--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 16 21:59:56 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/247/Fer1-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1892.86 -1913.16
2 -1892.64 -1905.22
--------------------------------------
TOTAL -1892.74 -1912.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.622640 0.007367 0.470615 0.799569 0.616661 1230.47 1250.84 1.000
r(A<->C){all} 0.061553 0.000379 0.024971 0.098904 0.059773 867.93 947.58 1.000
r(A<->G){all} 0.208318 0.002052 0.122859 0.294304 0.205246 647.81 682.98 1.000
r(A<->T){all} 0.094312 0.001205 0.029639 0.160972 0.091193 769.17 803.41 1.000
r(C<->G){all} 0.046498 0.000215 0.019669 0.076278 0.045225 779.43 925.44 1.000
r(C<->T){all} 0.552384 0.003282 0.436473 0.658348 0.552570 583.70 608.00 1.000
r(G<->T){all} 0.036934 0.000396 0.000663 0.072862 0.034422 992.12 1019.57 1.000
pi(A){all} 0.252147 0.000231 0.222449 0.281511 0.252480 976.57 1164.33 1.000
pi(C){all} 0.326028 0.000260 0.294563 0.356868 0.325771 1024.92 1151.48 1.000
pi(G){all} 0.276330 0.000244 0.246633 0.307922 0.276300 1070.74 1281.55 1.000
pi(T){all} 0.145495 0.000142 0.122941 0.169674 0.145173 798.83 955.11 1.000
alpha{1,2} 0.080926 0.000834 0.010227 0.128168 0.084505 1073.45 1178.69 1.000
alpha{3} 2.869701 0.768841 1.382711 4.675005 2.747479 1501.00 1501.00 1.000
pinvar{all} 0.480376 0.003100 0.373632 0.590202 0.484480 1184.58 1267.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1694.038989
Model 2: PositiveSelection -1694.03899
Model 0: one-ratio -1699.456849
Model 3: discrete -1692.844852
Model 7: beta -1693.313482
Model 8: beta&w>1 -1693.315795
Model 0 vs 1 10.835720000000038
Model 2 vs 1 2.000000222324161E-6
Model 8 vs 7 0.00462599999991653
>C1
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M
>C2
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGAEAAGAAASIFSSGSGMooo
o
>C3
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M
>C4
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG
M
>C5
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M
>C6
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSADMSDPGATASIFSSGSGM
o
>C7
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGSADMSDPGATASIFSSGSGM
o
>C8
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSADMSDPGATASIFSSGSGM
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=255
C1 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C2 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C3 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C4 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C5 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C6 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C7 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
C8 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
**************************************************
C1 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C2 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C3 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C4 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C5 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C6 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C7 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
C8 SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
**************************************************
C1 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C2 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C3 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C4 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C5 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C6 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C7 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
C8 FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
**************************************************
C1 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C2 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C3 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C4 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C5 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C6 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C7 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
C8 QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
**************************************************
C1 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
C2 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGA----EAAGAAASIFSSGSG
C3 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
C4 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG
C5 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
C6 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
C7 GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGS-ADMSDPGATASIFSSGSG
C8 GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
****** ***.**************:****: . .**:*****:***
C1 M----
C2 Moooo
C3 M----
C4 M----
C5 M----
C6 Mo---
C7 Mo---
C8 Mo---
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 251 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14502]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [14502]--->[14382]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/247/Fer1-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.442 Mb, Max= 30.883 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M----
>C2
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGA----EAAGAAASIFSSGSG
Moooo
>C3
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M----
>C4
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG
M----
>C5
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M----
>C6
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
Mo---
>C7
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGS-ADMSDPGATASIFSSGSG
Mo---
>C8
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
Mo---
FORMAT of file /tmp/tmp5704284194534072748aln Not Supported[FATAL:T-COFFEE]
>C1
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M----
>C2
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGA----EAAGAAASIFSSGSG
Moooo
>C3
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M----
>C4
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG
M----
>C5
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M----
>C6
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
Mo---
>C7
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGS-ADMSDPGATASIFSSGSG
Mo---
>C8
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
Mo---
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:255 S:99 BS:255
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES
BOT 0 1 98.38 C1 C2 98.38
TOP 1 0 98.38 C2 C1 98.38
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 99.20 C1 C4 99.20
TOP 3 0 99.20 C4 C1 99.20
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.60 C1 C6 99.60
TOP 5 0 99.60 C6 C1 99.60
BOT 0 6 98.40 C1 C7 98.40
TOP 6 0 98.40 C7 C1 98.40
BOT 0 7 99.60 C1 C8 99.60
TOP 7 0 99.60 C8 C1 99.60
BOT 1 2 98.38 C2 C3 98.38
TOP 2 1 98.38 C3 C2 98.38
BOT 1 3 97.57 C2 C4 97.57
TOP 3 1 97.57 C4 C2 97.57
BOT 1 4 98.38 C2 C5 98.38
TOP 4 1 98.38 C5 C2 98.38
BOT 1 5 97.98 C2 C6 97.98
TOP 5 1 97.98 C6 C2 97.98
BOT 1 6 96.77 C2 C7 96.77
TOP 6 1 96.77 C7 C2 96.77
BOT 1 7 97.98 C2 C8 97.98
TOP 7 1 97.98 C8 C2 97.98
BOT 2 3 99.20 C3 C4 99.20
TOP 3 2 99.20 C4 C3 99.20
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.60 C3 C6 99.60
TOP 5 2 99.60 C6 C3 99.60
BOT 2 6 98.40 C3 C7 98.40
TOP 6 2 98.40 C7 C3 98.40
BOT 2 7 99.60 C3 C8 99.60
TOP 7 2 99.60 C8 C3 99.60
BOT 3 4 99.20 C4 C5 99.20
TOP 4 3 99.20 C5 C4 99.20
BOT 3 5 99.60 C4 C6 99.60
TOP 5 3 99.60 C6 C4 99.60
BOT 3 6 98.40 C4 C7 98.40
TOP 6 3 98.40 C7 C4 98.40
BOT 3 7 99.60 C4 C8 99.60
TOP 7 3 99.60 C8 C4 99.60
BOT 4 5 99.60 C5 C6 99.60
TOP 5 4 99.60 C6 C5 99.60
BOT 4 6 98.40 C5 C7 98.40
TOP 6 4 98.40 C7 C5 98.40
BOT 4 7 99.60 C5 C8 99.60
TOP 7 4 99.60 C8 C5 99.60
BOT 5 6 98.80 C6 C7 98.80
TOP 6 5 98.80 C7 C6 98.80
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 6 7 98.80 C7 C8 98.80
TOP 7 6 98.80 C8 C7 98.80
AVG 0 C1 * 99.31
AVG 1 C2 * 97.92
AVG 2 C3 * 99.31
AVG 3 C4 * 98.97
AVG 4 C5 * 99.31
AVG 5 C6 * 99.31
AVG 6 C7 * 98.28
AVG 7 C8 * 99.31
TOT TOT * 98.97
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT
C2 ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT
C3 ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT
C4 ATGTTTTCCATGGATAATTTCGACTTGGAAGCCACGATGGCGCGCCATTT
C5 ATGTTTTCCATGGACAACTTCGACTTGGAGGCCACGATGGCGCGCCATTT
C6 ATGTTTTCCATGGACAACTTTGACCTGGAGGCCACGATGGCGCGCCATTT
C7 ATGTTTTCCATGGACAACTTCGACCTGGAGGCCACGATGGCGCGCCACTT
C8 ATGTTTTCCATGGACAACTTTGACTTGGAGGCCACGATGGCGCGCCATTT
************** ** ** *** ****.***************** **
C1 CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTATT
C2 CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT
C3 CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT
C4 CTTTGAGGGATCACAGGCCACCAACGCCTCTACCTCCAGCTCCGATTACT
C5 CTTCGAGGGATCACAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT
C6 CTTCGAGGGATCGCAGGCCACCAACGCTTCCACCTCTAGCTCCGACTATT
C7 CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGATTACT
C8 CTTCGAGGGATCACAGGCCACCAACGCCTCCACCTCCAGCTCCGATTACT
*** ********.************** ** ***** ******** ** *
C1 TTTTTGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
C2 TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
C3 TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
C4 TTTTCGGGGACGAGCACAGCTCGGAGAGTGATGACGAGGACGATGCCTAT
C5 TCTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
C6 TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGATGACGCCTAC
C7 TTTTCGGGGACGAGCATAGCTCGGAAAGCGATGACGAGGACGACGCCTAC
C8 TTTTCGGTGATGAGCACAGCTCGGAGAGCGACGACGAGGATGATGCCTAC
* ** ** ** ***** ********.** ** ******** ** *****
C1 AGCAGTGGCTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGCGGAG
C2 AGCAGTGGGTTCAATAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
C3 AGCAGTGGGTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
C4 AGCAGTGGGTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGAAG
C5 AGCAGTGGATTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGAAG
C6 AGCAGCGGTTTTAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
C7 AGCAGTGGATTCAACAGCGACCAGGAGAACACCGAGAAAACCCGGCGGAG
C8 AGCAGCGGATTTAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
***** ** ** ** ***********************.******.*.**
C1 CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC
C2 CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC
C3 CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC
C4 CCACAAGCCCCGACGCTTAAAGTGCGCCTCCCAAATGGCCCAGCAACGAC
C5 CCACAAGCCCCGTCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGAC
C6 CCACAAGCCTCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAACGGC
C7 CCACAAGCCGCGCCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGAC
C8 CCACAAGCCTCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAACGGC
********* ** *****.**************************.**.*
C1 AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
C2 AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
C3 AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
C4 AGGCGGCCAATCTCCGAGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
C5 AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
C6 AGGCAGCCAATCTCCGCGAGCGTCGGCGGATGCAGAGCATCAACGAGGCG
C7 AGGCCGCCAATCTCCGCGAGCGCCGGCGGATGCAGAGCATCAACGAGGCC
C8 AGGCCGCTAATCTCCGAGAGCGTCGACGGATGCAGAGCATCAACGAGGCG
**** ** ********.***** ** ***********************
C1 TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
C2 TTCGAGGGTTTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
C3 TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
C4 TTCGAGGGTCTGCGCACCCACATTCCCACGTTGCCCTACGAGAAGCGACT
C5 TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGGCT
C6 TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
C7 TTCGAGGGTCTGCGCACCCATATCCCCACGCTGCCCTACGAGAAGCGACT
C8 TTCGAGGGTCTACGCACCCACATTCCCACGCTGCCCTACGAAAAGCGACT
********* *.******** ** ****** **********.*****.**
C1 AAGCAAGGTGGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
C2 AAGCAAGGTGGACACCCTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
C3 AAGCAAGGTGGACACCCTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
C4 GAGCAAGGTCGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
C5 GAGCAAGGTCGACACACTCAAACTGGCCATAAGCTACATCACCTTCCTCA
C6 GAGCAAGGTCGACACACTCAAGCTGGCGATCAGCTACATAACCTTTCTGA
C7 GAGCAAGGTCGACACACTCAAGCTGGCCATCAGCTACATAACCTTCCTCA
C8 GAGCAAGGTCGACACACTCAAGTTGGCGATCAGCTACATAACCTTCCTTA
.******** *****.*****. **** **.********.***** ** *
C1 GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG
C2 GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG
C3 GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG
C4 GCGAGATGGTCAAGAAGGATAAGAACGGGAACGAGCCGGGCTTAAGTCTG
C5 GCGAGATGGTCAAGAAGGATAAGAACGGGAATGAGCCGGGCCTAAGTCTG
C6 GCGAGATGGTCAAGAAGGATAAGAACGGCAACGAGCCCGGACTGAGCTTG
C7 GCGAGATGGTCAAAAAGGACAAGAACGGCAACGAACCCGGCCTGAGCTTG
C8 GCGAGATGGTAAAGAAGGATAAGAATGGCAATGAACCCGGTCTAAGCTTG
**********.**.***** ***** ** ** **.** ** *.** **
C1 CAGCGTAACTACCAAAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
C2 CAGCGTAACTACCAGAAGGAGCCGCCGAAGAAAATTATCCTCAAGGATCG
C3 CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
C4 CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
C5 CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
C6 CAGCGCAATTACCAGAAGGAACCGCCCAAGAAAATCATCCTCAAGGATCG
C7 CAGCGCAACTACCAGAAGGAGCCGCCCAAGAAAATCATCCTCAAGGATCG
C8 CAGCGCAATTACCAAAAGGAACCACCCAAGAAAATCATTCTCAAGGATCG
***** ** *****.*****.**.** ******** ** ***********
C1 CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT
C2 CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT
C3 CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT
C4 CACTGGCGGTGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGGGACCGAT
C5 CACTGGCGGAGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGGGACCGAT
C6 CACAGGCGGAGTGGCGCACTCGTTGTCCTGGTACCGAAAGGGCGACCGAT
C7 CACTGGCGGCGTGGCGCATTCGTTATCCTGGTACCGCAAGGGCGACCGAT
C8 CACTGGCGGTGTGGCGCACTCATTGTCCTGGTACCGCAAGGGCGACCGAT
***:***** ******** **.**.***********.***** *******
C1 ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACGG
C2 ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCTCGG
C3 ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACGG
C4 ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGACCCACGG
C5 ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGACCCGCGG
C6 ACCCGGGCAGTAAGCTCTACGCCCGCACCTGGACCCCAGAGGATCCCCGG
C7 ACCCGGGCAGCAAGCTCTACGCCCGCACCTGGACACCCGAGGACCCCCGG
C8 ATCCGGGCAGCAAGCTCTACGCCCGCACCTGGACACCCGAGGATCCCCGG
* ******** ************.* ********.** ***** ** ***
C1 GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
C2 GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
C3 GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
C4 GGTCCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
C5 GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
C6 GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAACCA
C7 GGACCCCACTCGCAGCCCCAGCCGCTGTACACGAACAGCAACTCGAACCA
C8 GGGCCCCATTCCCAGCCCCTGCCGCTGTACAATAACAGCAACTCGAATCA
** ***** ** *******:***********. ************** **
C1 GAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGTGGTGCGG
C2 GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAGCT-------
C3 GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGAGCGG
C4 AAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGTGCGG
C5 GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGTGCGG
C6 GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGCAGT---GCCG
C7 GAACCAAAACAGCAACCAGAGCAGCGAGGACTTCAGCGGAAGT---GCCG
C8 AAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGT---GCCG
.** *********************** ** ********.. *
C1 ATATGTCGGATCCTGGAGCTGCGGCCAGTATTTTCAGCAGCGGCAGTGGC
C2 -----GAAGCTGCTGGAGCTGCGGCCAGCATCTTCAGCAGCGGCAGTGGC
C3 ATATGTCGGATCCTGGAGCTGCGGCCAGCATCTTCAGCAGCGGCAGTGGC
C4 ATATGTCGGATCCTGGAGCAACGGCCAGTATTTTCAGCACCGGCAGTGGA
C5 ATATGTCGGATCCTGGAGCAGCGGCCAGTATTTTCAGCAGCGGCAGTGGA
C6 ATATGTCCGATCCGGGAGCAACGGCCAGTATTTTCAGCAGCGGCAGTGGA
C7 ACATGTCCGATCCGGGGGCAACGGCCAGCATCTTCAGCAGCGGCAGTGGA
C8 ATATGTCCGATCCGGGAGCAACGGCCAGTATTTTTAGCAGCGGCAGTGGA
. *.* * **.**:.******* ** ** **** *********.
