1401.555] (-1400.993) * (-1398.310) (-1400.801) (-1401.573) [-1398.079] -- 0:00:00
997000 -- (-1406.030) [-1396.463] (-1399.579) (-1405.709) * (-1404.268) [-1399.573] (-1396.933) (-1398.666) -- 0:00:00
997500 -- (-1396.572) [-1396.691] (-1402.247) (-1398.268) * (-1396.164) [-1400.489] (-1402.142) (-1403.425) -- 0:00:00
998000 -- (-1396.466) (-1397.719) (-1398.160) [-1398.628] * [-1397.757] (-1407.142) (-1402.062) (-1398.720) -- 0:00:00
998500 -- [-1402.146] (-1395.562) (-1395.142) (-1400.993) * (-1394.496) [-1399.407] (-1400.529) (-1398.697) -- 0:00:00
999000 -- (-1403.191) [-1397.528] (-1400.315) (-1400.377) * (-1394.564) (-1403.506) (-1399.285) [-1397.965] -- 0:00:00
999500 -- [-1396.442] (-1399.650) (-1395.889) (-1397.634) * (-1399.712) [-1396.388] (-1397.894) (-1401.119) -- 0:00:00
1000000 -- [-1400.603] (-1399.408) (-1399.398) (-1402.917) * (-1407.386) [-1396.916] (-1405.819) (-1396.270) -- 0:00:00
Average standard deviation of split frequencies: 0.006595
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1400.602562 -- 18.539093
Chain 1 -- -1400.602562 -- 18.539093
Chain 2 -- -1399.408296 -- 12.933468
Chain 2 -- -1399.408289 -- 12.933468
Chain 3 -- -1399.397814 -- 18.057430
Chain 3 -- -1399.397815 -- 18.057430
Chain 4 -- -1402.917100 -- 18.679005
Chain 4 -- -1402.917100 -- 18.679005
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1407.385583 -- 15.011351
Chain 1 -- -1407.385584 -- 15.011351
Chain 2 -- -1396.916428 -- 16.623478
Chain 2 -- -1396.916432 -- 16.623478
Chain 3 -- -1405.818720 -- 19.148293
Chain 3 -- -1405.818720 -- 19.148293
Chain 4 -- -1396.269679 -- 18.200999
Chain 4 -- -1396.269679 -- 18.200999
Analysis completed in 2 mins 40 seconds
Analysis used 159.53 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1391.43
Likelihood of best state for "cold" chain of run 2 was -1391.41
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
59.2 % ( 54 %) Dirichlet(Revmat{all})
74.2 % ( 62 %) Slider(Revmat{all})
27.1 % ( 32 %) Dirichlet(Pi{all})
28.8 % ( 21 %) Slider(Pi{all})
69.4 % ( 42 %) Multiplier(Alpha{1,2})
59.5 % ( 23 %) Multiplier(Alpha{3})
66.6 % ( 30 %) Slider(Pinvar{all})
27.5 % ( 22 %) ExtSPR(Tau{all},V{all})
27.6 % ( 35 %) ExtTBR(Tau{all},V{all})
27.8 % ( 29 %) NNI(Tau{all},V{all})
30.4 % ( 38 %) ParsSPR(Tau{all},V{all})
26.5 % ( 27 %) Multiplier(V{all})
38.5 % ( 37 %) Nodeslider(V{all})
26.1 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
59.3 % ( 57 %) Dirichlet(Revmat{all})
74.8 % ( 66 %) Slider(Revmat{all})
27.5 % ( 15 %) Dirichlet(Pi{all})
28.8 % ( 27 %) Slider(Pi{all})
69.5 % ( 35 %) Multiplier(Alpha{1,2})
60.0 % ( 30 %) Multiplier(Alpha{3})
66.8 % ( 40 %) Slider(Pinvar{all})
27.7 % ( 29 %) ExtSPR(Tau{all},V{all})
27.9 % ( 28 %) ExtTBR(Tau{all},V{all})
27.8 % ( 38 %) NNI(Tau{all},V{all})
30.6 % ( 36 %) ParsSPR(Tau{all},V{all})
26.5 % ( 26 %) Multiplier(V{all})
38.4 % ( 30 %) Nodeslider(V{all})
26.2 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.54
2 | 166912 0.84 0.70
3 | 166586 166589 0.85
4 | 166835 166566 166512
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.67 0.54
2 | 166379 0.84 0.69
3 | 166841 166320 0.85
4 | 167371 166089 167000
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1398.10
| 2 2 1 1 2 1 2|
| 1 2 |
| 12 1 2 2 2 2 1|
| 11 1 2 1 1 1 *2 1 2 1 1 * 2 |
|1 2 2 1 1 2 2 11 22 2 1 * 2 |
| 21 2 2 1 1 12* *1 1 1* 2 1 11 |
|2 11 2 1 2 2* 12 2 1 11 2 1* 2 |
| 1 * 1 1 2 2 2 1 |
| 2 2 1 22 1 1 1 |
| 2 2 11 2 22 |
| 2 * 2 |
| |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1401.95
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1396.78 -1404.08
2 -1396.60 -1408.78
--------------------------------------
TOTAL -1396.69 -1408.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.150819 0.000921 0.098486 0.212677 0.147208 995.09 1116.57 1.000
r(A<->C){all} 0.091828 0.001327 0.025487 0.164307 0.088437 689.43 749.84 1.000
r(A<->G){all} 0.186122 0.002836 0.086653 0.285471 0.181476 705.03 705.13 1.000
r(A<->T){all} 0.136818 0.003449 0.034233 0.257040 0.129492 480.60 507.93 1.001
r(C<->G){all} 0.020423 0.000237 0.000011 0.049489 0.017069 1090.84 1150.26 1.001
r(C<->T){all} 0.459414 0.006329 0.303548 0.611546 0.459213 587.83 615.62 1.000
r(G<->T){all} 0.105394 0.002026 0.019633 0.190432 0.100535 589.25 622.89 1.000
pi(A){all} 0.256793 0.000236 0.227091 0.287115 0.256543 1195.15 1261.36 1.000
pi(C){all} 0.284907 0.000265 0.253089 0.316794 0.284408 1331.87 1375.37 1.000
pi(G){all} 0.283795 0.000264 0.250989 0.313982 0.283635 1329.84 1381.94 1.000
pi(T){all} 0.174505 0.000190 0.147354 0.201281 0.174064 1314.38 1325.94 1.001
alpha{1,2} 0.130575 0.024133 0.000111 0.382277 0.091025 1106.14 1140.29 1.000
alpha{3} 0.941946 0.316016 0.127053 2.115277 0.828221 1304.79 1402.89 1.000
pinvar{all} 0.529853 0.018971 0.230464 0.768644 0.549333 872.97 1017.11 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- ..***
8 -- .**..