C1 ATG------------
C2 ATG------------
C3 ATG------------
C4 ATG------------
C5 ATG------------
C6 ATG------------
C7 ATG------------
C8 ATG------------
***
>C1
ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT
CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTATT
TTTTTGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
AGCAGTGGCTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGCGGAG
CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC
AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
AAGCAAGGTGGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG
CAGCGTAACTACCAAAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT
ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACGG
GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
GAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGTGGTGCGG
ATATGTCGGATCCTGGAGCTGCGGCCAGTATTTTCAGCAGCGGCAGTGGC
ATG------------
>C2
ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT
CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT
TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
AGCAGTGGGTTCAATAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC
AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTTTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
AAGCAAGGTGGACACCCTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG
CAGCGTAACTACCAGAAGGAGCCGCCGAAGAAAATTATCCTCAAGGATCG
CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT
ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCTCGG
GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAGCT-------
-----GAAGCTGCTGGAGCTGCGGCCAGCATCTTCAGCAGCGGCAGTGGC
ATG------------
>C3
ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT
CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT
TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
AGCAGTGGGTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC
AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
AAGCAAGGTGGACACCCTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG
CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT
ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACGG
GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGAGCGG
ATATGTCGGATCCTGGAGCTGCGGCCAGCATCTTCAGCAGCGGCAGTGGC
ATG------------
>C4
ATGTTTTCCATGGATAATTTCGACTTGGAAGCCACGATGGCGCGCCATTT
CTTTGAGGGATCACAGGCCACCAACGCCTCTACCTCCAGCTCCGATTACT
TTTTCGGGGACGAGCACAGCTCGGAGAGTGATGACGAGGACGATGCCTAT
AGCAGTGGGTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGAAG
CCACAAGCCCCGACGCTTAAAGTGCGCCTCCCAAATGGCCCAGCAACGAC
AGGCGGCCAATCTCCGAGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTCTGCGCACCCACATTCCCACGTTGCCCTACGAGAAGCGACT
GAGCAAGGTCGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTCA
GCGAGATGGTCAAGAAGGATAAGAACGGGAACGAGCCGGGCTTAAGTCTG
CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
CACTGGCGGTGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGGGACCGAT
ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGACCCACGG
GGTCCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
AAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGTGCGG
ATATGTCGGATCCTGGAGCAACGGCCAGTATTTTCAGCACCGGCAGTGGA
ATG------------
>C5
ATGTTTTCCATGGACAACTTCGACTTGGAGGCCACGATGGCGCGCCATTT
CTTCGAGGGATCACAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT
TCTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT
AGCAGTGGATTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGAAG
CCACAAGCCCCGTCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGAC
AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGGCT
GAGCAAGGTCGACACACTCAAACTGGCCATAAGCTACATCACCTTCCTCA
GCGAGATGGTCAAGAAGGATAAGAACGGGAATGAGCCGGGCCTAAGTCTG
CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG
CACTGGCGGAGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGGGACCGAT
ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGACCCGCGG
GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA
GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGTGCGG
ATATGTCGGATCCTGGAGCAGCGGCCAGTATTTTCAGCAGCGGCAGTGGA
ATG------------
>C6
ATGTTTTCCATGGACAACTTTGACCTGGAGGCCACGATGGCGCGCCATTT
CTTCGAGGGATCGCAGGCCACCAACGCTTCCACCTCTAGCTCCGACTATT
TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGATGACGCCTAC
AGCAGCGGTTTTAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
CCACAAGCCTCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAACGGC
AGGCAGCCAATCTCCGCGAGCGTCGGCGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT
GAGCAAGGTCGACACACTCAAGCTGGCGATCAGCTACATAACCTTTCTGA
GCGAGATGGTCAAGAAGGATAAGAACGGCAACGAGCCCGGACTGAGCTTG
CAGCGCAATTACCAGAAGGAACCGCCCAAGAAAATCATCCTCAAGGATCG
CACAGGCGGAGTGGCGCACTCGTTGTCCTGGTACCGAAAGGGCGACCGAT
ACCCGGGCAGTAAGCTCTACGCCCGCACCTGGACCCCAGAGGATCCCCGG
GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAACCA
GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGCAGT---GCCG
ATATGTCCGATCCGGGAGCAACGGCCAGTATTTTCAGCAGCGGCAGTGGA
ATG------------
>C7
ATGTTTTCCATGGACAACTTCGACCTGGAGGCCACGATGGCGCGCCACTT
CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGATTACT
TTTTCGGGGACGAGCATAGCTCGGAAAGCGATGACGAGGACGACGCCTAC
AGCAGTGGATTCAACAGCGACCAGGAGAACACCGAGAAAACCCGGCGGAG
CCACAAGCCGCGCCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGAC
AGGCCGCCAATCTCCGCGAGCGCCGGCGGATGCAGAGCATCAACGAGGCC
TTCGAGGGTCTGCGCACCCATATCCCCACGCTGCCCTACGAGAAGCGACT
GAGCAAGGTCGACACACTCAAGCTGGCCATCAGCTACATAACCTTCCTCA
GCGAGATGGTCAAAAAGGACAAGAACGGCAACGAACCCGGCCTGAGCTTG
CAGCGCAACTACCAGAAGGAGCCGCCCAAGAAAATCATCCTCAAGGATCG
CACTGGCGGCGTGGCGCATTCGTTATCCTGGTACCGCAAGGGCGACCGAT
ACCCGGGCAGCAAGCTCTACGCCCGCACCTGGACACCCGAGGACCCCCGG
GGACCCCACTCGCAGCCCCAGCCGCTGTACACGAACAGCAACTCGAACCA
GAACCAAAACAGCAACCAGAGCAGCGAGGACTTCAGCGGAAGT---GCCG
ACATGTCCGATCCGGGGGCAACGGCCAGCATCTTCAGCAGCGGCAGTGGA
ATG------------
>C8
ATGTTTTCCATGGACAACTTTGACTTGGAGGCCACGATGGCGCGCCATTT
CTTCGAGGGATCACAGGCCACCAACGCCTCCACCTCCAGCTCCGATTACT
TTTTCGGTGATGAGCACAGCTCGGAGAGCGACGACGAGGATGATGCCTAC
AGCAGCGGATTTAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG
CCACAAGCCTCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAACGGC
AGGCCGCTAATCTCCGAGAGCGTCGACGGATGCAGAGCATCAACGAGGCG
TTCGAGGGTCTACGCACCCACATTCCCACGCTGCCCTACGAAAAGCGACT
GAGCAAGGTCGACACACTCAAGTTGGCGATCAGCTACATAACCTTCCTTA
GCGAGATGGTAAAGAAGGATAAGAATGGCAATGAACCCGGTCTAAGCTTG
CAGCGCAATTACCAAAAGGAACCACCCAAGAAAATCATTCTCAAGGATCG
CACTGGCGGTGTGGCGCACTCATTGTCCTGGTACCGCAAGGGCGACCGAT
ATCCGGGCAGCAAGCTCTACGCCCGCACCTGGACACCCGAGGATCCCCGG
GGGCCCCATTCCCAGCCCCTGCCGCTGTACAATAACAGCAACTCGAATCA
AAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGT---GCCG
ATATGTCCGATCCGGGAGCAACGGCCAGTATTTTTAGCAGCGGCAGTGGA
ATG------------
>C1
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M
>C2
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGAooooEAAGAAASIFSSGSG
M
>C3
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M
>C4
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG
M
>C5
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
M
>C6
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSoADMSDPGATASIFSSGSG
M
>C7
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGSoADMSDPGATASIFSSGSG
M
>C8
MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSoADMSDPGATASIFSSGSG
M
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 765 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479332957
Setting output file names to "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 152449905
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8068752076
Seed = 1465197779
Swapseed = 1479332957
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 19 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 80 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2688.859364 -- -24.349928
Chain 2 -- -2729.417431 -- -24.349928
Chain 3 -- -2658.556729 -- -24.349928
Chain 4 -- -2707.410251 -- -24.349928
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2653.411110 -- -24.349928
Chain 2 -- -2644.968547 -- -24.349928
Chain 3 -- -2698.867393 -- -24.349928
Chain 4 -- -2701.102902 -- -24.349928
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2688.859] (-2729.417) (-2658.557) (-2707.410) * [-2653.411] (-2644.969) (-2698.867) (-2701.103)
500 -- [-1991.936] (-2004.774) (-2005.474) (-2017.824) * (-2007.984) (-2019.095) (-1995.815) [-1987.089] -- 0:00:00
1000 -- (-1989.780) [-1976.309] (-1968.965) (-1975.104) * (-1996.719) (-1987.988) [-1986.002] (-1976.226) -- 0:00:00
1500 -- (-1953.685) [-1955.340] (-1964.419) (-1951.359) * (-1974.624) (-1970.101) (-1946.309) [-1948.469] -- 0:00:00
2000 -- (-1946.045) (-1930.899) (-1952.647) [-1903.412] * (-1962.413) (-1933.626) (-1934.436) [-1923.972] -- 0:08:19
2500 -- (-1907.397) [-1898.539] (-1931.795) (-1904.032) * (-1940.513) [-1907.460] (-1926.382) (-1926.922) -- 0:06:39
3000 -- (-1903.488) (-1895.767) (-1913.795) [-1898.275] * [-1929.060] (-1900.954) (-1919.906) (-1922.278) -- 0:05:32
3500 -- [-1899.939] (-1898.807) (-1907.299) (-1897.845) * (-1913.820) [-1897.907] (-1905.740) (-1918.702) -- 0:04:44
4000 -- (-1898.053) (-1896.446) (-1907.438) [-1899.675] * [-1899.468] (-1904.986) (-1908.926) (-1909.467) -- 0:04:09
4500 -- [-1896.569] (-1903.562) (-1904.208) (-1900.998) * [-1898.863] (-1896.792) (-1909.938) (-1922.881) -- 0:03:41
5000 -- (-1901.425) [-1896.907] (-1896.186) (-1899.953) * (-1898.266) (-1908.517) [-1907.475] (-1915.285) -- 0:03:19
Average standard deviation of split frequencies: 0.044896
5500 -- (-1904.237) [-1895.657] (-1898.075) (-1895.700) * [-1901.299] (-1903.070) (-1896.314) (-1911.375) -- 0:06:01
6000 -- (-1903.684) [-1896.842] (-1906.239) (-1902.823) * (-1895.849) [-1898.251] (-1907.492) (-1921.715) -- 0:05:31
6500 -- [-1902.833] (-1899.882) (-1902.061) (-1903.392) * [-1896.509] (-1906.278) (-1897.090) (-1910.277) -- 0:05:05
7000 -- (-1901.857) [-1891.308] (-1896.363) (-1908.166) * (-1898.977) (-1909.458) (-1902.919) [-1904.866] -- 0:04:43
7500 -- [-1893.372] (-1895.356) (-1901.466) (-1896.899) * (-1904.736) (-1904.499) (-1900.720) [-1904.810] -- 0:04:24
8000 -- (-1895.923) (-1894.127) (-1908.492) [-1904.599] * (-1891.043) (-1903.497) [-1898.670] (-1902.849) -- 0:04:08
8500 -- (-1900.168) (-1898.395) (-1893.253) [-1896.353] * (-1900.746) (-1896.986) [-1907.282] (-1902.420) -- 0:03:53
9000 -- (-1896.020) (-1891.307) (-1898.317) [-1895.757] * (-1892.109) (-1900.224) [-1893.422] (-1910.455) -- 0:05:30
9500 -- [-1891.053] (-1895.894) (-1896.038) (-1898.367) * (-1897.377) (-1890.511) (-1896.762) [-1892.018] -- 0:05:12
10000 -- (-1899.831) (-1906.086) (-1893.824) [-1903.451] * [-1898.330] (-1894.369) (-1897.621) (-1897.953) -- 0:04:57
Average standard deviation of split frequencies: 0.044194
10500 -- (-1899.337) (-1899.186) [-1900.238] (-1896.972) * (-1897.570) (-1900.188) [-1895.628] (-1905.913) -- 0:04:42
11000 -- (-1894.584) [-1900.223] (-1893.656) (-1898.762) * (-1898.613) (-1901.183) [-1890.562] (-1893.978) -- 0:04:29
11500 -- [-1899.754] (-1893.044) (-1898.318) (-1900.468) * [-1894.420] (-1898.712) (-1896.168) (-1896.622) -- 0:04:17
12000 -- (-1897.075) [-1898.710] (-1896.155) (-1903.422) * (-1892.202) [-1894.070] (-1901.711) (-1903.049) -- 0:04:07
12500 -- (-1898.310) (-1894.530) [-1898.146] (-1897.790) * (-1893.038) [-1891.884] (-1901.543) (-1910.204) -- 0:05:16
13000 -- (-1891.325) (-1899.977) (-1897.045) [-1894.462] * (-1899.049) (-1899.656) [-1895.561] (-1897.590) -- 0:05:03
13500 -- [-1894.269] (-1912.976) (-1900.630) (-1894.805) * (-1906.713) [-1898.990] (-1897.711) (-1905.861) -- 0:04:52
14000 -- (-1898.596) (-1895.728) [-1897.308] (-1900.793) * (-1900.844) (-1897.481) [-1895.658] (-1906.167) -- 0:04:41
14500 -- [-1898.641] (-1900.642) (-1898.931) (-1907.683) * (-1900.962) [-1899.356] (-1897.594) (-1899.765) -- 0:04:31
15000 -- (-1898.136) (-1893.578) [-1893.951] (-1896.956) * (-1906.900) (-1904.152) (-1894.607) [-1891.828] -- 0:04:22
Average standard deviation of split frequencies: 0.034373
15500 -- (-1904.506) (-1901.342) (-1896.512) [-1899.958] * [-1891.862] (-1898.989) (-1898.099) (-1897.809) -- 0:04:14
16000 -- (-1895.741) [-1902.593] (-1891.668) (-1903.974) * (-1895.967) (-1901.741) [-1901.286] (-1892.609) -- 0:05:07
16500 -- (-1896.071) (-1902.498) [-1895.654] (-1898.774) * [-1892.829] (-1902.110) (-1902.088) (-1906.646) -- 0:04:58
17000 -- (-1898.092) (-1903.940) [-1896.329] (-1906.818) * [-1890.906] (-1897.225) (-1906.835) (-1894.171) -- 0:04:49
17500 -- (-1894.808) [-1896.770] (-1895.689) (-1906.066) * (-1899.903) [-1899.202] (-1894.862) (-1902.494) -- 0:04:40
18000 -- (-1899.759) (-1899.273) (-1897.563) [-1900.375] * (-1897.896) (-1894.993) [-1895.706] (-1900.431) -- 0:04:32
18500 -- [-1892.873] (-1897.427) (-1904.229) (-1908.037) * (-1900.253) (-1903.010) (-1894.468) [-1899.081] -- 0:04:25
19000 -- (-1891.202) [-1899.162] (-1901.050) (-1903.658) * [-1894.968] (-1908.829) (-1904.630) (-1888.933) -- 0:05:09
19500 -- (-1896.330) (-1907.864) (-1903.011) [-1902.456] * (-1908.250) (-1900.130) (-1898.335) [-1893.556] -- 0:05:01
20000 -- (-1894.204) (-1897.172) [-1896.296] (-1896.482) * [-1900.168] (-1901.447) (-1896.740) (-1903.084) -- 0:04:54
Average standard deviation of split frequencies: 0.013686
20500 -- (-1892.325) [-1897.899] (-1895.884) (-1897.448) * (-1901.271) [-1899.093] (-1898.899) (-1904.475) -- 0:04:46
21000 -- (-1897.733) (-1899.036) [-1896.643] (-1903.645) * (-1910.953) [-1902.279] (-1891.968) (-1903.464) -- 0:04:39
21500 -- (-1897.747) (-1897.588) (-1907.094) [-1895.686] * [-1898.945] (-1893.827) (-1897.436) (-1910.112) -- 0:04:33
22000 -- [-1909.537] (-1896.893) (-1906.270) (-1896.754) * (-1898.755) (-1903.420) (-1896.216) [-1894.285] -- 0:04:26
22500 -- (-1896.003) (-1898.304) [-1900.367] (-1900.046) * (-1902.261) [-1905.212] (-1894.435) (-1904.625) -- 0:05:04
23000 -- (-1899.913) [-1897.111] (-1895.269) (-1908.495) * (-1896.684) (-1894.656) [-1894.930] (-1901.412) -- 0:04:57
23500 -- (-1902.905) (-1901.644) (-1906.297) [-1904.030] * (-1903.946) (-1895.327) (-1895.397) [-1897.251] -- 0:04:50
24000 -- (-1905.666) (-1893.338) [-1900.353] (-1898.956) * [-1894.544] (-1897.671) (-1896.261) (-1899.957) -- 0:04:44
24500 -- [-1902.484] (-1896.431) (-1898.471) (-1899.034) * (-1893.281) [-1900.154] (-1897.091) (-1895.772) -- 0:04:38
25000 -- (-1900.641) [-1902.945] (-1896.025) (-1895.857) * [-1891.322] (-1905.338) (-1900.254) (-1895.359) -- 0:04:33
Average standard deviation of split frequencies: 0.024175
25500 -- [-1896.473] (-1901.417) (-1895.736) (-1891.391) * (-1897.956) (-1905.143) (-1900.257) [-1896.929] -- 0:04:27
26000 -- (-1895.041) (-1903.304) [-1892.640] (-1895.280) * (-1890.327) (-1901.462) (-1893.895) [-1896.243] -- 0:04:59
26500 -- (-1892.379) (-1892.100) (-1897.100) [-1900.552] * (-1890.628) [-1900.172] (-1898.235) (-1899.458) -- 0:04:53
27000 -- (-1894.427) (-1892.228) (-1896.813) [-1896.078] * (-1898.235) (-1895.331) [-1900.432] (-1898.240) -- 0:04:48
27500 -- (-1893.353) (-1907.805) (-1896.297) [-1897.027] * (-1897.342) (-1901.840) (-1897.050) [-1896.032] -- 0:04:42
28000 -- (-1901.215) [-1895.493] (-1901.077) (-1896.755) * (-1907.820) (-1903.847) (-1901.223) [-1890.518] -- 0:04:37
28500 -- [-1892.513] (-1893.950) (-1899.600) (-1895.897) * [-1896.090] (-1900.258) (-1897.468) (-1891.876) -- 0:04:32
29000 -- (-1893.658) (-1893.579) (-1898.926) [-1899.925] * (-1896.197) [-1898.300] (-1899.603) (-1889.811) -- 0:05:01
29500 -- (-1893.371) [-1895.164] (-1903.748) (-1908.808) * (-1894.106) (-1901.428) (-1895.263) [-1899.442] -- 0:04:56
30000 -- (-1894.610) (-1901.775) (-1905.926) [-1898.664] * (-1899.345) (-1897.545) (-1896.886) [-1901.692] -- 0:04:51
Average standard deviation of split frequencies: 0.028182
30500 -- (-1906.575) (-1900.809) (-1891.705) [-1894.506] * (-1902.825) [-1897.719] (-1906.007) (-1897.921) -- 0:04:46
31000 -- (-1907.433) [-1905.700] (-1899.524) (-1900.656) * [-1894.006] (-1908.363) (-1896.816) (-1901.265) -- 0:04:41
31500 -- (-1906.538) [-1903.469] (-1903.571) (-1896.888) * [-1898.057] (-1897.933) (-1912.545) (-1898.973) -- 0:04:36
32000 -- (-1896.350) (-1896.473) (-1906.309) [-1893.617] * [-1895.779] (-1899.450) (-1888.249) (-1908.923) -- 0:05:02
32500 -- [-1904.814] (-1898.078) (-1901.946) (-1904.797) * (-1899.950) (-1892.695) (-1890.233) [-1899.570] -- 0:04:57
33000 -- (-1898.293) (-1902.353) [-1896.724] (-1906.964) * (-1898.101) (-1918.046) (-1905.063) [-1895.241] -- 0:04:53
33500 -- (-1902.616) (-1892.011) [-1900.440] (-1900.964) * [-1900.421] (-1895.270) (-1897.483) (-1904.897) -- 0:04:48
34000 -- (-1900.060) (-1900.131) [-1899.439] (-1895.647) * [-1900.416] (-1904.556) (-1898.300) (-1904.579) -- 0:04:44
34500 -- (-1903.429) (-1898.029) [-1894.888] (-1899.729) * (-1901.360) (-1904.553) (-1898.883) [-1900.562] -- 0:04:39
35000 -- (-1897.434) (-1897.318) [-1892.983] (-1902.169) * (-1902.456) (-1896.976) (-1897.506) [-1899.408] -- 0:04:35
Average standard deviation of split frequencies: 0.032736
35500 -- (-1904.522) (-1902.615) (-1897.092) [-1896.041] * (-1897.519) (-1901.537) (-1902.090) [-1892.487] -- 0:04:58
36000 -- (-1901.931) (-1910.325) (-1900.928) [-1900.469] * (-1898.411) (-1899.945) [-1900.588] (-1910.401) -- 0:04:54
36500 -- (-1895.528) (-1908.590) [-1893.430] (-1898.539) * (-1893.312) [-1892.919] (-1897.139) (-1897.841) -- 0:04:50
37000 -- (-1899.593) (-1908.277) (-1892.878) [-1892.081] * (-1898.715) (-1897.999) [-1898.850] (-1900.102) -- 0:04:46
37500 -- (-1899.958) (-1897.875) (-1899.511) [-1893.278] * (-1893.186) (-1891.068) (-1903.279) [-1905.614] -- 0:04:42
38000 -- (-1896.722) [-1899.371] (-1905.994) (-1906.190) * (-1908.909) [-1901.852] (-1897.863) (-1896.807) -- 0:04:38
38500 -- (-1899.246) (-1900.024) [-1901.617] (-1891.080) * (-1903.657) (-1900.305) (-1894.498) [-1896.737] -- 0:04:34
39000 -- (-1897.003) (-1902.522) [-1894.075] (-1912.992) * [-1897.363] (-1901.947) (-1900.588) (-1901.827) -- 0:04:55
39500 -- (-1898.989) (-1901.437) [-1898.437] (-1903.734) * (-1896.803) (-1898.295) (-1899.098) [-1898.166] -- 0:04:51
40000 -- (-1896.082) (-1902.121) [-1892.315] (-1897.761) * [-1895.984] (-1906.044) (-1901.608) (-1904.500) -- 0:04:48
Average standard deviation of split frequencies: 0.023184
40500 -- (-1900.708) (-1901.859) (-1895.458) [-1900.723] * (-1904.841) [-1897.627] (-1893.218) (-1903.232) -- 0:04:44
41000 -- (-1895.955) (-1897.165) [-1901.036] (-1900.194) * (-1900.597) [-1893.813] (-1897.290) (-1899.372) -- 0:04:40
41500 -- [-1896.297] (-1897.832) (-1900.306) (-1902.109) * (-1899.351) (-1903.791) (-1896.090) [-1900.913] -- 0:04:37
42000 -- (-1899.558) [-1900.420] (-1893.352) (-1898.689) * (-1894.480) (-1908.479) [-1896.945] (-1891.965) -- 0:04:33
42500 -- (-1903.332) (-1897.075) [-1897.443] (-1900.233) * [-1896.140] (-1902.585) (-1897.976) (-1903.621) -- 0:04:52
43000 -- [-1900.465] (-1895.413) (-1907.378) (-1894.702) * (-1900.173) (-1895.647) (-1903.844) [-1897.982] -- 0:04:49
43500 -- (-1908.368) [-1902.546] (-1902.338) (-1902.941) * (-1895.667) (-1898.101) (-1908.388) [-1898.222] -- 0:04:45
44000 -- [-1901.115] (-1899.887) (-1897.056) (-1898.262) * (-1899.830) (-1907.522) (-1894.466) [-1896.724] -- 0:04:42
44500 -- (-1902.169) [-1899.551] (-1909.596) (-1903.148) * (-1897.780) (-1892.368) (-1899.186) [-1902.898] -- 0:04:39
45000 -- [-1900.820] (-1894.247) (-1895.485) (-1903.250) * (-1893.836) (-1898.072) (-1903.832) [-1893.320] -- 0:04:35
Average standard deviation of split frequencies: 0.025620
45500 -- (-1904.197) (-1902.946) (-1900.838) [-1894.181] * (-1895.284) (-1899.407) (-1898.881) [-1891.700] -- 0:04:32
46000 -- [-1898.419] (-1900.036) (-1900.896) (-1894.565) * (-1895.556) (-1904.476) (-1894.313) [-1894.866] -- 0:04:50
46500 -- (-1909.399) [-1895.893] (-1891.476) (-1907.065) * [-1895.643] (-1897.501) (-1897.570) (-1897.827) -- 0:04:47
47000 -- (-1909.470) (-1910.834) [-1891.641] (-1899.652) * [-1895.294] (-1901.147) (-1897.308) (-1896.784) -- 0:04:43
47500 -- (-1906.425) [-1896.407] (-1906.288) (-1905.021) * [-1894.198] (-1902.225) (-1894.920) (-1891.955) -- 0:04:40
48000 -- (-1897.425) (-1892.822) (-1904.787) [-1897.240] * (-1899.967) [-1899.147] (-1896.773) (-1902.706) -- 0:04:37
48500 -- (-1906.161) [-1895.689] (-1900.100) (-1905.614) * (-1893.545) [-1894.579] (-1897.817) (-1898.952) -- 0:04:34
49000 -- (-1894.795) [-1895.186] (-1899.577) (-1904.847) * [-1896.014] (-1895.087) (-1903.914) (-1901.248) -- 0:04:31
49500 -- (-1899.761) [-1896.292] (-1901.315) (-1903.304) * (-1895.993) (-1897.063) (-1898.876) [-1897.464] -- 0:04:48
50000 -- (-1895.682) (-1897.455) [-1903.310] (-1907.425) * (-1897.133) (-1891.300) [-1900.033] (-1905.494) -- 0:04:45
Average standard deviation of split frequencies: 0.021709
50500 -- (-1906.851) (-1902.397) (-1898.128) [-1899.860] * (-1910.701) [-1898.563] (-1904.259) (-1893.591) -- 0:04:42
51000 -- [-1901.461] (-1906.240) (-1899.341) (-1906.792) * (-1904.060) (-1895.330) (-1898.237) [-1896.455] -- 0:04:39
51500 -- (-1905.694) (-1900.870) [-1893.021] (-1894.488) * (-1901.149) (-1901.498) (-1896.660) [-1899.454] -- 0:04:36
52000 -- (-1906.962) (-1905.499) (-1905.503) [-1894.981] * (-1904.815) [-1896.408] (-1903.559) (-1892.984) -- 0:04:33
52500 -- (-1903.603) [-1901.090] (-1904.863) (-1898.173) * (-1909.295) [-1895.583] (-1898.660) (-1899.486) -- 0:04:30
53000 -- (-1911.560) [-1902.265] (-1898.763) (-1896.224) * (-1907.818) (-1900.394) (-1902.756) [-1892.321] -- 0:04:45
53500 -- (-1895.530) (-1896.907) (-1895.607) [-1897.805] * (-1905.120) [-1900.699] (-1897.331) (-1899.562) -- 0:04:43
54000 -- [-1896.084] (-1907.750) (-1901.042) (-1899.289) * (-1904.174) [-1891.630] (-1899.679) (-1904.323) -- 0:04:40
54500 -- (-1895.250) (-1901.578) [-1904.519] (-1902.566) * (-1911.863) (-1895.208) (-1898.263) [-1891.785] -- 0:04:37
55000 -- (-1897.793) (-1894.667) (-1892.302) [-1894.019] * (-1905.428) (-1900.893) [-1897.694] (-1895.965) -- 0:04:34
Average standard deviation of split frequencies: 0.021045
55500 -- (-1899.045) [-1890.117] (-1898.496) (-1900.191) * (-1907.186) (-1900.559) (-1896.385) [-1894.586] -- 0:04:32
56000 -- [-1894.996] (-1902.367) (-1893.940) (-1898.033) * (-1898.911) (-1903.929) [-1900.036] (-1904.759) -- 0:04:29
56500 -- [-1894.654] (-1901.173) (-1888.580) (-1895.873) * (-1896.224) (-1892.206) (-1892.123) [-1892.031] -- 0:04:43
57000 -- (-1899.477) (-1895.031) (-1897.298) [-1905.196] * [-1898.697] (-1899.888) (-1897.937) (-1895.594) -- 0:04:41
57500 -- [-1896.236] (-1907.590) (-1897.849) (-1894.756) * [-1901.718] (-1897.303) (-1896.517) (-1895.163) -- 0:04:38
58000 -- (-1899.098) (-1908.606) [-1895.500] (-1899.844) * [-1896.634] (-1897.294) (-1893.249) (-1899.247) -- 0:04:36