9 -- .*.**
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 1516 0.504997 0.013191 0.495670 0.514324 2
8 1140 0.379747 0.013191 0.370420 0.389074 2
9 346 0.115256 0.000000 0.115256 0.115256 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.024652 0.000074 0.010032 0.042252 0.023333 1.000 2
length{all}[2] 0.015548 0.000037 0.004593 0.026935 0.014563 1.000 2
length{all}[3] 0.007609 0.000019 0.000608 0.015956 0.006781 1.000 2
length{all}[4] 0.048598 0.000223 0.022014 0.077268 0.046565 1.000 2
length{all}[5] 0.021293 0.000085 0.006081 0.039992 0.019991 1.000 2
length{all}[6] 0.028650 0.000134 0.008922 0.050552 0.026390 1.001 2
length{all}[7] 0.004238 0.000011 0.000010 0.010583 0.003420 1.000 2
length{all}[8] 0.005166 0.000016 0.000033 0.013227 0.004212 1.002 2
length{all}[9] 0.003179 0.000009 0.000025 0.009443 0.002258 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006595
Maximum standard deviation of split frequencies = 0.013191
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
| /------------------------------------------------ C3 (3)
| |
\-----------50----------+ /------------------------ C4 (4)
\----------100----------+
\------------------------ C5 (5)
Phylogram (based on average branch lengths):
/---------------------- C1 (1)
|
|-------------- C2 (2)
+
| /------- C3 (3)
| |
\--+ /-------------------------------------------- C4 (4)
\------------------------+
\------------------- C5 (5)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 735
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
92 patterns at 245 / 245 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
89792 bytes for conP
12512 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, 5))); MP score: 63
134688 bytes for conP, adjusted
0.046416 0.033208 0.000000 0.017429 0.048696 0.088868 0.040832 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1424.945322
Iterating by ming2
Initial: fx= 1424.945322
x= 0.04642 0.03321 0.00000 0.01743 0.04870 0.08887 0.04083 0.30000 1.30000
1 h-m-p 0.0000 0.0007 2750.2117 YYCYCCC 1422.912503 6 0.0000 23 | 0/9
2 h-m-p 0.0000 0.0003 129.6968 +YYYYYCC 1421.041486 6 0.0002 43 | 0/9
3 h-m-p 0.0001 0.0016 446.7498 ++CCCC 1404.388490 3 0.0008 63 | 0/9
4 h-m-p 0.0003 0.0016 866.4719 CCCCC 1396.690389 4 0.0003 83 | 0/9
5 h-m-p 0.0002 0.0008 444.8703 YCYCCC 1386.943794 5 0.0004 103 | 0/9
6 h-m-p 0.0001 0.0004 262.9422 CCCCC 1385.798955 4 0.0001 123 | 0/9
7 h-m-p 0.0007 0.0049 41.6226 YCCC 1385.436837 3 0.0005 140 | 0/9
8 h-m-p 0.0002 0.0083 129.7779 ++YCYYYCYYCC 1355.883314 10 0.0075 168 | 0/9
9 h-m-p 0.0000 0.0002 551.1763 YYYC 1355.576747 3 0.0000 183 | 0/9
10 h-m-p 0.0793 1.0370 0.2437 +CYYYCCC 1342.431652 6 0.6416 205 | 0/9
11 h-m-p 0.8147 4.0735 0.0423 YCYCCC 1338.885658 5 2.0017 234 | 0/9
12 h-m-p 0.8175 6.0123 0.1035 CYC 1338.336743 2 0.6974 258 | 0/9
13 h-m-p 0.4653 6.7524 0.1551 +CYCCC 1336.595390 4 2.5196 287 | 0/9
14 h-m-p 1.6000 8.0000 0.1496 YCCC 1335.291073 3 2.6295 313 | 0/9
15 h-m-p 1.6000 8.0000 0.1597 CYC 1334.903318 2 1.9923 337 | 0/9
16 h-m-p 1.6000 8.0000 0.0831 CY 1334.846282 1 1.6136 360 | 0/9
17 h-m-p 1.6000 8.0000 0.0283 YC 1334.843009 1 0.8585 382 | 0/9
18 h-m-p 1.6000 8.0000 0.0100 YC 1334.842398 1 0.9856 404 | 0/9
19 h-m-p 1.6000 8.0000 0.0018 YC 1334.842130 1 3.6752 426 | 0/9
20 h-m-p 1.6000 8.0000 0.0019 YC 1334.841826 1 2.9582 448 | 0/9
21 h-m-p 1.6000 8.0000 0.0006 C 1334.841805 0 1.4561 469 | 0/9
22 h-m-p 1.6000 8.0000 0.0001 C 1334.841805 0 1.3489 490 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 Y 1334.841805 0 1.2349 511 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 C 1334.841805 0 1.5192 532 | 0/9
25 h-m-p 1.6000 8.0000 0.0000 Y 1334.841805 0 3.2644 553 | 0/9
26 h-m-p 1.4704 8.0000 0.0000 ------Y 1334.841805 0 0.0001 580
Out..
lnL = -1334.841805
581 lfun, 581 eigenQcodon, 4067 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, 5))); MP score: 63
0.047298 0.035838 0.000000 0.019445 0.047639 0.086692 0.040087 2.597765 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.660669
np = 10
lnL0 = -1358.675104
Iterating by ming2
Initial: fx= 1358.675104
x= 0.04730 0.03584 0.00000 0.01945 0.04764 0.08669 0.04009 2.59777 0.57321 0.49224
1 h-m-p 0.0000 0.0005 4721.9091 CYCYCCC 1356.437997 6 0.0000 25 | 0/10
2 h-m-p 0.0001 0.0003 81.9007 CYCCC 1356.020333 4 0.0001 45 | 0/10
3 h-m-p 0.0002 0.0040 48.5785 +CC 1355.377463 1 0.0007 61 | 0/10
4 h-m-p 0.0002 0.0034 169.7580 ++YYYCYCCC 1334.522727 7 0.0031 86 | 0/10
5 h-m-p 0.0000 0.0001 874.7580 CCCCC 1334.277435 4 0.0000 107 | 0/10
6 h-m-p 0.0032 0.0159 3.8739 CCC 1334.257299 2 0.0012 124 | 0/10
7 h-m-p 0.0005 0.0302 9.6081 +YCCC 1334.077201 3 0.0038 143 | 0/10
8 h-m-p 0.0011 0.0160 33.5137 +CYCCC 1332.283862 4 0.0087 165 | 0/10
9 h-m-p 0.0015 0.0073 153.3484 YCCCCC 1329.570475 5 0.0030 187 | 0/10
10 h-m-p 0.0008 0.0041 319.5523 CCCCC 1327.693480 4 0.0011 208 | 0/10
11 h-m-p 0.2057 1.0285 0.6102 ++ 1325.224106 m 1.0285 221 | 1/10
12 h-m-p 0.9660 4.8565 0.6477 YYCC 1324.672778 3 0.7367 248 | 1/10
13 h-m-p 1.0755 5.3776 0.0730 YYCC 1324.525000 3 0.7832 274 | 1/10
14 h-m-p 0.4900 8.0000 0.1166 YC 1324.487993 1 0.7957 297 | 1/10
15 h-m-p 1.6000 8.0000 0.0035 YC 1324.484425 1 0.9082 320 | 1/10
16 h-m-p 0.2882 8.0000 0.0111 YC 1324.483619 1 0.5836 343 | 1/10
17 h-m-p 1.6000 8.0000 0.0022 Y 1324.483610 0 0.7761 365 | 1/10
18 h-m-p 1.6000 8.0000 0.0003 Y 1324.483607 0 2.8342 387 | 1/10
19 h-m-p 1.6000 8.0000 0.0000 +Y 1324.483593 0 7.1710 410 | 1/10
20 h-m-p 1.6000 8.0000 0.0002 Y 1324.483592 0 0.8707 432 | 1/10
21 h-m-p 1.6000 8.0000 0.0000 Y 1324.483592 0 0.8758 454 | 1/10
22 h-m-p 1.6000 8.0000 0.0000 C 1324.483592 0 0.4029 476 | 1/10
23 h-m-p 0.4045 8.0000 0.0000 Y 1324.483592 0 0.2706 498 | 1/10
24 h-m-p 0.3461 8.0000 0.0000 --------------Y 1324.483592 0 0.0000 534
Out..
lnL = -1324.483592
535 lfun, 1605 eigenQcodon, 7490 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, 5))); MP score: 63
initial w for M2:NSpselection reset.