58500 -- (-1900.300) (-1904.624) [-1894.265] (-1895.565) * (-1898.449) (-1902.481) (-1894.733) [-1898.073] -- 0:04:33
59000 -- (-1899.497) (-1896.710) (-1889.126) [-1897.091] * (-1907.094) (-1902.384) (-1895.177) [-1899.077] -- 0:04:31
59500 -- [-1896.297] (-1921.460) (-1896.128) (-1894.946) * (-1898.525) [-1895.770] (-1895.949) (-1892.876) -- 0:04:44
60000 -- (-1906.246) (-1899.741) [-1896.802] (-1898.984) * (-1907.420) [-1897.753] (-1903.439) (-1891.029) -- 0:04:42
Average standard deviation of split frequencies: 0.019426
60500 -- (-1897.554) [-1897.015] (-1892.441) (-1898.338) * [-1898.000] (-1902.382) (-1898.977) (-1895.904) -- 0:04:39
61000 -- [-1898.090] (-1899.611) (-1903.458) (-1896.714) * (-1905.560) (-1893.049) (-1895.537) [-1894.452] -- 0:04:37
61500 -- (-1898.185) (-1898.352) [-1893.116] (-1908.832) * [-1896.423] (-1899.321) (-1893.809) (-1893.356) -- 0:04:34
62000 -- (-1897.356) (-1891.072) [-1894.316] (-1907.488) * [-1903.240] (-1902.277) (-1892.646) (-1904.763) -- 0:04:32
62500 -- [-1899.646] (-1891.806) (-1901.594) (-1898.160) * (-1900.720) (-1902.565) (-1890.295) [-1896.839] -- 0:04:30
63000 -- (-1895.808) (-1897.425) [-1896.405] (-1893.870) * [-1892.157] (-1911.162) (-1896.271) (-1896.344) -- 0:04:42
63500 -- (-1900.119) (-1894.206) [-1899.799] (-1892.717) * (-1904.056) (-1908.091) [-1895.587] (-1889.762) -- 0:04:40
64000 -- (-1906.038) (-1897.155) [-1892.370] (-1905.800) * (-1905.928) [-1895.819] (-1895.357) (-1893.665) -- 0:04:37
64500 -- (-1907.040) (-1896.545) [-1892.295] (-1905.680) * [-1901.548] (-1899.061) (-1893.773) (-1900.263) -- 0:04:35
65000 -- [-1893.974] (-1904.542) (-1894.251) (-1909.229) * (-1895.293) [-1891.501] (-1901.927) (-1898.664) -- 0:04:33
Average standard deviation of split frequencies: 0.020407
65500 -- (-1899.153) [-1894.246] (-1899.250) (-1900.035) * [-1899.609] (-1896.465) (-1896.916) (-1903.708) -- 0:04:31
66000 -- (-1898.066) (-1898.809) (-1906.042) [-1905.522] * (-1898.002) (-1893.303) [-1895.165] (-1898.559) -- 0:04:28
66500 -- (-1898.298) (-1910.496) (-1899.533) [-1895.809] * [-1899.507] (-1906.230) (-1907.866) (-1898.011) -- 0:04:40
67000 -- [-1895.760] (-1901.296) (-1892.328) (-1904.647) * (-1897.705) (-1903.159) [-1897.704] (-1896.477) -- 0:04:38
67500 -- (-1899.335) (-1904.838) (-1896.783) [-1895.143] * (-1897.110) (-1904.238) (-1893.342) [-1895.924] -- 0:04:36
68000 -- [-1893.998] (-1899.183) (-1899.851) (-1893.265) * (-1902.193) (-1892.128) [-1893.410] (-1895.339) -- 0:04:34
68500 -- (-1902.141) (-1897.875) (-1900.684) [-1893.616] * [-1901.438] (-1901.108) (-1890.716) (-1902.531) -- 0:04:31
69000 -- (-1895.248) (-1894.572) [-1896.586] (-1895.433) * (-1890.965) [-1900.356] (-1897.690) (-1894.461) -- 0:04:29
69500 -- (-1895.304) (-1896.820) (-1902.374) [-1895.620] * (-1899.271) [-1894.088] (-1899.969) (-1896.501) -- 0:04:27
70000 -- (-1911.097) (-1894.579) (-1901.468) [-1891.719] * [-1892.298] (-1903.415) (-1900.557) (-1897.533) -- 0:04:39
Average standard deviation of split frequencies: 0.020965
70500 -- (-1897.726) (-1901.669) [-1893.212] (-1890.843) * [-1893.344] (-1910.124) (-1899.034) (-1890.112) -- 0:04:36
71000 -- [-1893.986] (-1898.751) (-1892.529) (-1901.613) * (-1893.281) [-1899.221] (-1899.041) (-1901.570) -- 0:04:34
71500 -- (-1901.522) (-1897.304) [-1902.956] (-1896.667) * (-1901.065) (-1902.437) (-1908.378) [-1898.243] -- 0:04:32
72000 -- (-1893.756) [-1899.899] (-1904.486) (-1901.010) * [-1897.579] (-1904.382) (-1895.627) (-1899.312) -- 0:04:30
72500 -- (-1902.383) [-1902.953] (-1902.053) (-1902.977) * (-1900.459) [-1902.727] (-1895.413) (-1907.391) -- 0:04:28
73000 -- (-1900.959) (-1900.406) [-1897.146] (-1901.793) * [-1900.342] (-1897.192) (-1894.731) (-1899.806) -- 0:04:39
73500 -- (-1898.253) [-1896.911] (-1895.186) (-1911.465) * (-1900.686) (-1894.127) (-1896.760) [-1898.874] -- 0:04:37
74000 -- (-1897.731) [-1895.178] (-1892.271) (-1905.026) * (-1905.219) [-1895.862] (-1897.684) (-1904.224) -- 0:04:35
74500 -- (-1894.314) [-1898.393] (-1896.355) (-1896.026) * [-1899.785] (-1902.445) (-1905.266) (-1899.480) -- 0:04:33
75000 -- (-1894.031) (-1900.153) [-1895.564] (-1904.773) * (-1896.536) (-1897.408) (-1897.707) [-1901.652] -- 0:04:31
Average standard deviation of split frequencies: 0.021709
75500 -- (-1903.558) (-1892.481) (-1903.011) [-1893.425] * (-1904.183) [-1892.108] (-1911.379) (-1910.834) -- 0:04:29
76000 -- [-1904.544] (-1898.080) (-1900.832) (-1891.428) * (-1900.699) (-1897.332) (-1906.098) [-1896.506] -- 0:04:39
76500 -- (-1898.358) (-1897.221) (-1900.681) [-1895.223] * (-1897.942) (-1892.382) [-1895.816] (-1907.318) -- 0:04:37
77000 -- [-1900.567] (-1901.593) (-1902.554) (-1895.330) * (-1892.006) [-1903.642] (-1910.867) (-1901.234) -- 0:04:35
77500 -- (-1890.680) (-1909.731) (-1906.225) [-1896.501] * (-1892.647) [-1904.034] (-1896.174) (-1899.979) -- 0:04:33
78000 -- (-1901.162) (-1910.328) (-1900.875) [-1896.354] * (-1897.438) [-1897.201] (-1906.779) (-1908.814) -- 0:04:31
78500 -- (-1900.265) [-1902.163] (-1903.940) (-1894.933) * [-1895.141] (-1897.046) (-1895.934) (-1907.635) -- 0:04:29
79000 -- (-1908.634) (-1898.639) (-1902.636) [-1892.588] * (-1904.181) (-1894.521) (-1899.717) [-1900.423] -- 0:04:28
79500 -- (-1897.025) (-1901.048) [-1900.559] (-1900.712) * (-1901.775) (-1899.886) [-1897.376] (-1902.219) -- 0:04:37
80000 -- (-1896.696) (-1904.401) (-1906.349) [-1896.489] * (-1896.004) (-1899.559) [-1898.742] (-1896.742) -- 0:04:36
Average standard deviation of split frequencies: 0.017532
80500 -- (-1903.892) [-1894.711] (-1900.362) (-1895.075) * [-1895.136] (-1897.370) (-1900.134) (-1901.803) -- 0:04:34
81000 -- (-1893.278) (-1899.697) (-1896.125) [-1900.225] * [-1892.251] (-1905.926) (-1902.580) (-1908.565) -- 0:04:32
81500 -- [-1896.888] (-1895.721) (-1903.859) (-1896.519) * (-1894.964) [-1898.063] (-1899.281) (-1895.993) -- 0:04:30
82000 -- (-1902.916) (-1903.793) [-1902.118] (-1898.358) * (-1894.720) (-1900.271) [-1901.988] (-1900.962) -- 0:04:28
82500 -- [-1898.991] (-1900.194) (-1895.323) (-1906.065) * (-1894.777) (-1904.957) (-1905.164) [-1898.633] -- 0:04:38
83000 -- (-1900.108) (-1891.993) [-1895.291] (-1897.253) * (-1901.898) (-1908.709) [-1895.973] (-1897.356) -- 0:04:36
83500 -- (-1901.445) (-1895.300) (-1899.707) [-1894.990] * (-1906.097) (-1908.001) (-1895.828) [-1902.321] -- 0:04:34
84000 -- (-1895.181) (-1896.795) [-1897.918] (-1899.503) * (-1904.233) (-1892.324) (-1896.147) [-1900.922] -- 0:04:32
84500 -- [-1895.584] (-1895.331) (-1898.223) (-1895.798) * (-1903.246) [-1899.960] (-1897.741) (-1908.086) -- 0:04:30
85000 -- (-1904.016) (-1903.394) (-1904.007) [-1896.262] * (-1906.700) (-1905.313) [-1895.103] (-1900.380) -- 0:04:29
Average standard deviation of split frequencies: 0.018010
85500 -- (-1899.141) (-1898.896) [-1896.282] (-1895.169) * (-1897.349) (-1906.183) [-1900.927] (-1898.629) -- 0:04:27
86000 -- (-1896.297) (-1901.814) [-1889.490] (-1892.221) * [-1896.142] (-1902.585) (-1899.777) (-1899.514) -- 0:04:36
86500 -- [-1897.355] (-1900.927) (-1899.525) (-1897.864) * (-1900.315) (-1903.454) [-1902.413] (-1899.890) -- 0:04:34
87000 -- (-1900.117) (-1900.318) (-1905.751) [-1898.572] * [-1893.449] (-1904.679) (-1895.964) (-1898.887) -- 0:04:32
87500 -- (-1898.102) [-1891.098] (-1894.833) (-1903.689) * [-1899.312] (-1912.414) (-1899.038) (-1895.760) -- 0:04:31
88000 -- (-1894.746) (-1902.133) [-1894.226] (-1902.222) * (-1904.400) [-1904.711] (-1902.338) (-1891.816) -- 0:04:29
88500 -- (-1892.901) (-1901.730) (-1896.957) [-1894.310] * (-1897.160) (-1901.950) [-1898.765] (-1907.058) -- 0:04:27
89000 -- [-1891.346] (-1894.622) (-1903.390) (-1893.241) * [-1894.827] (-1897.949) (-1893.562) (-1893.619) -- 0:04:26
89500 -- (-1899.212) (-1892.393) [-1899.535] (-1896.826) * [-1900.476] (-1895.361) (-1898.568) (-1898.840) -- 0:04:34
90000 -- (-1893.271) [-1896.924] (-1904.165) (-1910.427) * (-1895.431) (-1896.626) [-1903.650] (-1894.538) -- 0:04:33
Average standard deviation of split frequencies: 0.009532
90500 -- (-1908.589) (-1896.891) [-1908.389] (-1894.362) * (-1909.519) (-1898.124) [-1897.676] (-1892.267) -- 0:04:31
91000 -- [-1894.314] (-1900.896) (-1904.018) (-1899.086) * (-1903.718) (-1898.542) (-1907.171) [-1897.066] -- 0:04:29
91500 -- (-1903.275) [-1903.433] (-1897.912) (-1905.581) * [-1897.494] (-1899.152) (-1896.770) (-1900.748) -- 0:04:28
92000 -- (-1894.218) (-1901.110) (-1897.750) [-1897.435] * (-1891.827) (-1893.363) [-1898.274] (-1891.734) -- 0:04:26
92500 -- (-1902.207) [-1900.265] (-1894.719) (-1896.552) * (-1891.587) (-1900.640) (-1898.029) [-1893.101] -- 0:04:24
93000 -- (-1901.440) (-1896.476) [-1891.922] (-1896.109) * (-1895.085) [-1900.442] (-1901.694) (-1893.329) -- 0:04:33
93500 -- (-1905.420) (-1901.988) [-1897.786] (-1895.940) * [-1895.881] (-1905.351) (-1891.665) (-1893.407) -- 0:04:31
94000 -- (-1895.083) (-1901.604) (-1893.889) [-1897.125] * (-1899.946) (-1902.560) [-1901.078] (-1899.725) -- 0:04:29
94500 -- (-1890.667) (-1897.071) [-1899.230] (-1896.011) * (-1908.139) (-1896.723) [-1894.519] (-1894.668) -- 0:04:28
95000 -- (-1893.414) [-1900.864] (-1898.784) (-1907.230) * [-1898.347] (-1908.499) (-1897.520) (-1906.399) -- 0:04:26
Average standard deviation of split frequencies: 0.011458
95500 -- [-1901.583] (-1912.190) (-1905.978) (-1901.515) * (-1903.441) [-1900.266] (-1901.520) (-1900.314) -- 0:04:25
96000 -- (-1905.128) [-1898.579] (-1903.848) (-1894.154) * (-1896.354) (-1905.874) [-1894.168] (-1899.453) -- 0:04:23
96500 -- (-1906.789) (-1906.210) (-1900.045) [-1898.829] * [-1902.015] (-1898.074) (-1898.426) (-1898.214) -- 0:04:31
97000 -- [-1896.263] (-1911.734) (-1901.255) (-1898.928) * [-1902.467] (-1896.956) (-1899.210) (-1900.537) -- 0:04:29
97500 -- (-1897.078) (-1902.905) [-1901.308] (-1902.292) * [-1894.921] (-1898.414) (-1894.963) (-1903.353) -- 0:04:28
98000 -- (-1894.041) [-1899.471] (-1897.822) (-1901.774) * (-1900.617) (-1899.315) [-1898.464] (-1899.621) -- 0:04:26
98500 -- (-1896.356) (-1902.342) [-1894.116] (-1890.602) * (-1898.308) (-1900.758) (-1894.445) [-1893.987] -- 0:04:25
99000 -- (-1898.205) (-1899.014) [-1910.379] (-1892.742) * (-1898.571) [-1894.002] (-1897.780) (-1901.717) -- 0:04:23
99500 -- (-1898.609) (-1904.649) (-1905.729) [-1900.514] * (-1898.424) (-1907.368) (-1899.896) [-1896.041] -- 0:04:31
100000 -- (-1899.735) (-1891.243) [-1899.847] (-1894.206) * (-1907.565) [-1894.828] (-1898.217) (-1898.269) -- 0:04:30
Average standard deviation of split frequencies: 0.012488
100500 -- [-1896.448] (-1896.293) (-1908.337) (-1899.157) * (-1894.551) (-1900.374) [-1898.512] (-1897.123) -- 0:04:28
101000 -- [-1906.287] (-1904.335) (-1902.175) (-1898.729) * (-1907.284) [-1896.451] (-1905.648) (-1898.660) -- 0:04:27
101500 -- [-1895.003] (-1894.983) (-1899.227) (-1898.588) * [-1898.835] (-1897.621) (-1899.738) (-1900.427) -- 0:04:25
102000 -- (-1899.459) [-1896.124] (-1902.250) (-1894.545) * (-1902.158) (-1900.570) (-1906.800) [-1892.810] -- 0:04:24
102500 -- [-1894.621] (-1904.546) (-1900.593) (-1897.761) * (-1901.060) (-1894.220) (-1895.316) [-1891.972] -- 0:04:22
103000 -- [-1895.795] (-1905.051) (-1895.583) (-1916.394) * (-1896.587) (-1899.976) (-1904.068) [-1900.934] -- 0:04:29
103500 -- [-1895.130] (-1901.613) (-1898.243) (-1901.185) * (-1897.888) [-1896.983] (-1905.392) (-1900.439) -- 0:04:28
104000 -- (-1894.725) (-1894.137) [-1895.438] (-1895.889) * (-1898.122) (-1899.312) (-1904.907) [-1900.509] -- 0:04:27
104500 -- (-1906.914) (-1899.632) [-1902.067] (-1902.326) * [-1899.496] (-1901.042) (-1898.606) (-1898.976) -- 0:04:25
105000 -- (-1890.140) (-1901.044) [-1904.303] (-1902.678) * [-1894.963] (-1895.571) (-1907.584) (-1894.015) -- 0:04:24
Average standard deviation of split frequencies: 0.008894
105500 -- [-1893.126] (-1900.827) (-1916.753) (-1898.373) * (-1896.023) (-1894.268) (-1901.249) [-1889.878] -- 0:04:22
106000 -- (-1898.596) [-1901.299] (-1900.024) (-1899.306) * (-1906.892) (-1917.002) [-1896.087] (-1905.341) -- 0:04:21
106500 -- (-1893.370) (-1904.374) [-1895.099] (-1903.730) * [-1901.708] (-1905.048) (-1905.282) (-1902.331) -- 0:04:28
107000 -- [-1895.824] (-1899.731) (-1901.701) (-1896.685) * (-1905.293) (-1901.590) [-1900.748] (-1906.074) -- 0:04:27
107500 -- (-1896.992) [-1905.436] (-1913.068) (-1903.530) * [-1899.601] (-1906.972) (-1900.681) (-1905.386) -- 0:04:25
108000 -- [-1897.463] (-1902.732) (-1903.662) (-1917.081) * (-1898.137) (-1903.799) [-1895.867] (-1901.093) -- 0:04:24
108500 -- (-1904.521) (-1897.927) (-1909.515) [-1902.699] * (-1898.976) (-1898.158) [-1897.122] (-1897.664) -- 0:04:22
109000 -- [-1895.243] (-1897.057) (-1905.478) (-1899.509) * (-1903.632) (-1902.073) [-1896.581] (-1894.669) -- 0:04:21
109500 -- (-1904.989) [-1900.788] (-1902.803) (-1893.368) * (-1897.378) (-1905.811) [-1899.297] (-1896.719) -- 0:04:20
110000 -- (-1895.405) (-1906.053) (-1913.678) [-1899.224] * (-1904.065) (-1904.867) [-1897.222] (-1897.962) -- 0:04:27
Average standard deviation of split frequencies: 0.008519
110500 -- (-1894.595) (-1905.000) (-1903.543) [-1897.426] * (-1898.674) (-1908.140) [-1896.028] (-1894.328) -- 0:04:25
111000 -- (-1901.625) (-1899.822) (-1900.272) [-1902.374] * (-1903.465) [-1896.852] (-1900.319) (-1898.656) -- 0:04:24
111500 -- (-1897.004) (-1899.001) (-1904.955) [-1894.823] * (-1909.575) (-1900.778) [-1895.223] (-1897.820) -- 0:04:22
112000 -- [-1893.023] (-1894.277) (-1900.070) (-1890.835) * [-1899.424] (-1897.243) (-1898.100) (-1900.607) -- 0:04:21
112500 -- [-1896.966] (-1898.792) (-1899.821) (-1892.562) * [-1900.190] (-1913.870) (-1896.062) (-1900.552) -- 0:04:20
113000 -- [-1897.153] (-1894.063) (-1904.202) (-1894.589) * (-1893.833) (-1895.127) [-1906.814] (-1898.812) -- 0:04:26
113500 -- (-1898.735) [-1898.634] (-1900.305) (-1906.222) * (-1899.881) (-1898.631) [-1901.923] (-1906.084) -- 0:04:25
114000 -- (-1896.620) (-1891.903) [-1893.523] (-1905.153) * (-1902.528) (-1905.499) [-1897.253] (-1898.126) -- 0:04:24
114500 -- (-1891.231) (-1895.069) (-1898.866) [-1902.471] * (-1903.418) (-1897.604) [-1895.906] (-1903.291) -- 0:04:22
115000 -- (-1899.036) (-1907.605) [-1890.064] (-1898.393) * (-1895.117) [-1893.102] (-1903.935) (-1895.889) -- 0:04:21
Average standard deviation of split frequencies: 0.007450
115500 -- (-1893.753) (-1893.409) [-1899.970] (-1897.871) * (-1902.246) (-1902.118) (-1907.022) [-1896.623] -- 0:04:20
116000 -- [-1900.579] (-1902.751) (-1892.963) (-1898.929) * (-1898.948) (-1903.029) (-1902.772) [-1896.181] -- 0:04:19
116500 -- (-1906.064) (-1898.538) [-1895.119] (-1899.183) * (-1899.655) [-1894.301] (-1898.682) (-1897.133) -- 0:04:25
117000 -- (-1901.349) (-1898.052) [-1889.213] (-1908.757) * (-1904.863) (-1895.385) (-1895.787) [-1892.611] -- 0:04:24
117500 -- (-1896.645) [-1905.085] (-1898.418) (-1897.199) * (-1890.373) [-1892.798] (-1901.216) (-1897.522) -- 0:04:22
118000 -- (-1892.765) (-1905.213) (-1902.936) [-1901.687] * (-1902.067) [-1896.649] (-1905.896) (-1891.578) -- 0:04:21
118500 -- (-1897.105) (-1895.060) [-1898.350] (-1905.807) * [-1890.101] (-1889.484) (-1898.137) (-1896.881) -- 0:04:20
119000 -- [-1900.563] (-1899.871) (-1898.347) (-1904.800) * (-1903.601) (-1904.929) (-1897.356) [-1902.614] -- 0:04:19
119500 -- (-1896.609) (-1896.738) [-1899.503] (-1901.337) * (-1891.123) [-1892.943] (-1901.260) (-1892.497) -- 0:04:17
120000 -- (-1893.501) [-1896.217] (-1894.289) (-1903.445) * [-1905.037] (-1894.216) (-1897.272) (-1896.666) -- 0:04:24
Average standard deviation of split frequencies: 0.005860
120500 -- (-1900.484) [-1901.024] (-1895.523) (-1893.921) * (-1906.162) (-1892.872) (-1898.963) [-1890.916] -- 0:04:22
121000 -- (-1905.447) (-1906.637) (-1896.696) [-1896.930] * [-1907.821] (-1909.396) (-1902.586) (-1901.352) -- 0:04:21
121500 -- (-1900.866) (-1904.650) (-1898.281) [-1904.188] * (-1894.778) (-1902.064) (-1906.138) [-1900.398] -- 0:04:20
122000 -- [-1891.586] (-1898.282) (-1900.082) (-1897.818) * [-1892.819] (-1901.997) (-1893.140) (-1909.243) -- 0:04:19
122500 -- (-1898.204) (-1893.196) (-1903.282) [-1893.469] * [-1898.429] (-1902.945) (-1894.633) (-1902.421) -- 0:04:17
123000 -- [-1900.246] (-1915.347) (-1901.745) (-1900.498) * (-1895.044) (-1907.488) [-1895.129] (-1903.996) -- 0:04:16
123500 -- (-1897.123) (-1895.479) (-1903.604) [-1899.669] * (-1897.965) (-1907.352) (-1894.490) [-1897.535] -- 0:04:22
124000 -- [-1897.680] (-1908.617) (-1902.713) (-1897.367) * [-1892.335] (-1912.699) (-1893.782) (-1898.483) -- 0:04:21
124500 -- (-1897.338) (-1897.259) (-1903.303) [-1890.506] * (-1905.931) (-1905.347) [-1890.913] (-1898.741) -- 0:04:20
125000 -- [-1896.202] (-1896.568) (-1905.525) (-1903.548) * [-1897.006] (-1898.186) (-1891.942) (-1905.934) -- 0:04:19
Average standard deviation of split frequencies: 0.007483
125500 -- (-1903.270) (-1895.373) (-1897.155) [-1894.062] * (-1899.390) (-1894.436) [-1895.922] (-1900.153) -- 0:04:17
126000 -- [-1898.267] (-1893.817) (-1897.524) (-1905.424) * (-1912.078) (-1908.022) (-1901.833) [-1899.092] -- 0:04:16
126500 -- (-1897.987) [-1900.771] (-1897.886) (-1902.328) * (-1899.759) (-1899.082) (-1892.070) [-1894.382] -- 0:04:15
127000 -- (-1895.081) (-1902.116) [-1897.471] (-1896.251) * (-1893.106) (-1900.711) [-1901.791] (-1895.154) -- 0:04:21
127500 -- (-1900.453) (-1896.582) [-1905.021] (-1895.798) * (-1897.016) (-1900.343) (-1898.516) [-1902.485] -- 0:04:20
128000 -- (-1902.036) (-1900.806) (-1898.654) [-1898.990] * (-1896.725) (-1894.467) (-1908.695) [-1893.222] -- 0:04:18
128500 -- [-1900.792] (-1899.131) (-1893.862) (-1907.605) * (-1896.634) (-1892.732) [-1897.019] (-1898.066) -- 0:04:17
129000 -- (-1903.606) (-1905.915) [-1895.164] (-1897.200) * (-1906.769) (-1901.423) [-1898.828] (-1893.837) -- 0:04:16
129500 -- (-1901.182) [-1893.944] (-1892.555) (-1893.954) * (-1918.094) (-1895.889) (-1916.509) [-1895.595] -- 0:04:15
130000 -- (-1907.659) (-1894.681) (-1897.890) [-1899.857] * [-1895.490] (-1900.815) (-1903.293) (-1896.780) -- 0:04:21
Average standard deviation of split frequencies: 0.004810
130500 -- [-1901.342] (-1897.131) (-1906.592) (-1897.741) * (-1906.245) [-1899.935] (-1905.293) (-1911.457) -- 0:04:19
131000 -- [-1900.655] (-1898.938) (-1899.579) (-1893.991) * (-1906.852) (-1899.060) (-1897.785) [-1899.888] -- 0:04:18
131500 -- [-1892.225] (-1898.363) (-1911.439) (-1898.392) * (-1904.854) (-1910.156) [-1894.070] (-1897.833) -- 0:04:17
132000 -- [-1896.576] (-1900.174) (-1897.133) (-1896.880) * (-1896.174) [-1895.782] (-1891.821) (-1900.230) -- 0:04:16
132500 -- [-1894.602] (-1897.282) (-1899.319) (-1898.533) * (-1905.337) (-1897.099) (-1895.598) [-1895.862] -- 0:04:15
133000 -- [-1896.074] (-1905.180) (-1906.246) (-1898.738) * (-1899.772) [-1892.868] (-1908.506) (-1895.570) -- 0:04:14
133500 -- (-1898.200) (-1897.051) [-1896.690] (-1901.262) * [-1905.666] (-1896.248) (-1896.797) (-1899.580) -- 0:04:19
134000 -- (-1895.121) (-1900.439) [-1895.648] (-1905.053) * [-1896.351] (-1892.410) (-1909.040) (-1895.477) -- 0:04:18
134500 -- [-1892.783] (-1898.987) (-1902.120) (-1897.985) * (-1897.933) (-1898.852) [-1899.958] (-1895.652) -- 0:04:17
135000 -- (-1897.079) [-1896.493] (-1897.673) (-1897.483) * [-1904.647] (-1898.729) (-1898.065) (-1900.084) -- 0:04:16
Average standard deviation of split frequencies: 0.000693
135500 -- [-1897.249] (-1893.257) (-1898.324) (-1894.357) * (-1903.676) (-1897.695) [-1898.276] (-1905.601) -- 0:04:15
136000 -- (-1903.868) [-1896.781] (-1902.987) (-1897.783) * (-1899.429) [-1899.813] (-1902.775) (-1896.515) -- 0:04:14
136500 -- [-1904.309] (-1898.265) (-1916.029) (-1895.902) * (-1897.303) (-1900.965) (-1899.992) [-1896.119] -- 0:04:13
137000 -- (-1897.839) (-1896.300) (-1896.141) [-1896.052] * (-1914.785) (-1897.695) [-1895.214] (-1899.906) -- 0:04:18
137500 -- (-1909.678) [-1898.947] (-1894.647) (-1900.369) * (-1896.642) (-1899.291) (-1905.362) [-1899.003] -- 0:04:17
138000 -- (-1900.477) [-1895.713] (-1896.509) (-1907.251) * (-1898.419) (-1910.745) [-1896.882] (-1897.055) -- 0:04:16
138500 -- (-1901.766) (-1899.378) [-1898.471] (-1895.435) * [-1897.704] (-1897.300) (-1897.222) (-1902.627) -- 0:04:15
139000 -- (-1894.155) (-1901.195) (-1893.683) [-1896.705] * (-1899.407) [-1903.100] (-1893.048) (-1899.134) -- 0:04:13
139500 -- (-1896.085) (-1899.484) [-1900.455] (-1901.241) * (-1892.844) [-1904.382] (-1903.382) (-1899.050) -- 0:04:12
140000 -- (-1898.938) (-1899.560) [-1901.335] (-1889.193) * (-1907.406) [-1894.110] (-1903.684) (-1897.926) -- 0:04:11
Average standard deviation of split frequencies: 0.001340
140500 -- (-1901.190) [-1905.185] (-1891.663) (-1892.309) * (-1902.209) (-1898.755) (-1898.838) [-1894.716] -- 0:04:16
141000 -- (-1901.840) (-1900.279) [-1898.429] (-1906.358) * [-1904.929] (-1898.176) (-1900.948) (-1897.507) -- 0:04:15
141500 -- (-1904.328) (-1896.963) (-1894.963) [-1891.018] * (-1900.068) (-1902.923) [-1899.324] (-1905.193) -- 0:04:14
142000 -- (-1903.501) [-1894.515] (-1903.268) (-1900.242) * (-1903.228) (-1905.837) [-1902.339] (-1899.655) -- 0:04:13
142500 -- (-1905.093) (-1902.276) [-1898.361] (-1897.153) * (-1909.279) [-1898.242] (-1896.200) (-1901.910) -- 0:04:12
143000 -- [-1897.064] (-1896.433) (-1896.437) (-1899.513) * (-1906.020) [-1893.720] (-1899.376) (-1902.256) -- 0:04:11
143500 -- [-1900.494] (-1891.097) (-1909.182) (-1895.293) * (-1903.285) [-1900.127] (-1894.936) (-1903.920) -- 0:04:10
144000 -- (-1896.537) (-1899.654) (-1902.238) [-1898.225] * [-1893.755] (-1897.933) (-1902.940) (-1904.169) -- 0:04:15
144500 -- (-1894.848) (-1904.166) (-1911.556) [-1896.210] * (-1904.298) (-1902.315) [-1898.364] (-1904.142) -- 0:04:14
145000 -- (-1914.236) (-1897.521) [-1891.148] (-1901.566) * (-1895.983) (-1899.911) (-1907.458) [-1892.723] -- 0:04:13
Average standard deviation of split frequencies: 0.003229
145500 -- [-1897.489] (-1895.852) (-1901.632) (-1907.300) * [-1894.929] (-1898.054) (-1901.601) (-1895.757) -- 0:04:12
146000 -- (-1909.589) (-1905.495) (-1900.933) [-1890.859] * (-1902.014) (-1894.623) [-1902.298] (-1893.932) -- 0:04:11
146500 -- (-1903.919) (-1907.650) (-1893.996) [-1896.998] * (-1903.942) [-1895.492] (-1901.979) (-1897.670) -- 0:04:10
147000 -- [-1894.003] (-1912.651) (-1897.279) (-1901.546) * [-1894.772] (-1896.569) (-1910.266) (-1895.980) -- 0:04:09
147500 -- (-1895.848) (-1906.316) (-1897.224) [-1897.482] * (-1897.667) [-1893.285] (-1903.647) (-1902.383) -- 0:04:14