0.047410 0.033436 0.000000 0.017783 0.048918 0.088190 0.040388 2.699111 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.498505
np = 12
lnL0 = -1363.558604
Iterating by ming2
Initial: fx= 1363.558604
x= 0.04741 0.03344 0.00000 0.01778 0.04892 0.08819 0.04039 2.69911 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0026 3642.0148 YCYYYC 1361.497435 5 0.0000 23 | 0/12
2 h-m-p 0.0001 0.0004 70.1889 YCCCC 1361.106217 4 0.0001 45 | 0/12
3 h-m-p 0.0002 0.0119 66.0796 YCCC 1360.806221 3 0.0002 65 | 0/12
4 h-m-p 0.0003 0.0055 53.6367 +YCYCCC 1358.855453 5 0.0024 89 | 0/12
5 h-m-p 0.0001 0.0005 806.1148 ++ 1347.038521 m 0.0005 104 | 1/12
6 h-m-p 0.0032 0.0160 49.8783 CCC 1346.949182 2 0.0009 123 | 1/12
7 h-m-p 0.0008 0.0127 57.4412 +YYCCCC 1345.738507 5 0.0034 147 | 1/12
8 h-m-p 0.0004 0.0018 257.7706 YCYCCC 1343.355862 5 0.0009 170 | 1/12
9 h-m-p 0.0006 0.0029 96.8774 CYCCCC 1340.133924 5 0.0010 194 | 1/12
10 h-m-p 0.0246 0.5457 4.1174 ++YCCC 1335.326581 3 0.3235 216 | 1/12
11 h-m-p 0.1261 0.6305 3.1437 YCCC 1330.263046 3 0.2929 236 | 1/12
12 h-m-p 0.0923 0.4613 1.0368 ++ 1328.440327 m 0.4613 251 | 1/12
13 h-m-p -0.0000 -0.0000 2.0456
h-m-p: -0.00000000e+00 -0.00000000e+00 2.04556257e+00 1328.440327
.. | 1/12
14 h-m-p 0.0000 0.0007 169.8213 ++CYC 1326.341552 2 0.0002 283 | 1/12
15 h-m-p 0.0001 0.0006 74.8978 YCCC 1326.201217 3 0.0001 303 | 1/12
16 h-m-p 0.0001 0.0004 80.6005 CCCC 1326.034717 3 0.0001 324 | 1/12
17 h-m-p 0.0002 0.0021 39.4183 CC 1325.952305 1 0.0002 341 | 1/12
18 h-m-p 0.0003 0.0052 23.0987 CCC 1325.890533 2 0.0003 360 | 1/12
19 h-m-p 0.0013 0.0146 6.0672 CC 1325.882513 1 0.0005 377 | 1/12
20 h-m-p 0.0006 0.0786 5.1068 ++YCC 1325.821382 2 0.0072 397 | 1/12
21 h-m-p 0.0004 0.0624 93.6631 +CCC 1325.471831 2 0.0024 417 | 1/12
22 h-m-p 0.0814 2.0663 2.7226 +CCCCC 1324.038105 4 0.4861 441 | 0/12
23 h-m-p 0.0007 0.0036 1206.3496 YCCC 1323.592722 3 0.0005 461 | 0/12
24 h-m-p 1.0417 8.0000 0.5299 CC 1323.374570 1 1.4830 478 | 0/12
25 h-m-p 1.5260 8.0000 0.5150 CCC 1323.231085 2 1.8737 509 | 0/12
26 h-m-p 1.6000 8.0000 0.0805 YCC 1323.181743 2 1.1870 539 | 0/12
27 h-m-p 0.2875 8.0000 0.3324 ++YCCC 1323.088942 3 3.5852 573 | 0/12
28 h-m-p 1.6000 8.0000 0.6800 YCCCC 1322.829556 4 3.3473 607 | 0/12
29 h-m-p 0.3307 1.6534 1.3657 CYCCC 1322.682584 4 0.5101 641 | 0/12
30 h-m-p 0.4671 2.3355 0.9435 CCC 1322.523118 2 0.7300 660 | 0/12
31 h-m-p 0.4954 2.4768 0.5432 +YCCC 1322.383288 3 1.4660 693 | 0/12
32 h-m-p 1.0119 5.9117 0.7869 YCC 1322.185966 2 1.8378 723 | 0/12
33 h-m-p 0.3148 1.5739 1.1848 ++ 1321.839914 m 1.5739 750 | 0/12
34 h-m-p 0.6750 8.0000 2.7626 YCCC 1321.551951 3 1.3724 770 | 0/12
35 h-m-p 1.0470 8.0000 3.6211 YC 1321.469508 1 0.4490 786 | 0/12
36 h-m-p 1.6000 8.0000 0.9752 CCC 1321.422815 2 1.4663 805 | 0/12
37 h-m-p 1.6000 8.0000 0.2423 CC 1321.416630 1 1.3474 834 | 0/12
38 h-m-p 1.6000 8.0000 0.0593 YC 1321.416309 1 1.1492 862 | 0/12
39 h-m-p 1.6000 8.0000 0.0056 C 1321.416213 0 2.0910 889 | 0/12
40 h-m-p 1.5273 8.0000 0.0077 C 1321.416184 0 2.3411 916 | 0/12
41 h-m-p 1.6000 8.0000 0.0049 C 1321.416181 0 1.3914 943 | 0/12
42 h-m-p 1.6000 8.0000 0.0011 C 1321.416181 0 1.3217 970 | 0/12
43 h-m-p 1.6000 8.0000 0.0001 Y 1321.416181 0 0.8433 997 | 0/12
44 h-m-p 1.6000 8.0000 0.0000 -C 1321.416181 0 0.1000 1025 | 0/12
45 h-m-p 0.4035 8.0000 0.0000 ----C 1321.416181 0 0.0004 1056
Out..
lnL = -1321.416181
1057 lfun, 4228 eigenQcodon, 22197 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1330.675345 S = -1264.306897 -59.000280
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 92 patterns 0:12
did 20 / 92 patterns 0:12
did 30 / 92 patterns 0:12
did 40 / 92 patterns 0:12
did 50 / 92 patterns 0:12
did 60 / 92 patterns 0:12
did 70 / 92 patterns 0:12
did 80 / 92 patterns 0:12
did 90 / 92 patterns 0:12
did 92 / 92 patterns 0:12
Time used: 0:12
Model 3: discrete
TREE # 1
(1, 2, (3, (4, 5))); MP score: 63
0.049165 0.032878 0.000000 0.017555 0.049564 0.086141 0.041582 2.923644 0.331355 0.382499 0.065025 0.162329 0.271802
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 10.589750
np = 13
lnL0 = -1336.455606
Iterating by ming2
Initial: fx= 1336.455606
x= 0.04917 0.03288 0.00000 0.01755 0.04956 0.08614 0.04158 2.92364 0.33136 0.38250 0.06502 0.16233 0.27180
1 h-m-p 0.0000 0.0008 8617.6486 CYYYYC 1333.637796 5 0.0000 25 | 0/13
2 h-m-p 0.0001 0.0003 65.2541 CYCCC 1333.389578 4 0.0001 48 | 0/13
3 h-m-p 0.0002 0.0020 41.3543 +YCCC 1332.722145 3 0.0011 70 | 0/13
4 h-m-p 0.0000 0.0002 149.4356 ++ 1331.828021 m 0.0002 86 | 1/13
5 h-m-p 0.0000 0.0003 476.2173 ++ 1330.057454 m 0.0003 102 | 2/13
6 h-m-p 0.0003 0.0155 307.1477 -CC 1330.052653 1 0.0000 121 | 2/13
7 h-m-p 0.0049 0.0612 1.5618 CCCC 1329.842347 3 0.0079 143 | 2/13
8 h-m-p 0.0005 0.0027 16.9178 CCC 1329.811516 2 0.0002 163 | 2/13
9 h-m-p 0.0008 0.0260 4.3859 CC 1329.800957 1 0.0007 181 | 2/13
10 h-m-p 0.0007 0.1539 4.1584 +++YCCC 1329.189144 3 0.0321 205 | 2/13
11 h-m-p 0.0091 0.2141 14.6873 +CCCCC 1326.936469 4 0.0605 230 | 2/13
12 h-m-p 1.3640 6.8202 0.4779 YYYYC 1326.213151 4 1.3260 250 | 1/13
13 h-m-p 0.0655 2.1281 9.6751 --YCCC 1326.190894 3 0.0005 284 | 1/13
14 h-m-p 0.0160 8.0000 0.6784 +++CCCC 1325.506106 3 1.5091 309 | 0/13
15 h-m-p 0.8309 8.0000 1.2321 YCYC 1324.853555 3 1.4592 341 | 0/13
16 h-m-p 1.6000 8.0000 0.5883 CCCCC 1324.149244 4 1.9733 365 | 0/13
17 h-m-p 0.4391 7.2286 2.6440 +YYCC 1323.177477 3 1.3046 399 | 0/13