148000 -- (-1893.561) [-1895.324] (-1906.214) (-1898.128) * (-1906.470) [-1897.688] (-1903.286) (-1890.997) -- 0:04:13
148500 -- (-1892.644) (-1895.784) (-1903.288) [-1895.470] * (-1899.754) [-1897.993] (-1902.502) (-1902.202) -- 0:04:12
149000 -- [-1898.460] (-1893.081) (-1900.448) (-1903.041) * (-1911.262) (-1898.596) (-1894.475) [-1897.882] -- 0:04:11
149500 -- (-1909.527) (-1912.999) [-1902.048] (-1896.302) * (-1897.000) (-1904.887) (-1897.913) [-1901.543] -- 0:04:10
150000 -- (-1902.831) [-1898.164] (-1895.210) (-1898.368) * (-1904.522) (-1901.014) (-1908.338) [-1901.238] -- 0:04:09
Average standard deviation of split frequencies: 0.004693
150500 -- (-1895.652) (-1897.601) [-1891.004] (-1915.779) * (-1894.095) (-1903.313) (-1897.210) [-1896.319] -- 0:04:14
151000 -- (-1900.006) (-1900.548) (-1895.938) [-1896.506] * (-1900.133) [-1894.368] (-1905.911) (-1903.470) -- 0:04:13
151500 -- [-1893.455] (-1899.886) (-1902.761) (-1897.103) * (-1898.943) (-1913.864) [-1891.990] (-1900.447) -- 0:04:12
152000 -- (-1898.013) [-1898.938] (-1894.426) (-1902.257) * (-1902.173) [-1896.695] (-1898.558) (-1898.880) -- 0:04:11
152500 -- [-1910.075] (-1897.758) (-1898.103) (-1900.811) * (-1894.132) (-1901.394) (-1900.837) [-1894.170] -- 0:04:10
153000 -- [-1895.180] (-1896.794) (-1899.138) (-1897.733) * (-1894.669) [-1898.910] (-1899.913) (-1906.867) -- 0:04:09
153500 -- (-1894.599) (-1909.432) (-1893.490) [-1900.794] * (-1904.294) (-1899.867) [-1892.577] (-1905.241) -- 0:04:08
154000 -- [-1897.666] (-1901.814) (-1897.925) (-1899.766) * (-1895.325) [-1895.865] (-1901.370) (-1894.933) -- 0:04:12
154500 -- (-1895.584) [-1899.140] (-1890.567) (-1895.857) * (-1906.242) (-1897.301) [-1890.005] (-1893.280) -- 0:04:11
155000 -- (-1891.410) [-1893.771] (-1895.710) (-1904.516) * (-1900.051) [-1896.173] (-1896.104) (-1902.066) -- 0:04:10
Average standard deviation of split frequencies: 0.004835
155500 -- [-1897.263] (-1894.103) (-1895.955) (-1898.721) * (-1901.242) [-1900.254] (-1897.231) (-1893.552) -- 0:04:09
156000 -- (-1896.898) (-1891.828) [-1907.553] (-1906.327) * [-1892.435] (-1897.821) (-1899.952) (-1899.659) -- 0:04:08
156500 -- [-1897.341] (-1895.819) (-1903.344) (-1900.470) * (-1901.033) (-1901.050) [-1893.986] (-1901.267) -- 0:04:07
157000 -- (-1901.812) (-1901.594) (-1901.838) [-1902.350] * (-1901.610) (-1890.240) [-1898.611] (-1901.165) -- 0:04:06
157500 -- (-1912.699) [-1899.484] (-1904.956) (-1895.458) * (-1907.366) [-1890.841] (-1895.606) (-1903.547) -- 0:04:11
158000 -- [-1902.626] (-1903.284) (-1900.329) (-1893.132) * (-1895.282) (-1901.487) [-1892.988] (-1895.055) -- 0:04:10
158500 -- (-1894.062) [-1896.251] (-1904.162) (-1895.337) * [-1895.126] (-1897.116) (-1908.567) (-1903.923) -- 0:04:09
159000 -- [-1900.377] (-1895.278) (-1901.647) (-1906.336) * (-1896.230) [-1895.150] (-1894.682) (-1897.492) -- 0:04:08
159500 -- (-1903.929) [-1897.431] (-1894.772) (-1892.622) * (-1891.841) [-1896.894] (-1899.301) (-1892.131) -- 0:04:07
160000 -- (-1900.847) (-1902.957) [-1894.001] (-1898.838) * [-1890.182] (-1896.273) (-1900.451) (-1896.208) -- 0:04:06
Average standard deviation of split frequencies: 0.006455
160500 -- (-1894.932) (-1897.340) (-1892.399) [-1894.777] * (-1904.973) [-1891.465] (-1899.872) (-1900.218) -- 0:04:05
161000 -- (-1894.357) (-1893.672) [-1896.467] (-1898.245) * (-1899.782) [-1898.676] (-1898.134) (-1898.051) -- 0:04:10
161500 -- (-1902.362) [-1899.277] (-1903.935) (-1897.834) * (-1907.044) (-1903.043) (-1901.049) [-1891.723] -- 0:04:09
162000 -- (-1897.210) (-1894.933) (-1896.393) [-1898.820] * [-1896.484] (-1904.399) (-1902.138) (-1901.615) -- 0:04:08
162500 -- (-1898.484) (-1902.593) (-1901.392) [-1893.810] * [-1894.568] (-1901.421) (-1898.774) (-1905.514) -- 0:04:07
163000 -- (-1896.377) [-1896.980] (-1903.551) (-1897.157) * (-1898.842) [-1897.551] (-1900.461) (-1896.366) -- 0:04:06
163500 -- [-1892.420] (-1900.206) (-1899.100) (-1894.658) * [-1893.666] (-1904.440) (-1905.592) (-1904.462) -- 0:04:05
164000 -- (-1908.144) (-1901.363) (-1897.747) [-1893.304] * [-1901.460] (-1899.245) (-1902.795) (-1899.998) -- 0:04:09
164500 -- (-1896.371) (-1900.901) [-1903.396] (-1900.475) * [-1894.437] (-1898.363) (-1900.984) (-1892.120) -- 0:04:08
165000 -- (-1903.186) (-1894.173) [-1892.749] (-1898.795) * (-1899.979) (-1899.195) [-1897.000] (-1898.461) -- 0:04:07
Average standard deviation of split frequencies: 0.005112
165500 -- [-1901.790] (-1898.063) (-1898.725) (-1910.290) * [-1899.787] (-1897.783) (-1899.584) (-1898.333) -- 0:04:07
166000 -- [-1897.927] (-1894.354) (-1895.820) (-1900.254) * [-1895.380] (-1894.687) (-1904.801) (-1896.971) -- 0:04:06
166500 -- [-1893.819] (-1895.674) (-1907.357) (-1905.765) * (-1900.040) (-1906.912) [-1895.245] (-1898.997) -- 0:04:05
167000 -- (-1904.922) (-1896.987) [-1892.753] (-1904.615) * (-1902.190) [-1900.143] (-1899.382) (-1905.373) -- 0:04:04
167500 -- [-1901.618] (-1901.193) (-1898.548) (-1915.508) * (-1898.348) [-1893.307] (-1894.316) (-1898.854) -- 0:04:08
168000 -- (-1906.593) [-1896.425] (-1899.721) (-1903.879) * (-1896.014) [-1893.627] (-1909.830) (-1905.404) -- 0:04:07
168500 -- [-1899.891] (-1903.695) (-1900.666) (-1895.882) * [-1896.298] (-1900.495) (-1892.086) (-1898.048) -- 0:04:06
169000 -- (-1894.678) (-1897.714) [-1896.603] (-1903.285) * (-1904.180) (-1905.005) [-1891.235] (-1900.962) -- 0:04:05
169500 -- (-1894.898) [-1896.603] (-1899.605) (-1899.753) * (-1897.095) [-1903.517] (-1893.352) (-1897.963) -- 0:04:04
170000 -- (-1893.936) (-1898.728) [-1895.125] (-1906.438) * [-1896.801] (-1903.765) (-1895.929) (-1901.394) -- 0:04:04
Average standard deviation of split frequencies: 0.003315
170500 -- (-1900.105) [-1896.909] (-1903.439) (-1898.361) * (-1897.552) [-1896.822] (-1897.282) (-1895.687) -- 0:04:03
171000 -- [-1899.622] (-1900.631) (-1896.739) (-1901.942) * (-1904.345) (-1898.026) (-1896.435) [-1890.228] -- 0:04:07
171500 -- (-1898.994) (-1900.953) [-1893.381] (-1905.218) * (-1907.477) (-1895.824) (-1901.252) [-1895.841] -- 0:04:06
172000 -- (-1899.298) (-1897.779) [-1897.070] (-1902.153) * (-1904.452) [-1897.781] (-1898.217) (-1909.189) -- 0:04:05
172500 -- [-1891.213] (-1907.103) (-1896.873) (-1890.920) * (-1901.760) [-1900.259] (-1898.926) (-1900.685) -- 0:04:04
173000 -- (-1898.439) (-1905.991) [-1896.659] (-1902.839) * (-1908.662) (-1902.170) (-1894.966) [-1892.366] -- 0:04:03
173500 -- [-1894.280] (-1905.067) (-1898.169) (-1899.171) * (-1913.538) (-1898.871) (-1902.501) [-1899.710] -- 0:04:02
174000 -- (-1892.488) (-1909.827) [-1900.145] (-1891.413) * (-1904.090) [-1898.706] (-1901.164) (-1896.490) -- 0:04:02
174500 -- (-1898.432) [-1902.688] (-1897.197) (-1901.833) * (-1899.617) (-1897.595) (-1901.627) [-1898.801] -- 0:04:05
175000 -- [-1899.672] (-1897.754) (-1894.468) (-1898.836) * (-1902.981) (-1893.777) (-1900.995) [-1903.179] -- 0:04:05
Average standard deviation of split frequencies: 0.003214
175500 -- (-1898.995) [-1899.835] (-1898.840) (-1909.630) * [-1896.270] (-1899.322) (-1901.657) (-1901.433) -- 0:04:04
176000 -- (-1895.315) (-1897.975) [-1896.071] (-1900.451) * [-1890.106] (-1899.274) (-1899.196) (-1902.123) -- 0:04:03
176500 -- (-1897.850) [-1903.838] (-1899.344) (-1895.092) * (-1898.340) (-1895.882) [-1897.098] (-1908.318) -- 0:04:02
177000 -- (-1901.231) (-1900.985) [-1901.744] (-1896.930) * (-1895.966) [-1894.337] (-1897.100) (-1899.913) -- 0:04:01
177500 -- (-1903.813) (-1909.015) (-1905.793) [-1890.597] * (-1897.174) (-1896.857) (-1905.116) [-1895.758] -- 0:04:00
178000 -- [-1895.509] (-1896.428) (-1902.709) (-1896.045) * (-1899.534) (-1899.229) [-1898.596] (-1894.896) -- 0:04:04
178500 -- (-1904.297) (-1898.771) (-1905.943) [-1890.232] * (-1895.534) (-1901.169) (-1898.798) [-1898.704] -- 0:04:03
179000 -- (-1901.234) (-1899.316) (-1895.604) [-1895.218] * (-1901.982) [-1903.994] (-1899.465) (-1894.052) -- 0:04:03
179500 -- (-1904.663) (-1892.210) (-1896.714) [-1891.995] * (-1899.735) (-1901.785) [-1891.857] (-1895.767) -- 0:04:02
180000 -- [-1892.916] (-1895.806) (-1898.398) (-1898.119) * (-1909.955) [-1899.302] (-1898.445) (-1897.974) -- 0:04:01
Average standard deviation of split frequencies: 0.003131
180500 -- [-1892.245] (-1902.600) (-1909.277) (-1893.770) * (-1902.785) (-1897.745) [-1898.404] (-1897.947) -- 0:04:00
181000 -- (-1897.679) (-1902.052) [-1893.691] (-1899.255) * (-1896.660) (-1892.767) (-1902.143) [-1894.801] -- 0:03:59
181500 -- (-1901.814) (-1900.345) [-1900.292] (-1901.024) * (-1892.724) [-1899.437] (-1893.788) (-1894.905) -- 0:04:03
182000 -- (-1898.828) [-1898.076] (-1895.853) (-1896.301) * (-1894.159) [-1900.448] (-1890.149) (-1897.531) -- 0:04:02
182500 -- [-1903.518] (-1899.706) (-1903.230) (-1902.267) * [-1895.149] (-1903.172) (-1897.170) (-1901.828) -- 0:04:01
183000 -- (-1901.169) (-1907.221) [-1900.202] (-1897.091) * (-1896.467) [-1898.766] (-1896.557) (-1904.976) -- 0:04:01
183500 -- (-1898.805) (-1901.872) (-1896.899) [-1889.809] * [-1897.400] (-1896.736) (-1898.686) (-1897.183) -- 0:04:00
184000 -- (-1899.206) [-1895.969] (-1899.153) (-1905.313) * (-1904.398) (-1902.739) (-1901.148) [-1896.338] -- 0:03:59
184500 -- [-1894.260] (-1898.670) (-1909.132) (-1901.619) * (-1903.567) [-1901.948] (-1897.031) (-1896.624) -- 0:04:03
185000 -- (-1897.034) (-1894.405) [-1899.324] (-1896.671) * (-1904.731) (-1894.188) (-1894.362) [-1895.596] -- 0:04:02
Average standard deviation of split frequencies: 0.002028
185500 -- (-1901.111) (-1895.612) [-1898.995] (-1895.710) * (-1903.561) [-1896.182] (-1901.376) (-1898.029) -- 0:04:01
186000 -- (-1895.684) [-1893.711] (-1902.913) (-1893.307) * (-1898.785) (-1912.380) (-1897.329) [-1893.539] -- 0:04:00
186500 -- [-1894.657] (-1896.914) (-1894.077) (-1909.635) * (-1900.435) (-1897.462) (-1907.822) [-1895.457] -- 0:03:59
187000 -- [-1898.481] (-1901.533) (-1906.112) (-1904.772) * (-1895.534) (-1901.120) [-1892.456] (-1896.398) -- 0:03:59
187500 -- [-1895.994] (-1897.987) (-1895.546) (-1900.377) * (-1903.941) [-1901.819] (-1897.467) (-1899.283) -- 0:03:58
188000 -- (-1890.391) (-1902.791) [-1900.041] (-1906.994) * [-1900.451] (-1902.255) (-1903.247) (-1898.998) -- 0:04:01
188500 -- (-1892.811) (-1912.363) [-1900.449] (-1895.963) * [-1895.515] (-1903.209) (-1904.819) (-1901.718) -- 0:04:01
189000 -- (-1897.445) (-1911.191) [-1905.184] (-1898.968) * (-1897.180) (-1912.462) (-1901.424) [-1895.607] -- 0:04:00
189500 -- (-1894.184) (-1900.137) (-1911.281) [-1899.406] * (-1906.491) (-1906.096) [-1895.428] (-1901.977) -- 0:03:59
190000 -- [-1903.152] (-1897.787) (-1911.879) (-1911.382) * (-1905.976) (-1895.832) [-1893.771] (-1905.024) -- 0:03:58
Average standard deviation of split frequencies: 0.003956
190500 -- (-1894.316) [-1892.274] (-1907.001) (-1904.586) * (-1899.160) (-1900.212) [-1895.776] (-1892.426) -- 0:03:57
191000 -- [-1897.733] (-1898.760) (-1901.813) (-1904.626) * [-1895.448] (-1902.425) (-1895.581) (-1898.445) -- 0:03:57
191500 -- (-1899.888) (-1902.236) [-1907.131] (-1905.254) * (-1895.612) (-1904.101) [-1892.876] (-1901.399) -- 0:04:00
192000 -- [-1900.337] (-1893.580) (-1908.499) (-1900.162) * (-1895.094) (-1904.549) (-1907.318) [-1892.895] -- 0:03:59