18 h-m-p 1.6000 8.0000 1.6153 CCCC 1322.434542 3 1.5123 421 | 0/13
19 h-m-p 1.6000 8.0000 1.2536 YCCCC 1322.162103 4 0.8071 444 | 0/13
20 h-m-p 0.6069 8.0000 1.6671 +YCC 1321.886550 2 1.7635 464 | 0/13
21 h-m-p 1.6000 8.0000 1.2176 CC 1321.780830 1 1.8313 482 | 0/13
22 h-m-p 1.6000 8.0000 1.0513 YC 1321.755972 1 0.9343 499 | 0/13
23 h-m-p 1.6000 8.0000 0.4374 C 1321.747658 0 1.6883 515 | 0/13
24 h-m-p 1.6000 8.0000 0.0467 +YC 1321.738428 1 4.8344 546 | 0/13
25 h-m-p 1.6000 8.0000 0.0621 ++ 1321.688880 m 8.0000 575 | 0/13
26 h-m-p 0.6495 8.0000 0.7643 +YYC 1321.640448 2 2.3648 607 | 0/13
27 h-m-p 1.6000 8.0000 0.3035 +CYC 1321.456969 2 6.6249 640 | 0/13
28 h-m-p 0.2649 1.3243 1.7002 +YCCC 1321.379167 3 0.7775 675 | 0/13
29 h-m-p 0.0587 0.2933 0.9894 ++ 1321.328795 m 0.2933 691 | 1/13
30 h-m-p 0.2395 8.0000 1.2111 CC 1321.322576 1 0.0709 722 | 1/13
31 h-m-p 0.5892 8.0000 0.1458 CCC 1321.286665 2 0.8859 742 | 1/13
32 h-m-p 0.4699 8.0000 0.2748 YC 1321.275534 1 0.9012 771 | 1/13
33 h-m-p 1.6000 8.0000 0.0944 CCC 1321.262936 2 2.3538 803 | 1/13
34 h-m-p 1.3920 8.0000 0.1597 YC 1321.260511 1 0.8746 832 | 1/13
35 h-m-p 1.1224 8.0000 0.1244 +YC 1321.258385 1 3.4933 862 | 1/13
36 h-m-p 1.6000 8.0000 0.0231 +C 1321.251084 0 6.3843 891 | 1/13
37 h-m-p 1.4309 8.0000 0.1030 YC 1321.231969 1 3.4118 920 | 1/13
38 h-m-p 1.6000 8.0000 0.0876 YC 1321.230994 1 1.0743 949 | 1/13
39 h-m-p 1.6000 8.0000 0.0114 YC 1321.230943 1 1.0407 978 | 1/13
40 h-m-p 1.6000 8.0000 0.0014 Y 1321.230942 0 1.0512 1006 | 1/13
41 h-m-p 1.6000 8.0000 0.0002 Y 1321.230942 0 1.1972 1034 | 1/13
42 h-m-p 1.6000 8.0000 0.0000 C 1321.230942 0 0.5781 1062 | 1/13
43 h-m-p 0.4077 8.0000 0.0000 C 1321.230942 0 0.4077 1090 | 1/13
44 h-m-p 0.6042 8.0000 0.0000 Y 1321.230942 0 0.6042 1118 | 1/13
45 h-m-p 1.4982 8.0000 0.0000 ----------Y 1321.230942 0 0.0000 1156
Out..
lnL = -1321.230942
1157 lfun, 4628 eigenQcodon, 24297 P(t)
Time used: 0:20
Model 7: beta
TREE # 1
(1, 2, (3, (4, 5))); MP score: 63
0.045969 0.032981 0.000000 0.017649 0.048363 0.087613 0.042009 2.859351 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.837452
np = 10
lnL0 = -1338.460099
Iterating by ming2
Initial: fx= 1338.460099
x= 0.04597 0.03298 0.00000 0.01765 0.04836 0.08761 0.04201 2.85935 0.66567 1.54913
1 h-m-p 0.0000 0.0014 4866.9965 CYYCYCCC 1336.150191 7 0.0000 26 | 0/10
2 h-m-p 0.0001 0.0004 67.0056 CYCCC 1335.852111 4 0.0001 46 | 0/10
3 h-m-p 0.0002 0.0265 45.4688 CYC 1335.681951 2 0.0002 62 | 0/10
4 h-m-p 0.0003 0.0085 31.1430 +YCCCC 1334.890162 4 0.0024 83 | 0/10
5 h-m-p 0.0002 0.0015 406.6465 +YYCCC 1332.237619 4 0.0006 103 | 0/10
6 h-m-p 0.0001 0.0006 594.6716 CYCCCC 1330.820944 5 0.0002 125 | 0/10
7 h-m-p 0.0004 0.0022 56.5602 YYCC 1330.669070 3 0.0003 142 | 0/10
8 h-m-p 0.0014 0.0079 12.4125 YC 1330.655986 1 0.0002 156 | 0/10
9 h-m-p 0.0014 0.6846 2.8260 +++YCCCC 1329.314851 4 0.1939 179 | 0/10
10 h-m-p 0.8582 4.2911 0.5686 YCCCCC 1328.450653 5 0.9412 201 | 0/10
11 h-m-p 0.6399 3.1996 0.5572 CYCYC 1327.986116 4 1.2666 231 | 0/10
12 h-m-p 0.2021 1.0104 1.4845 +YYYYYYYYC 1325.707030 8 0.8084 263 | 0/10
13 h-m-p 0.0063 0.0313 9.2476 YYCC 1325.678693 3 0.0053 280 | 0/10
14 h-m-p 0.1143 0.6680 0.4312 YCYCCC 1325.410654 5 0.2881 301 | 0/10
15 h-m-p 0.2958 6.3250 0.4198 +YCC 1324.972139 2 0.7797 328 | 0/10
16 h-m-p 0.6123 3.0613 0.0980 CCCCC 1324.849248 4 0.8171 359 | 0/10
17 h-m-p 0.8926 8.0000 0.0897 YC 1324.828222 1 0.5817 383 | 0/10
18 h-m-p 1.3405 6.7026 0.0332 CYC 1324.823883 2 1.0105 409 | 0/10
19 h-m-p 1.6000 8.0000 0.0174 YCC 1324.822534 2 0.9442 435 | 0/10
20 h-m-p 1.3011 8.0000 0.0126 C 1324.821793 0 1.1887 458 | 0/10
21 h-m-p 1.4957 8.0000 0.0100 YC 1324.821533 1 0.7336 482 | 0/10
22 h-m-p 1.0373 8.0000 0.0071 CC 1324.821314 1 1.6785 507 | 0/10
23 h-m-p 1.6000 8.0000 0.0024 C 1324.821243 0 1.3434 530 | 0/10
24 h-m-p 0.3960 8.0000 0.0082 C 1324.821184 0 0.5490 553 | 0/10
25 h-m-p 1.2628 8.0000 0.0036 Y 1324.821137 0 1.2628 576 | 0/10
26 h-m-p 1.6000 8.0000 0.0013 C 1324.821104 0 1.5341 599 | 0/10
27 h-m-p 0.9795 8.0000 0.0021 C 1324.821074 0 1.4402 622 | 0/10
28 h-m-p 1.6000 8.0000 0.0011 -Y 1324.821074 0 0.0760 646 | 0/10
29 h-m-p 0.0579 8.0000 0.0014 ++C 1324.821071 0 0.9161 671 | 0/10
30 h-m-p 0.7206 8.0000 0.0018 ---------Y 1324.821071 0 0.0000 703 | 0/10
31 h-m-p 0.0007 0.3742 3.7070 -----------.. | 0/10
32 h-m-p 0.0000 0.0058 1.1015 Y 1324.821068 0 0.0000 748 | 0/10
33 h-m-p 0.0000 0.0035 1.3694 C 1324.821061 0 0.0000 761 | 0/10
34 h-m-p 0.0057 2.8609 0.0354 --C 1324.821061 0 0.0001 776 | 0/10
35 h-m-p 0.0131 6.5641 0.0080 --C 1324.821061 0 0.0002 801 | 0/10
36 h-m-p 0.0160 8.0000 0.0026 -------C 1324.821061 0 0.0000 831 | 0/10
37 h-m-p 0.0160 8.0000 0.0009 ---C 1324.821061 0 0.0001 857 | 0/10
38 h-m-p 0.0160 8.0000 0.0012 Y 1324.821061 0 0.0022 880 | 0/10
39 h-m-p 0.0160 8.0000 0.0038 C 1324.821061 0 0.0032 903 | 0/10
40 h-m-p 0.0160 8.0000 0.0232 Y 1324.821061 0 0.0075 926 | 0/10
41 h-m-p 0.0160 8.0000 0.1565 --Y 1324.821061 0 0.0005 951 | 0/10
42 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/10
43 h-m-p 0.0160 8.0000 0.0348 ------------- | 0/10
44 h-m-p 0.0160 8.0000 0.0348 -------------
Out..
lnL = -1324.821061
1057 lfun, 11627 eigenQcodon, 73990 P(t)
Time used: 0:45
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, 5))); MP score: 63
initial w for M8:NSbetaw>1 reset.