192500 -- (-1902.382) [-1898.587] (-1897.642) (-1906.588) * (-1900.819) (-1895.606) (-1902.331) [-1893.033] -- 0:03:59
193000 -- (-1893.907) (-1899.756) [-1891.530] (-1893.195) * (-1900.238) [-1896.417] (-1904.812) (-1898.922) -- 0:03:58
193500 -- (-1895.079) (-1899.610) (-1892.883) [-1892.352] * (-1899.216) (-1907.977) [-1905.467] (-1893.519) -- 0:03:57
194000 -- (-1902.489) [-1894.344] (-1903.333) (-1903.706) * (-1903.407) (-1913.155) (-1906.114) [-1895.014] -- 0:03:56
194500 -- (-1900.601) [-1899.390] (-1894.735) (-1904.110) * (-1893.725) (-1900.157) [-1898.444] (-1892.831) -- 0:03:56
195000 -- (-1897.531) [-1896.879] (-1895.648) (-1907.986) * (-1912.131) (-1897.959) (-1904.357) [-1893.195] -- 0:03:59
Average standard deviation of split frequencies: 0.005772
195500 -- [-1887.533] (-1902.512) (-1894.013) (-1901.174) * (-1906.712) (-1902.884) [-1897.051] (-1896.392) -- 0:03:58
196000 -- (-1907.670) (-1899.978) [-1901.467] (-1897.745) * (-1897.253) [-1894.785] (-1892.941) (-1892.880) -- 0:03:57
196500 -- (-1899.407) (-1900.649) (-1902.613) [-1900.789] * (-1891.939) (-1891.237) [-1904.105] (-1886.967) -- 0:03:57
197000 -- (-1905.603) [-1891.291] (-1900.454) (-1893.985) * (-1896.766) (-1905.561) (-1896.996) [-1895.595] -- 0:03:56
197500 -- (-1908.317) (-1898.310) [-1895.045] (-1902.141) * (-1910.704) (-1898.251) [-1898.423] (-1894.890) -- 0:03:55
198000 -- (-1906.137) (-1896.265) [-1893.186] (-1907.154) * (-1901.436) [-1898.797] (-1900.990) (-1894.794) -- 0:03:58
198500 -- [-1901.260] (-1898.466) (-1895.058) (-1897.407) * (-1892.452) (-1909.487) (-1893.808) [-1898.820] -- 0:03:58
199000 -- (-1906.432) (-1897.513) (-1899.312) [-1897.486] * [-1894.637] (-1901.657) (-1895.173) (-1904.889) -- 0:03:57
199500 -- (-1902.443) [-1900.782] (-1903.329) (-1900.235) * (-1902.541) (-1907.039) (-1894.930) [-1898.757] -- 0:03:56
200000 -- (-1904.223) (-1894.659) (-1898.621) [-1897.471] * (-1903.501) (-1895.829) (-1895.356) [-1893.927] -- 0:03:56
Average standard deviation of split frequencies: 0.004698
200500 -- (-1903.968) (-1899.707) [-1898.741] (-1911.781) * (-1895.802) [-1896.781] (-1898.559) (-1904.896) -- 0:03:55
201000 -- (-1908.077) (-1897.356) (-1902.715) [-1893.505] * (-1905.743) [-1902.629] (-1898.528) (-1907.875) -- 0:03:54
201500 -- [-1903.163] (-1899.231) (-1917.237) (-1899.966) * (-1906.096) [-1895.772] (-1897.105) (-1898.614) -- 0:03:57
202000 -- [-1907.839] (-1897.955) (-1906.186) (-1908.343) * (-1897.755) (-1900.764) (-1898.721) [-1892.007] -- 0:03:57
202500 -- (-1901.842) [-1897.231] (-1902.587) (-1892.167) * (-1899.650) [-1892.913] (-1904.957) (-1901.626) -- 0:03:56
203000 -- (-1898.678) (-1897.318) (-1891.189) [-1894.009] * [-1898.484] (-1895.284) (-1896.819) (-1897.493) -- 0:03:55
203500 -- [-1893.845] (-1897.050) (-1899.391) (-1903.365) * (-1906.904) [-1893.213] (-1889.509) (-1909.122) -- 0:03:54
204000 -- (-1893.404) (-1893.203) [-1898.850] (-1905.773) * (-1892.777) (-1901.737) (-1902.128) [-1889.772] -- 0:03:54
204500 -- [-1899.886] (-1892.306) (-1899.320) (-1898.250) * (-1901.360) (-1904.216) [-1894.591] (-1900.043) -- 0:03:53
205000 -- (-1896.628) (-1902.189) [-1896.034] (-1900.443) * (-1900.197) [-1904.774] (-1898.828) (-1893.814) -- 0:03:56
Average standard deviation of split frequencies: 0.004119
205500 -- (-1900.267) (-1898.453) [-1904.186] (-1893.045) * (-1902.019) (-1912.895) [-1896.728] (-1904.009) -- 0:03:55
206000 -- (-1897.918) [-1897.649] (-1903.236) (-1898.447) * (-1906.088) (-1903.924) (-1904.502) [-1900.083] -- 0:03:55
206500 -- (-1910.872) [-1892.228] (-1901.653) (-1900.347) * (-1909.556) (-1905.828) [-1899.104] (-1898.948) -- 0:03:54
207000 -- [-1892.602] (-1907.686) (-1908.323) (-1898.779) * (-1903.065) (-1901.417) (-1907.109) [-1895.678] -- 0:03:53
207500 -- (-1893.176) (-1900.694) [-1903.415] (-1896.148) * (-1912.376) (-1899.962) [-1894.693] (-1898.915) -- 0:03:52
208000 -- [-1896.970] (-1900.670) (-1899.049) (-1900.879) * (-1897.475) [-1889.335] (-1902.095) (-1901.866) -- 0:03:52
208500 -- (-1897.248) [-1895.391] (-1897.830) (-1903.019) * (-1902.976) (-1898.943) (-1891.205) [-1896.819] -- 0:03:55
209000 -- (-1897.912) (-1901.117) (-1905.046) [-1898.447] * (-1899.716) (-1901.072) (-1901.954) [-1892.869] -- 0:03:54
209500 -- (-1898.368) [-1893.441] (-1897.978) (-1897.695) * (-1908.263) [-1893.315] (-1904.459) (-1900.431) -- 0:03:53
210000 -- (-1899.062) (-1899.481) (-1898.769) [-1893.718] * [-1895.639] (-1905.331) (-1896.423) (-1894.947) -- 0:03:53
Average standard deviation of split frequencies: 0.004923
210500 -- (-1898.947) (-1908.959) (-1893.515) [-1896.614] * (-1900.213) [-1894.633] (-1903.454) (-1908.369) -- 0:03:52
211000 -- (-1903.489) [-1898.438] (-1897.249) (-1900.411) * (-1904.172) (-1900.011) [-1895.228] (-1902.186) -- 0:03:51
211500 -- [-1896.015] (-1903.095) (-1895.269) (-1896.465) * (-1908.557) [-1896.320] (-1906.875) (-1894.845) -- 0:03:51
212000 -- (-1896.542) (-1899.426) [-1895.934] (-1896.633) * (-1907.307) (-1899.057) [-1897.959] (-1906.191) -- 0:03:54
212500 -- (-1896.932) (-1898.440) (-1901.326) [-1898.490] * (-1896.927) (-1906.698) [-1896.626] (-1901.855) -- 0:03:53
213000 -- (-1900.489) (-1898.694) [-1895.556] (-1900.764) * (-1892.374) (-1901.949) [-1902.449] (-1896.602) -- 0:03:52
213500 -- (-1894.421) [-1901.382] (-1900.412) (-1897.403) * (-1901.590) (-1892.077) (-1898.414) [-1892.448] -- 0:03:52
214000 -- (-1896.757) (-1901.395) (-1893.479) [-1904.436] * (-1899.331) [-1898.799] (-1898.162) (-1900.693) -- 0:03:51
214500 -- (-1900.923) (-1895.312) (-1896.305) [-1897.970] * (-1904.942) (-1903.924) [-1896.787] (-1899.914) -- 0:03:50
215000 -- (-1897.825) [-1898.836] (-1896.512) (-1898.328) * (-1914.452) (-1897.166) (-1901.684) [-1899.076] -- 0:03:53
Average standard deviation of split frequencies: 0.003928
215500 -- (-1895.026) [-1902.968] (-1897.674) (-1903.947) * (-1909.143) (-1894.989) (-1907.750) [-1896.410] -- 0:03:52
216000 -- (-1902.495) [-1901.199] (-1902.386) (-1898.510) * (-1901.561) (-1894.846) [-1901.327] (-1889.498) -- 0:03:52
216500 -- [-1889.268] (-1899.322) (-1904.013) (-1901.238) * (-1903.803) (-1908.910) [-1898.138] (-1898.283) -- 0:03:51
217000 -- (-1895.541) (-1910.600) (-1901.830) [-1896.184] * [-1907.373] (-1897.276) (-1895.630) (-1892.245) -- 0:03:50
217500 -- [-1898.256] (-1891.460) (-1893.970) (-1895.923) * (-1898.230) [-1897.867] (-1895.735) (-1890.780) -- 0:03:50
218000 -- (-1899.468) [-1904.910] (-1898.039) (-1894.879) * [-1896.086] (-1904.434) (-1900.484) (-1903.833) -- 0:03:49
218500 -- (-1895.023) (-1896.429) [-1897.966] (-1902.952) * [-1899.085] (-1894.642) (-1900.789) (-1900.720) -- 0:03:52
219000 -- [-1893.450] (-1913.306) (-1895.611) (-1894.430) * (-1903.269) [-1898.091] (-1906.616) (-1893.322) -- 0:03:51
219500 -- (-1902.960) (-1899.550) [-1900.587] (-1909.124) * [-1895.911] (-1901.601) (-1891.368) (-1903.119) -- 0:03:51
220000 -- (-1903.145) (-1903.217) [-1902.805] (-1902.903) * (-1903.606) [-1896.436] (-1890.213) (-1899.824) -- 0:03:50
Average standard deviation of split frequencies: 0.002991
220500 -- (-1896.180) [-1899.900] (-1895.976) (-1899.585) * (-1896.463) (-1901.705) (-1902.027) [-1891.241] -- 0:03:49
221000 -- (-1896.657) (-1904.105) (-1897.451) [-1903.001] * (-1901.214) [-1895.666] (-1899.609) (-1904.945) -- 0:03:49
221500 -- (-1898.437) [-1900.137] (-1898.854) (-1906.374) * (-1903.355) [-1897.491] (-1893.622) (-1898.148) -- 0:03:48
222000 -- (-1894.058) [-1895.785] (-1903.483) (-1895.917) * (-1906.598) [-1895.293] (-1904.374) (-1895.739) -- 0:03:51
222500 -- [-1903.397] (-1902.202) (-1903.845) (-1900.852) * (-1902.235) [-1897.051] (-1897.423) (-1907.556) -- 0:03:50
223000 -- [-1901.259] (-1899.275) (-1903.434) (-1909.222) * (-1900.213) (-1904.178) [-1899.813] (-1908.989) -- 0:03:49
223500 -- (-1904.144) [-1898.606] (-1896.789) (-1901.822) * (-1903.859) (-1899.226) [-1891.287] (-1895.140) -- 0:03:49
224000 -- (-1898.488) (-1895.239) (-1897.040) [-1898.746] * (-1898.223) [-1893.879] (-1891.251) (-1895.983) -- 0:03:48
224500 -- (-1900.597) (-1909.226) [-1896.716] (-1895.228) * (-1899.259) (-1901.185) [-1898.545] (-1890.635) -- 0:03:47
225000 -- (-1900.233) (-1901.291) [-1898.938] (-1905.525) * (-1898.057) [-1900.803] (-1896.929) (-1904.454) -- 0:03:47
Average standard deviation of split frequencies: 0.004172
225500 -- (-1898.488) [-1901.736] (-1903.899) (-1903.698) * (-1902.485) (-1902.191) (-1898.580) [-1896.095] -- 0:03:50
226000 -- (-1892.499) (-1899.008) [-1895.614] (-1895.442) * (-1904.072) (-1897.043) [-1900.225] (-1906.335) -- 0:03:49
226500 -- (-1900.088) (-1899.043) [-1897.625] (-1895.271) * (-1896.412) [-1895.324] (-1898.913) (-1894.826) -- 0:03:48
227000 -- [-1901.224] (-1898.809) (-1899.822) (-1897.195) * (-1901.665) (-1899.147) (-1903.989) [-1899.177] -- 0:03:48
227500 -- [-1900.138] (-1896.634) (-1902.990) (-1896.694) * [-1898.447] (-1902.294) (-1901.574) (-1899.023) -- 0:03:47
228000 -- (-1898.724) [-1896.708] (-1899.429) (-1896.912) * [-1894.661] (-1893.910) (-1892.997) (-1908.225) -- 0:03:46
228500 -- (-1894.844) [-1894.421] (-1894.020) (-1897.001) * (-1891.861) (-1902.484) [-1892.061] (-1903.335) -- 0:03:49
229000 -- (-1899.521) (-1900.102) [-1898.156] (-1894.133) * (-1902.591) (-1903.081) (-1899.648) [-1899.387] -- 0:03:48
229500 -- (-1899.520) (-1900.112) [-1894.783] (-1898.827) * [-1898.615] (-1911.995) (-1897.904) (-1897.966) -- 0:03:48
230000 -- (-1899.675) (-1897.783) (-1898.894) [-1893.374] * (-1894.901) (-1897.172) (-1900.227) [-1896.975] -- 0:03:47
Average standard deviation of split frequencies: 0.003270
230500 -- (-1909.326) (-1900.826) (-1896.150) [-1892.083] * [-1893.036] (-1898.029) (-1909.682) (-1901.863) -- 0:03:47
231000 -- (-1898.148) [-1902.003] (-1900.477) (-1895.817) * (-1895.367) (-1897.788) [-1899.400] (-1898.134) -- 0:03:46
231500 -- (-1900.485) [-1899.611] (-1898.715) (-1898.952) * (-1895.706) [-1891.791] (-1921.321) (-1897.130) -- 0:03:45
232000 -- [-1898.662] (-1895.954) (-1902.043) (-1917.758) * (-1900.467) (-1896.242) [-1901.097] (-1893.898) -- 0:03:48
232500 -- (-1901.828) (-1898.391) [-1894.785] (-1906.700) * [-1900.764] (-1894.507) (-1899.850) (-1909.946) -- 0:03:47
233000 -- (-1900.487) (-1901.043) (-1893.528) [-1903.566] * (-1901.324) (-1899.850) (-1895.676) [-1898.480] -- 0:03:47
233500 -- (-1897.898) (-1897.846) (-1895.128) [-1894.668] * (-1893.100) [-1897.332] (-1903.625) (-1897.024) -- 0:03:46
234000 -- (-1896.364) [-1895.063] (-1892.712) (-1893.786) * [-1896.724] (-1904.974) (-1898.586) (-1900.066) -- 0:03:45
234500 -- (-1895.696) (-1904.065) [-1895.178] (-1901.670) * (-1899.249) (-1900.883) (-1898.126) [-1898.676] -- 0:03:45
235000 -- (-1895.738) (-1899.766) [-1893.499] (-1899.254) * (-1911.311) (-1890.741) (-1902.529) [-1893.651] -- 0:03:44
Average standard deviation of split frequencies: 0.003196
235500 -- [-1895.051] (-1898.000) (-1898.144) (-1903.596) * (-1895.028) [-1890.801] (-1900.160) (-1900.759) -- 0:03:47
236000 -- [-1902.371] (-1900.558) (-1897.229) (-1896.455) * [-1894.395] (-1901.799) (-1893.070) (-1899.083) -- 0:03:46
236500 -- (-1904.258) [-1900.621] (-1905.617) (-1898.965) * (-1895.994) (-1899.580) (-1896.644) [-1897.031] -- 0:03:45