0.047331 0.033433 0.000000 0.018146 0.048534 0.088909 0.040776 2.604168 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.946350
np = 12
lnL0 = -1337.250534
Iterating by ming2
Initial: fx= 1337.250534
x= 0.04733 0.03343 0.00000 0.01815 0.04853 0.08891 0.04078 2.60417 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0014 1229.6024 CYYCCCCC 1335.433674 7 0.0000 41 | 0/12
2 h-m-p 0.0000 0.0006 114.2693 +CYYCCC 1333.193285 5 0.0003 77 | 0/12
3 h-m-p 0.0001 0.0004 268.4056 YCC 1331.926052 2 0.0001 107 | 0/12
4 h-m-p 0.0001 0.0005 116.6488 +YYCCC 1330.203472 4 0.0004 141 | 0/12
5 h-m-p 0.0003 0.0014 43.8712 YCCC 1329.776671 3 0.0006 173 | 0/12
6 h-m-p 0.0003 0.0039 89.5272 +YCYCYCCC 1326.644351 7 0.0020 212 | 0/12
7 h-m-p 0.0003 0.0014 124.8108 CCCCC 1326.102969 4 0.0003 247 | 0/12
8 h-m-p 0.0097 0.0573 4.3983 -YC 1326.090375 1 0.0011 276 | 0/12
9 h-m-p 0.0007 0.1312 6.7391 ++CCC 1325.839526 2 0.0164 309 | 0/12
10 h-m-p 0.0006 0.0129 188.5799 +CCC 1324.849578 2 0.0025 341 | 0/12
11 h-m-p 0.4588 4.0430 1.0123 CCC 1323.572448 2 0.7250 372 | 0/12
12 h-m-p 1.0525 5.2626 0.1244 YCCC 1323.348382 3 0.6855 404 | 0/12
13 h-m-p 0.5813 8.0000 0.1467 YC 1323.293034 1 1.3924 432 | 0/12
14 h-m-p 1.1137 8.0000 0.1834 +YCCC 1323.209600 3 3.0564 465 | 0/12
15 h-m-p 0.6051 3.0255 0.5726 CYCYC 1323.094832 4 1.0670 498 | 0/12
16 h-m-p 0.7024 3.5122 0.8515 CYCCC 1322.832489 4 1.2330 532 | 0/12
17 h-m-p 1.6000 8.0000 0.6450 CCC 1322.729404 2 0.3114 563 | 0/12
18 h-m-p 0.1201 3.5012 1.6716 +YCCCC 1322.413469 4 1.0767 598 | 0/12
19 h-m-p 0.9194 4.5972 1.7127 CCCCC 1322.102665 4 1.3083 633 | 0/12
20 h-m-p 0.6815 3.4075 2.8978 YCC 1321.842366 2 0.4294 663 | 0/12
21 h-m-p 0.5659 7.8977 2.1986 +YYCC 1321.533968 3 1.6374 695 | 0/12
22 h-m-p 1.0934 5.4671 1.6423 YYCCCCC 1321.412566 6 1.2989 732 | 0/12
23 h-m-p 0.5502 2.7512 1.6458 CCCCC 1321.353132 4 0.7631 767 | 0/12
24 h-m-p 0.9050 4.5248 0.8105 YYC 1321.340798 2 0.7097 796 | 0/12
25 h-m-p 1.6000 8.0000 0.2074 YC 1321.335240 1 0.9968 824 | 0/12
26 h-m-p 0.6537 8.0000 0.3163 +YC 1321.331770 1 1.9441 853 | 0/12
27 h-m-p 1.6000 8.0000 0.2568 CC 1321.329480 1 1.3820 882 | 0/12
28 h-m-p 1.6000 8.0000 0.0491 YC 1321.329201 1 0.9997 910 | 0/12
29 h-m-p 1.6000 8.0000 0.0294 YC 1321.329082 1 1.1583 938 | 0/12
30 h-m-p 1.3422 8.0000 0.0254 C 1321.329044 0 1.4090 965 | 0/12
31 h-m-p 1.6000 8.0000 0.0021 C 1321.329030 0 2.0550 992 | 0/12
32 h-m-p 0.6691 8.0000 0.0063 +C 1321.329017 0 3.1101 1020 | 0/12
33 h-m-p 1.6000 8.0000 0.0050 C 1321.329015 0 1.7941 1047 | 0/12
34 h-m-p 1.6000 8.0000 0.0018 C 1321.329015 0 1.3144 1074 | 0/12
35 h-m-p 1.6000 8.0000 0.0004 Y 1321.329015 0 0.9831 1101 | 0/12
36 h-m-p 1.6000 8.0000 0.0000 C 1321.329015 0 1.6000 1128 | 0/12
37 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/12
38 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -1321.329015
1208 lfun, 14496 eigenQcodon, 93016 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1330.757458 S = -1264.503858 -59.732541
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 92 patterns 1:15
did 20 / 92 patterns 1:15
did 30 / 92 patterns 1:16
did 40 / 92 patterns 1:16
did 50 / 92 patterns 1:16
did 60 / 92 patterns 1:16
did 70 / 92 patterns 1:16
did 80 / 92 patterns 1:17
did 90 / 92 patterns 1:17
did 92 / 92 patterns 1:17
Time used: 1:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=245
D_melanogaster_Fer1HCH-PI MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ
D_sechellia_Fer1HCH-PI MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ
D_simulans_Fer1HCH-PI MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ
D_yakuba_Fer1HCH-PI MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ
D_erecta_Fer1HCH-PI MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ
*****.**:******************:*********::**: :::****
D_melanogaster_Fer1HCH-PI NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL
D_sechellia_Fer1HCH-PI NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
D_simulans_Fer1HCH-PI NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
D_yakuba_Fer1HCH-PI NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL
D_erecta_Fer1HCH-PI NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL
* .* ****************:**************:*************
D_melanogaster_Fer1HCH-PI AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
D_sechellia_Fer1HCH-PI AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
D_simulans_Fer1HCH-PI AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
D_yakuba_Fer1HCH-PI AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
D_erecta_Fer1HCH-PI AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD
**************************************************
D_melanogaster_Fer1HCH-PI LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
D_sechellia_Fer1HCH-PI LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
D_simulans_Fer1HCH-PI LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL
D_yakuba_Fer1HCH-PI LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL
D_erecta_Fer1HCH-PI LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL
**.*************:************************.********
D_melanogaster_Fer1HCH-PI VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
D_sechellia_Fer1HCH-PI VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
D_simulans_Fer1HCH-PI VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
D_yakuba_Fer1HCH-PI VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL
D_erecta_Fer1HCH-PI VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
*******************************:*************
>D_melanogaster_Fer1HCH-PI ATGGTGAAACTAATTGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC CTATGGAGATTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG TGAGAGAGCTTCAAAGGGAGCGAGAAGAGCATCAACTAAAAGAAAAACAA AACCTAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT TCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG GCATGCGCAATCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC CGAGCACTTCTTCAAGGCCGCCAAGGAGGAACGTGAGCACGGATCCAAGC TGGTGGAGTACCTGTCCATGCGCGGTCAACTGACCGAGGGAGTCAGCGAT CTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC GCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCACTACCACCTG GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG CGAGCTCGCCGGCAAGCTGACCACTCTCAAGAAGATGATGGACACCAACG GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG >D_sechellia_Fer1HCH-PI ATGGTGAAACTAATCGTTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC CTATGGAGATTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG TGAGAGAGCTGCAAAGGGAGCGAGAAGAGCATAAACTTAAAGAAAAACAA AACCAAAACCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT TCCTGAGATTACCAAGGATTGGGTGGACATGAAGGATGCCTGCATAAAGG GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC CGAGCACTTCTTCAAGGCTGCCAAGGAGGAGCGTGAGCACGGATCCAAGC TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGAGTCAGCGAT CTGATCTCTGTTCCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC GCAAGCTGATCCAGACCTGCGAGAACAAGCCTTACAACCACTACCACCTG GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG >D_simulans_Fer1HCH-PI ATGGTGAAACTAATCGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC CTATGGAGATTTCAAGTGCGCTCTTTCCAAGAAAGAAAGCAAGAGTTTCG TGAGAGAGCTGCAAAGGGAGCGAGAAGAGCAGCAACTTAAAGAAAAACAA AACCCAAACCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCAGT TCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTG GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGC CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGATCCAAGC TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGAGTCAGCGAT CTGATCACTGTACCGACTGTGGCCAAGCAGGAGTGGACCGATGGTGCCGC CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC GCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCACTACCACCTG GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG >D_yakuba_Fer1HCH-PI ATGGTGAAATTAATCGCTAGCCTGCTCCTGTTGGCCGTGGTGGCCCAGGC CTATGGAGACTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG TGAGAGAGCTGCAGAAAGAGCGAAAAGCGCAGCAAGTTAAAGAAAAACAA AACTCAAACCATGGAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT TCCTGAGATTACCAGGGACTGGGTGGACATGAAGGATGCCTGCATAAAGG GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACCTG GCCATGGGTGCCTACTTCTCCCGTGACACCGTCAACCGCCCTGGATTCGC CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGATCCAAGC TGGTTGAGTACCTGTCCATGCGCGGTCAGCTGACCGAGGGCGTTAGCGAT TTGATTAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGCGCTTC CGCCCTGTCCGACGCGCTCGATCTGGAGATCAAGGTGACCAAGTCCATCC GCAAGCTGATCCAGACCTGCGAGAGCAAGCCATACAACCACTACCACCTG GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG AGAGCTCGCCGGCAAGCTGACCACTCTAAAGAAGATGATGGACTCCAACG GCGAACTGGGCGAGTTCCTGTTCGACAAGACCTTG >D_erecta_Fer1HCH-PI ATGGTGAAATTAATCGCTAGCCTGTTCCTGTTGGCCGTGGTGGCCCAGGC CTATGGAGACTTCAAGTGCGCTCTTTCCAAGCAAGAAAGCAAGAGTTTCG TGAGAGAACTGCGGAAAGAGCGAGAAGCGCAGCAGCTTAAAGAAAAACAA AACCCAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGCTCCCTGGCTGT TCCTGAGATTACCAAGGATTGGGTGGACATGAAGGATGCCTGCATAAAGG GCATGCGCCACCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACCTG GCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCCGGCTTCGC CGAGCACTTCTTCAAGGCCGCCAAGGAGGAGCGTGAGCACGGTTCCAAGC TGGTGGAGTACCTGTCCATGCGCGGTCAGTTGACCGAGGGCGTCAGCGAT CTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACCGATGGCGCCGC CGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACCAAGTCCATCC GCAAGCTGATCCAGACCTGCGAGGGCAAGCCATACAACCACTACCACCTG GTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCCACGGACAGCG CGAGCTCGCCGGCAAGCTGACCACTCTGAAGAAGATGATGGACACCAACG GCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTG
>D_melanogaster_Fer1HCH-PI MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQ NLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYL AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL >D_sechellia_Fer1HCH-PI MVKLIVSLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHKLKEKQ NQNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD LISVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL >D_simulans_Fer1HCH-PI MVKLIASLLLLAVVAQAYGDFKCALSKKESKSFVRELQREREEQQLKEKQ NPNHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD LITVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHL VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL >D_yakuba_Fer1HCH-PI MVKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQKERKAQQVKEKQ NSNHGGQDQECKGSLAVPEITRDWVDMKDACIKGMRHQIQEEINASYQYL AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD LINVPTVAKQEWTDGASALSDALDLEIKVTKSIRKLIQTCESKPYNHYHL VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDSNGELGEFLFDKTL >D_erecta_Fer1HCH-PI MVKLIASLFLLAVVAQAYGDFKCALSKQESKSFVRELRKEREAQQLKEKQ NPSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRHQIQEEINASYQYL AMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSD LINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCEGKPYNHYHL VDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL
#NEXUS
[ID: 8567111570]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_Fer1HCH-PI
D_sechellia_Fer1HCH-PI
D_simulans_Fer1HCH-PI
D_yakuba_Fer1HCH-PI
D_erecta_Fer1HCH-PI
;
end;
begin trees;
translate
1 D_melanogaster_Fer1HCH-PI,
2 D_sechellia_Fer1HCH-PI,
3 D_simulans_Fer1HCH-PI,
4 D_yakuba_Fer1HCH-PI,
5 D_erecta_Fer1HCH-PI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02333272,2:0.01456272,(3:0.006781307,(4:0.04656526,5:0.01999134)1.000:0.02638974)0.505:0.003419669);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02333272,2:0.01456272,(3:0.006781307,(4:0.04656526,5:0.01999134):0.02638974):0.003419669);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1396.78 -1404.08
2 -1396.60 -1408.78
--------------------------------------
TOTAL -1396.69 -1408.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.150819 0.000921 0.098486 0.212677 0.147208 995.09 1116.57 1.000
r(A<->C){all} 0.091828 0.001327 0.025487 0.164307 0.088437 689.43 749.84 1.000
r(A<->G){all} 0.186122 0.002836 0.086653 0.285471 0.181476 705.03 705.13 1.000
r(A<->T){all} 0.136818 0.003449 0.034233 0.257040 0.129492 480.60 507.93 1.001
r(C<->G){all} 0.020423 0.000237 0.000011 0.049489 0.017069 1090.84 1150.26 1.001
r(C<->T){all} 0.459414 0.006329 0.303548 0.611546 0.459213 587.83 615.62 1.000
r(G<->T){all} 0.105394 0.002026 0.019633 0.190432 0.100535 589.25 622.89 1.000
pi(A){all} 0.256793 0.000236 0.227091 0.287115 0.256543 1195.15 1261.36 1.000
pi(C){all} 0.284907 0.000265 0.253089 0.316794 0.284408 1331.87 1375.37 1.000
pi(G){all} 0.283795 0.000264 0.250989 0.313982 0.283635 1329.84 1381.94 1.000
pi(T){all} 0.174505 0.000190 0.147354 0.201281 0.174064 1314.38 1325.94 1.001
alpha{1,2} 0.130575 0.024133 0.000111 0.382277 0.091025 1106.14 1140.29 1.000
alpha{3} 0.941946 0.316016 0.127053 2.115277 0.828221 1304.79 1402.89 1.000
pinvar{all} 0.529853 0.018971 0.230464 0.768644 0.549333 872.97 1017.11 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/247/Fer1HCH-PI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 245
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 | Ser TCT 0 1 0 0 0 | Tyr TAT 2 2 2 2 2 | Cys TGT 0 0 0 0 0
TTC 8 8 8 8 9 | TCC 8 8 8 10 8 | TAC 7 7 7 7 7 | TGC 4 4 4 4 4
Leu TTA 0 0 0 1 1 | TCA 0 0 0 1 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 3 3 3 2 | TCG 0 0 0 0 0 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 1 2 | Pro CCT 2 3 2 2 1 | His CAT 2 2 1 1 1 | Arg CGT 1 1 1 2 1
CTC 5 4 4 4 3 | CCC 1 0 1 0 1 | CAC 5 6 6 6 6 | CGC 6 6 6 4 6
CTA 3 1 1 1 0 | CCA 0 0 1 1 2 | Gln CAA 7 6 5 5 4 | CGA 1 1 1 2 1
CTG 17 18 18 17 19 | CCG 1 1 1 1 1 | CAG 8 9 10 11 11 | CGG 0 0 0 0 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 1 1 2 1 | Thr ACT 2 2 3 2 2 | Asn AAT 2 0 0 1 1 | Ser AGT 1 1 1 1 1
ATC 6 7 7 6 7 | ACC 10 10 10 9 10 | AAC 6 7 7 6 5 | AGC 4 3 3 4 4
ATA 1 1 1 1 1 | ACA 0 0 0 0 0 | Lys AAA 4 5 5 6 5 | Arg AGA 1 1 1 1 1
Met ATG 7 7 7 7 7 | ACG 0 0 0 0 0 | AAG 18 18 18 17 18 | AGG 1 1 1 1 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 3 1 4 1 | Ala GCT 3 3 2 4 3 | Asp GAT 4 5 4 4 4 | Gly GGT 4 4 4 4 4
GTC 3 3 3 2 3 | GCC 16 15 16 13 16 | GAC 9 8 9 9 9 | GGC 6 6 6 7 10
GTA 0 0 1 0 0 | GCA 0 0 1 0 0 | Glu GAA 6 5 5 3 6 | GGA 5 5 5 5 2
GTG 10 9 9 9 10 | GCG 0 0 0 2 1 | GAG 19 20 20 19 18 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Fer1HCH-PI
position 1: T:0.13469 C:0.24898 A:0.26531 G:0.35102
position 2: T:0.27347 C:0.17551 A:0.40408 G:0.14694
position 3: T:0.11429 C:0.42449 A:0.11429 G:0.34694
Average T:0.17415 C:0.28299 A:0.26122 G:0.28163
#2: D_sechellia_Fer1HCH-PI
position 1: T:0.14286 C:0.24490 A:0.26122 G:0.35102
position 2: T:0.27347 C:0.17551 A:0.40816 G:0.14286
position 3: T:0.12245 C:0.41633 A:0.10204 G:0.35918
Average T:0.17959 C:0.27891 A:0.25714 G:0.28435
#3: D_simulans_Fer1HCH-PI
position 1: T:0.13878 C:0.24490 A:0.26531 G:0.35102
position 2: T:0.26939 C:0.18367 A:0.40408 G:0.14286
position 3: T:0.09796 C:0.42857 A:0.11020 G:0.36327
Average T:0.16871 C:0.28571 A:0.25986 G:0.28571
#4: D_yakuba_Fer1HCH-PI
position 1: T:0.15510 C:0.23673 A:0.26122 G:0.34694
position 2: T:0.26939 C:0.18367 A:0.39592 G:0.15102
position 3: T:0.12245 C:0.40408 A:0.11020 G:0.36327
Average T:0.18231 C:0.27483 A:0.25578 G:0.28707
#5: D_erecta_Fer1HCH-PI
position 1: T:0.14286 C:0.24490 A:0.25714 G:0.35510
position 2: T:0.26939 C:0.18367 A:0.39592 G:0.15102
position 3: T:0.09796 C:0.44082 A:0.09388 G:0.36735
Average T:0.17007 C:0.28980 A:0.24898 G:0.29116
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 1 | Tyr Y TAT 10 | Cys C TGT 0
TTC 41 | TCC 42 | TAC 35 | TGC 20
Leu L TTA 2 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 13 | TCG 0 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 9 | Pro P CCT 10 | His H CAT 7 | Arg R CGT 6
CTC 20 | CCC 3 | CAC 29 | CGC 28
CTA 6 | CCA 4 | Gln Q CAA 27 | CGA 6
CTG 89 | CCG 5 | CAG 49 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 7 | Thr T ACT 11 | Asn N AAT 4 | Ser S AGT 5
ATC 33 | ACC 49 | AAC 31 | AGC 18
ATA 5 | ACA 0 | Lys K AAA 25 | Arg R AGA 5
Met M ATG 35 | ACG 0 | AAG 89 | AGG 4
------------------------------------------------------------------------------
Val V GTT 10 | Ala A GCT 15 | Asp D GAT 21 | Gly G GGT 20
GTC 14 | GCC 76 | GAC 44 | GGC 35
GTA 1 | GCA 1 | Glu E GAA 25 | GGA 22
GTG 47 | GCG 3 | GAG 96 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14286 C:0.24408 A:0.26204 G:0.35102
position 2: T:0.27102 C:0.18041 A:0.40163 G:0.14694
position 3: T:0.11102 C:0.42286 A:0.10612 G:0.36000
Average T:0.17497 C:0.28245 A:0.25660 G:0.28599
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Fer1HCH-PI
D_sechellia_Fer1HCH-PI 0.1665 (0.0125 0.0748)
D_simulans_Fer1HCH-PI 0.1730 (0.0107 0.0617) 0.3525 (0.0107 0.0303)
D_yakuba_Fer1HCH-PI 0.1379 (0.0242 0.1758) 0.1828 (0.0288 0.1576) 0.1435 (0.0215 0.1500)
D_erecta_Fer1HCH-PI 0.1125 (0.0161 0.1429) 0.2465 (0.0233 0.0946) 0.1590 (0.0161 0.1011) 0.1622 (0.0197 0.1215)
Model 0: one-ratio
TREE # 1: (1, 2, (3, (4, 5))); MP score: 63
lnL(ntime: 7 np: 9): -1334.841805 +0.000000
6..1 6..2 6..7 7..3 7..8 8..4 8..5
0.051507 0.032462 0.004954 0.012705 0.052967 0.089672 0.042441 2.597765 0.130050
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.28671
(1: 0.051507, 2: 0.032462, (3: 0.012705, (4: 0.089672, 5: 0.042441): 0.052967): 0.004954);
(D_melanogaster_Fer1HCH-PI: 0.051507, D_sechellia_Fer1HCH-PI: 0.032462, (D_simulans_Fer1HCH-PI: 0.012705, (D_yakuba_Fer1HCH-PI: 0.089672, D_erecta_Fer1HCH-PI: 0.042441): 0.052967): 0.004954);
Detailed output identifying parameters
kappa (ts/tv) = 2.59777
omega (dN/dS) = 0.13005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.052 599.5 135.5 0.1300 0.0077 0.0591 4.6 8.0
6..2 0.032 599.5 135.5 0.1300 0.0048 0.0373 2.9 5.0
6..7 0.005 599.5 135.5 0.1300 0.0007 0.0057 0.4 0.8
7..3 0.013 599.5 135.5 0.1300 0.0019 0.0146 1.1 2.0
7..8 0.053 599.5 135.5 0.1300 0.0079 0.0608 4.7 8.2
8..4 0.090 599.5 135.5 0.1300 0.0134 0.1029 8.0 13.9
8..5 0.042 599.5 135.5 0.1300 0.0063 0.0487 3.8 6.6
tree length for dN: 0.0428
tree length for dS: 0.3291
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, (4, 5))); MP score: 63
lnL(ntime: 7 np: 10): -1324.483592 +0.000000
6..1 6..2 6..7 7..3 7..8 8..4 8..5
0.055322 0.034909 0.004714 0.013976 0.059243 0.100832 0.043445 2.699111 0.856967 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.31244
(1: 0.055322, 2: 0.034909, (3: 0.013976, (4: 0.100832, 5: 0.043445): 0.059243): 0.004714);
(D_melanogaster_Fer1HCH-PI: 0.055322, D_sechellia_Fer1HCH-PI: 0.034909, (D_simulans_Fer1HCH-PI: 0.013976, (D_yakuba_Fer1HCH-PI: 0.100832, D_erecta_Fer1HCH-PI: 0.043445): 0.059243): 0.004714);
Detailed output identifying parameters
kappa (ts/tv) = 2.69911
dN/dS (w) for site classes (K=2)
p: 0.85697 0.14303
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.055 598.6 136.4 0.1430 0.0087 0.0611 5.2 8.3
6..2 0.035 598.6 136.4 0.1430 0.0055 0.0385 3.3 5.3
6..7 0.005 598.6 136.4 0.1430 0.0007 0.0052 0.4 0.7
7..3 0.014 598.6 136.4 0.1430 0.0022 0.0154 1.3 2.1
7..8 0.059 598.6 136.4 0.1430 0.0094 0.0654 5.6 8.9
8..4 0.101 598.6 136.4 0.1430 0.0159 0.1113 9.5 15.2
8..5 0.043 598.6 136.4 0.1430 0.0069 0.0479 4.1 6.5
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, (4, 5))); MP score: 63
lnL(ntime: 7 np: 12): -1321.416181 +0.000000
6..1 6..2 6..7 7..3 7..8 8..4 8..5
0.067871 0.043174 0.006012 0.017099 0.071498 0.124977 0.055551 2.923644 0.877859 0.114042 0.016224 17.325367
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.38618
(1: 0.067871, 2: 0.043174, (3: 0.017099, (4: 0.124977, 5: 0.055551): 0.071498): 0.006012);
(D_melanogaster_Fer1HCH-PI: 0.067871, D_sechellia_Fer1HCH-PI: 0.043174, (D_simulans_Fer1HCH-PI: 0.017099, (D_yakuba_Fer1HCH-PI: 0.124977, D_erecta_Fer1HCH-PI: 0.055551): 0.071498): 0.006012);
Detailed output identifying parameters
kappa (ts/tv) = 2.92364
dN/dS (w) for site classes (K=3)
p: 0.87786 0.11404 0.00810
w: 0.01622 1.00000 17.32537
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.068 596.8 138.2 0.2686 0.0150 0.0557 8.9 7.7
6..2 0.043 596.8 138.2 0.2686 0.0095 0.0354 5.7 4.9
6..7 0.006 596.8 138.2 0.2686 0.0013 0.0049 0.8 0.7
7..3 0.017 596.8 138.2 0.2686 0.0038 0.0140 2.2 1.9
7..8 0.071 596.8 138.2 0.2686 0.0158 0.0587 9.4 8.1
8..4 0.125 596.8 138.2 0.2686 0.0276 0.1026 16.4 14.2
8..5 0.056 596.8 138.2 0.2686 0.0122 0.0456 7.3 6.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.969* 16.824
153 N 0.860 15.045
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.964* 5.324 +- 2.510
153 N 0.949 5.266 +- 2.546
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.996 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.044 0.125 0.172 0.163 0.132 0.104 0.083 0.068 0.058 0.051
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.072
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.039 0.888
sum of density on p0-p1 = 1.000000
Time used: 0:12
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, (4, 5))); MP score: 63
lnL(ntime: 7 np: 13): -1321.230942 +0.000000
6..1 6..2 6..7 7..3 7..8 8..4 8..5
0.068040 0.043113 0.006146 0.016922 0.070739 0.123837 0.056474 2.859351 0.812942 0.178563 0.000001 0.647408 16.724067
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.38527
(1: 0.068040, 2: 0.043113, (3: 0.016922, (4: 0.123837, 5: 0.056474): 0.070739): 0.006146);
(D_melanogaster_Fer1HCH-PI: 0.068040, D_sechellia_Fer1HCH-PI: 0.043113, (D_simulans_Fer1HCH-PI: 0.016922, (D_yakuba_Fer1HCH-PI: 0.123837, D_erecta_Fer1HCH-PI: 0.056474): 0.070739): 0.006146);
Detailed output identifying parameters
kappa (ts/tv) = 2.85935
dN/dS (w) for site classes (K=3)
p: 0.81294 0.17856 0.00849
w: 0.00000 0.64741 16.72407
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.068 597.3 137.7 0.2577 0.0147 0.0572 8.8 7.9
6..2 0.043 597.3 137.7 0.2577 0.0093 0.0362 5.6 5.0
6..7 0.006 597.3 137.7 0.2577 0.0013 0.0052 0.8 0.7
7..3 0.017 597.3 137.7 0.2577 0.0037 0.0142 2.2 2.0
7..8 0.071 597.3 137.7 0.2577 0.0153 0.0594 9.1 8.2
8..4 0.124 597.3 137.7 0.2577 0.0268 0.1040 16.0 14.3
8..5 0.056 597.3 137.7 0.2577 0.0122 0.0474 7.3 6.5
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.986* 16.492
153 N 0.927 15.550
Time used: 0:20
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, (4, 5))); MP score: 63
check convergence..
lnL(ntime: 7 np: 10): -1324.821061 +0.000000
6..1 6..2 6..7 7..3 7..8 8..4 8..5
0.054211 0.034192 0.004758 0.013643 0.057772 0.098299 0.042923 2.604168 0.012569 0.078335
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.30580
(1: 0.054211, 2: 0.034192, (3: 0.013643, (4: 0.098299, 5: 0.042923): 0.057772): 0.004758);
(D_melanogaster_Fer1HCH-PI: 0.054211, D_sechellia_Fer1HCH-PI: 0.034192, (D_simulans_Fer1HCH-PI: 0.013643, (D_yakuba_Fer1HCH-PI: 0.098299, D_erecta_Fer1HCH-PI: 0.042923): 0.057772): 0.004758);
Detailed output identifying parameters
kappa (ts/tv) = 2.60417
Parameters in M7 (beta):
p = 0.01257 q = 0.07833
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.23391 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.054 599.5 135.5 0.1234 0.0078 0.0634 4.7 8.6
6..2 0.034 599.5 135.5 0.1234 0.0049 0.0400 3.0 5.4
6..7 0.005 599.5 135.5 0.1234 0.0007 0.0056 0.4 0.8
7..3 0.014 599.5 135.5 0.1234 0.0020 0.0160 1.2 2.2
7..8 0.058 599.5 135.5 0.1234 0.0083 0.0676 5.0 9.2
8..4 0.098 599.5 135.5 0.1234 0.0142 0.1150 8.5 15.6
8..5 0.043 599.5 135.5 0.1234 0.0062 0.0502 3.7 6.8
Time used: 0:45
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, (4, 5))); MP score: 63
check convergence..
lnL(ntime: 7 np: 12): -1321.329015 +0.000000
6..1 6..2 6..7 7..3 7..8 8..4 8..5
0.067769 0.043015 0.006132 0.016928 0.070695 0.123734 0.056077 2.860707 0.991600 0.063279 0.475729 16.773657
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.38435
(1: 0.067769, 2: 0.043015, (3: 0.016928, (4: 0.123734, 5: 0.056077): 0.070695): 0.006132);
(D_melanogaster_Fer1HCH-PI: 0.067769, D_sechellia_Fer1HCH-PI: 0.043015, (D_simulans_Fer1HCH-PI: 0.016928, (D_yakuba_Fer1HCH-PI: 0.123734, D_erecta_Fer1HCH-PI: 0.056077): 0.070695): 0.006132);
Detailed output identifying parameters
kappa (ts/tv) = 2.86071
Parameters in M8 (beta&w>1):
p0 = 0.99160 p = 0.06328 q = 0.47573
(p1 = 0.00840) w = 16.77366
dN/dS (w) for site classes (K=11)
p: 0.09916 0.09916 0.09916 0.09916 0.09916 0.09916 0.09916 0.09916 0.09916 0.09916 0.00840
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00032 0.00449 0.04226 0.26895 0.85982 16.77366
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.068 597.3 137.7 0.2575 0.0147 0.0570 8.8 7.8
6..2 0.043 597.3 137.7 0.2575 0.0093 0.0362 5.6 5.0
6..7 0.006 597.3 137.7 0.2575 0.0013 0.0052 0.8 0.7
7..3 0.017 597.3 137.7 0.2575 0.0037 0.0142 2.2 2.0
7..8 0.071 597.3 137.7 0.2575 0.0153 0.0594 9.1 8.2
8..4 0.124 597.3 137.7 0.2575 0.0268 0.1040 16.0 14.3
8..5 0.056 597.3 137.7 0.2575 0.0121 0.0471 7.2 6.5
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.981* 16.475
153 N 0.909 15.329
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.981* 4.241 +- 2.163
53 S 0.578 2.416 +- 2.115
153 N 0.974* 4.221 +- 2.176
192 N 0.577 2.391 +- 2.081
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.989 0.011 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.001 0.013 0.046 0.094 0.145 0.193 0.235 0.273
ws: 0.092 0.230 0.228 0.161 0.103 0.066 0.045 0.032 0.025 0.020
Time used: 1:17
Model 1: NearlyNeutral -1324.483592
Model 2: PositiveSelection -1321.416181
Model 0: one-ratio -1334.841805
Model 3: discrete -1321.230942
Model 7: beta -1324.821061
Model 8: beta&w>1 -1321.329015
Model 0 vs 1 20.716425999999956
Model 2 vs 1 6.134821999999986
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.969* 16.824
153 N 0.860 15.045
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.964* 5.324 +- 2.510
153 N 0.949 5.266 +- 2.546
Model 8 vs 7 6.984092000000146
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.981* 16.475
153 N 0.909 15.329
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1HCH-PI)
Pr(w>1) post mean +- SE for w
52 L 0.981* 4.241 +- 2.163
53 S 0.578 2.416 +- 2.115
153 N 0.974* 4.221 +- 2.176
192 N 0.577 2.391 +- 2.081
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