237000 -- (-1895.735) [-1897.581] (-1901.885) (-1899.841) * (-1900.380) [-1894.173] (-1889.184) (-1902.864) -- 0:03:45
237500 -- (-1899.860) (-1903.770) (-1904.938) [-1904.100] * (-1898.592) [-1892.659] (-1905.320) (-1895.594) -- 0:03:44
238000 -- (-1892.791) [-1900.817] (-1901.767) (-1895.274) * (-1902.406) (-1898.074) (-1901.336) [-1892.080] -- 0:03:47
238500 -- (-1890.074) (-1895.339) (-1900.108) [-1894.678] * (-1897.536) [-1889.235] (-1904.256) (-1901.929) -- 0:03:46
239000 -- (-1894.604) [-1893.108] (-1899.419) (-1896.759) * (-1902.281) (-1891.485) (-1897.982) [-1894.257] -- 0:03:46
239500 -- (-1895.455) (-1897.953) (-1900.408) [-1892.542] * (-1895.910) (-1910.932) [-1896.186] (-1893.329) -- 0:03:45
240000 -- [-1897.558] (-1903.432) (-1899.765) (-1893.575) * [-1900.780] (-1910.151) (-1894.413) (-1898.275) -- 0:03:44
Average standard deviation of split frequencies: 0.003134
240500 -- (-1894.149) (-1892.598) (-1898.670) [-1899.846] * (-1904.290) (-1904.412) (-1891.396) [-1900.144] -- 0:03:44
241000 -- (-1894.367) (-1893.415) [-1893.778] (-1897.692) * (-1911.230) (-1896.329) [-1900.106] (-1902.942) -- 0:03:43
241500 -- (-1902.700) (-1891.697) (-1892.682) [-1901.526] * (-1905.145) [-1898.206] (-1902.452) (-1900.302) -- 0:03:46
242000 -- [-1898.574] (-1898.564) (-1895.083) (-1902.943) * [-1894.378] (-1903.823) (-1900.871) (-1899.416) -- 0:03:45
242500 -- [-1896.107] (-1896.250) (-1896.065) (-1908.162) * (-1893.081) (-1900.063) (-1897.888) [-1893.472] -- 0:03:44
243000 -- [-1897.168] (-1895.000) (-1896.336) (-1900.370) * [-1895.493] (-1898.272) (-1903.875) (-1899.245) -- 0:03:44
243500 -- [-1892.200] (-1902.087) (-1898.081) (-1904.652) * [-1895.567] (-1897.248) (-1901.303) (-1905.037) -- 0:03:43
244000 -- [-1899.233] (-1899.291) (-1900.014) (-1902.621) * [-1894.884] (-1898.791) (-1895.858) (-1903.371) -- 0:03:43
244500 -- (-1901.859) (-1889.137) [-1899.182] (-1897.543) * (-1901.997) [-1891.550] (-1899.363) (-1897.963) -- 0:03:42
245000 -- [-1896.314] (-1905.302) (-1897.899) (-1902.746) * (-1890.584) (-1890.144) (-1897.165) [-1895.128] -- 0:03:44
Average standard deviation of split frequencies: 0.004216
245500 -- [-1892.592] (-1895.041) (-1903.148) (-1904.135) * (-1904.241) (-1900.212) [-1900.483] (-1900.686) -- 0:03:44
246000 -- (-1897.302) (-1896.889) [-1897.074] (-1910.154) * (-1897.985) [-1895.932] (-1902.151) (-1903.673) -- 0:03:43
246500 -- (-1899.481) [-1895.015] (-1893.891) (-1908.261) * (-1900.767) [-1897.480] (-1898.144) (-1910.398) -- 0:03:43
247000 -- (-1897.923) (-1901.873) [-1897.877] (-1902.755) * [-1900.143] (-1903.084) (-1906.593) (-1897.689) -- 0:03:42
247500 -- (-1901.446) (-1901.571) [-1893.060] (-1899.325) * [-1890.487] (-1896.792) (-1908.626) (-1907.515) -- 0:03:41
248000 -- (-1895.197) [-1902.774] (-1896.974) (-1899.876) * (-1895.841) (-1900.963) (-1908.837) [-1890.680] -- 0:03:41
248500 -- [-1895.681] (-1895.770) (-1904.432) (-1901.539) * [-1894.337] (-1905.384) (-1901.834) (-1901.651) -- 0:03:43
249000 -- [-1891.893] (-1895.186) (-1894.398) (-1898.603) * [-1896.579] (-1900.168) (-1892.291) (-1909.927) -- 0:03:43
249500 -- (-1892.616) (-1895.934) [-1892.897] (-1896.901) * (-1898.591) (-1906.335) [-1907.564] (-1901.390) -- 0:03:42
250000 -- (-1898.853) (-1897.241) [-1900.838] (-1903.073) * [-1892.298] (-1903.436) (-1905.143) (-1900.023) -- 0:03:42
Average standard deviation of split frequencies: 0.003385
250500 -- [-1896.702] (-1896.040) (-1901.839) (-1900.456) * [-1892.742] (-1904.439) (-1903.511) (-1907.226) -- 0:03:41
251000 -- (-1906.297) (-1898.136) [-1903.799] (-1906.906) * (-1896.389) (-1897.796) (-1902.019) [-1898.022] -- 0:03:40
251500 -- (-1899.800) (-1894.950) (-1896.578) [-1899.266] * (-1913.993) [-1894.013] (-1896.769) (-1901.765) -- 0:03:43
252000 -- (-1891.920) [-1897.963] (-1905.151) (-1899.009) * (-1894.713) [-1906.845] (-1894.851) (-1893.360) -- 0:03:42
252500 -- (-1898.606) (-1897.013) (-1895.790) [-1897.755] * [-1907.764] (-1909.948) (-1901.166) (-1902.356) -- 0:03:42
253000 -- (-1894.999) (-1896.421) (-1899.627) [-1894.384] * (-1897.485) (-1896.806) [-1895.053] (-1902.668) -- 0:03:41
253500 -- (-1894.059) [-1898.826] (-1903.169) (-1897.127) * (-1890.522) [-1899.881] (-1899.736) (-1903.023) -- 0:03:40
254000 -- (-1899.562) (-1902.046) (-1901.631) [-1896.810] * (-1902.896) (-1895.477) [-1889.925] (-1895.221) -- 0:03:40
254500 -- [-1898.563] (-1900.203) (-1896.458) (-1897.827) * (-1903.006) (-1901.535) [-1894.125] (-1899.492) -- 0:03:39
255000 -- (-1903.368) (-1900.912) (-1896.955) [-1895.958] * (-1902.884) (-1899.728) (-1901.040) [-1897.685] -- 0:03:42
Average standard deviation of split frequencies: 0.002946
255500 -- (-1896.445) (-1897.038) [-1896.178] (-1903.633) * (-1898.085) (-1897.624) [-1895.132] (-1897.292) -- 0:03:41
256000 -- [-1900.339] (-1899.831) (-1897.651) (-1899.330) * (-1903.481) [-1899.181] (-1895.230) (-1891.695) -- 0:03:40
256500 -- (-1898.426) (-1900.596) [-1902.333] (-1909.267) * [-1896.238] (-1898.288) (-1912.802) (-1899.739) -- 0:03:40
257000 -- (-1902.401) [-1901.719] (-1897.380) (-1893.309) * (-1897.817) (-1902.930) (-1906.467) [-1907.722] -- 0:03:39
257500 -- (-1907.006) (-1900.357) (-1904.617) [-1894.889] * (-1904.506) (-1898.787) [-1890.930] (-1895.595) -- 0:03:39
258000 -- [-1897.418] (-1896.634) (-1897.122) (-1895.392) * (-1900.819) (-1901.260) [-1892.721] (-1900.661) -- 0:03:38
258500 -- [-1899.380] (-1907.961) (-1900.900) (-1898.796) * (-1903.559) (-1901.739) (-1898.326) [-1896.948] -- 0:03:40
259000 -- [-1899.095] (-1899.656) (-1898.737) (-1890.089) * (-1896.225) (-1896.419) [-1900.299] (-1899.792) -- 0:03:40
259500 -- (-1906.265) [-1897.455] (-1897.437) (-1898.042) * (-1896.309) (-1905.555) (-1902.091) [-1892.272] -- 0:03:39
260000 -- (-1902.890) (-1900.948) (-1897.452) [-1897.019] * (-1900.808) (-1896.896) (-1900.219) [-1898.639] -- 0:03:39
Average standard deviation of split frequencies: 0.003617
260500 -- [-1896.946] (-1904.454) (-1899.649) (-1899.626) * [-1900.733] (-1896.180) (-1902.451) (-1894.369) -- 0:03:38
261000 -- (-1898.006) (-1894.835) [-1893.503] (-1904.624) * (-1895.330) (-1897.707) [-1905.572] (-1898.393) -- 0:03:38
261500 -- (-1908.999) (-1896.364) [-1898.670] (-1899.589) * (-1898.825) (-1902.928) (-1902.553) [-1892.319] -- 0:03:37
262000 -- (-1897.898) (-1903.129) (-1901.666) [-1894.665] * (-1905.616) (-1897.746) [-1894.955] (-1896.583) -- 0:03:39
262500 -- (-1901.282) (-1897.085) (-1898.933) [-1896.910] * (-1901.873) (-1903.891) [-1899.069] (-1894.098) -- 0:03:39
263000 -- (-1896.750) (-1897.405) [-1893.757] (-1892.421) * (-1903.269) (-1907.774) (-1896.796) [-1894.398] -- 0:03:38
263500 -- (-1894.458) (-1907.416) (-1896.589) [-1896.403] * [-1901.609] (-1905.868) (-1893.806) (-1898.939) -- 0:03:38
264000 -- [-1893.571] (-1901.532) (-1899.438) (-1901.252) * (-1898.679) (-1907.484) (-1892.283) [-1905.139] -- 0:03:37
264500 -- [-1900.786] (-1896.517) (-1896.004) (-1901.208) * [-1895.647] (-1897.685) (-1908.605) (-1898.639) -- 0:03:36
265000 -- (-1900.368) (-1897.968) [-1896.507] (-1904.385) * (-1897.987) [-1895.583] (-1900.195) (-1894.620) -- 0:03:39
Average standard deviation of split frequencies: 0.002836
265500 -- (-1903.577) (-1902.635) (-1905.300) [-1903.273] * [-1894.634] (-1896.718) (-1898.162) (-1894.672) -- 0:03:38
266000 -- (-1895.806) (-1905.342) (-1901.810) [-1901.428] * (-1907.462) (-1892.055) [-1905.390] (-1905.761) -- 0:03:37
266500 -- (-1901.881) (-1904.851) [-1897.406] (-1895.675) * (-1907.483) (-1897.409) [-1897.950] (-1899.981) -- 0:03:37
267000 -- (-1903.054) (-1904.255) (-1895.953) [-1898.844] * (-1894.994) (-1904.279) [-1900.064] (-1900.189) -- 0:03:36
267500 -- (-1901.650) (-1907.686) (-1899.501) [-1896.762] * (-1892.558) (-1901.066) [-1900.335] (-1896.643) -- 0:03:36
268000 -- (-1903.823) [-1901.303] (-1897.279) (-1901.468) * (-1904.483) (-1902.199) [-1901.697] (-1900.888) -- 0:03:35
268500 -- (-1898.316) (-1895.707) [-1895.023] (-1897.090) * (-1900.079) (-1902.597) (-1899.797) [-1897.615] -- 0:03:37
269000 -- (-1896.271) (-1901.423) [-1902.843] (-1906.858) * (-1894.250) [-1899.771] (-1899.631) (-1900.974) -- 0:03:37
269500 -- (-1899.100) [-1895.943] (-1902.212) (-1892.771) * [-1898.724] (-1897.633) (-1898.246) (-1901.111) -- 0:03:36
270000 -- (-1894.692) (-1896.540) (-1898.606) [-1898.557] * (-1900.931) (-1902.455) [-1893.177] (-1898.681) -- 0:03:36
Average standard deviation of split frequencies: 0.002787
270500 -- (-1900.240) (-1891.054) [-1897.000] (-1899.387) * (-1898.314) (-1896.758) [-1896.568] (-1899.018) -- 0:03:35
271000 -- (-1911.835) [-1892.852] (-1901.906) (-1895.879) * (-1899.369) [-1897.456] (-1900.292) (-1899.941) -- 0:03:35
271500 -- [-1897.506] (-1897.795) (-1902.223) (-1902.627) * [-1896.471] (-1901.497) (-1900.072) (-1899.885) -- 0:03:34
272000 -- (-1898.477) (-1904.027) (-1897.047) [-1898.746] * (-1900.914) (-1902.042) [-1902.268] (-1893.517) -- 0:03:36
272500 -- (-1892.887) (-1908.140) (-1901.797) [-1901.045] * (-1893.250) [-1897.209] (-1908.172) (-1895.358) -- 0:03:36
273000 -- [-1893.718] (-1896.974) (-1900.068) (-1891.556) * [-1894.152] (-1896.095) (-1900.963) (-1907.518) -- 0:03:35
273500 -- [-1895.031] (-1896.719) (-1900.416) (-1896.336) * (-1892.776) (-1901.686) (-1905.821) [-1896.643] -- 0:03:35
274000 -- (-1897.915) [-1892.947] (-1896.736) (-1896.576) * (-1901.693) [-1906.515] (-1900.485) (-1901.554) -- 0:03:34
274500 -- (-1902.491) (-1898.651) (-1899.374) [-1892.270] * (-1900.313) (-1899.007) (-1907.983) [-1900.226] -- 0:03:34
275000 -- (-1905.450) (-1897.230) [-1890.538] (-1898.752) * (-1896.905) [-1897.226] (-1899.731) (-1895.741) -- 0:03:33
Average standard deviation of split frequencies: 0.002733
275500 -- (-1890.298) (-1900.266) [-1896.996] (-1898.575) * (-1900.753) [-1895.160] (-1905.152) (-1903.196) -- 0:03:35
276000 -- (-1894.669) [-1896.861] (-1899.250) (-1905.600) * [-1896.320] (-1891.926) (-1896.571) (-1903.231) -- 0:03:35
276500 -- (-1898.102) (-1893.367) [-1901.853] (-1899.186) * (-1902.717) [-1899.958] (-1893.219) (-1896.619) -- 0:03:34
277000 -- (-1896.235) (-1895.982) (-1904.828) [-1907.044] * (-1907.189) (-1895.861) (-1903.525) [-1897.646] -- 0:03:34
277500 -- (-1900.734) (-1899.135) (-1894.563) [-1896.198] * (-1898.404) (-1892.050) [-1896.914] (-1899.655) -- 0:03:33
278000 -- (-1900.041) [-1898.530] (-1903.363) (-1898.767) * (-1910.067) (-1892.584) [-1897.980] (-1894.121) -- 0:03:32
278500 -- (-1898.384) (-1899.317) (-1898.916) [-1894.443] * (-1899.542) (-1895.265) [-1893.629] (-1900.391) -- 0:03:32
279000 -- [-1894.054] (-1903.467) (-1901.285) (-1908.655) * [-1900.942] (-1899.612) (-1893.500) (-1896.159) -- 0:03:34
279500 -- (-1893.840) [-1904.533] (-1900.475) (-1905.291) * (-1900.532) (-1896.189) [-1895.167] (-1894.682) -- 0:03:33
280000 -- (-1896.880) (-1900.864) [-1900.444] (-1899.984) * (-1888.475) (-1898.971) (-1894.277) [-1898.211] -- 0:03:33
Average standard deviation of split frequencies: 0.002351
280500 -- [-1894.045] (-1898.105) (-1912.287) (-1894.112) * (-1897.211) [-1903.988] (-1894.163) (-1894.803) -- 0:03:32
281000 -- [-1900.348] (-1907.658) (-1911.438) (-1902.135) * (-1892.153) (-1907.555) [-1893.766] (-1891.659) -- 0:03:32
281500 -- (-1897.643) (-1907.510) (-1907.669) [-1902.090] * (-1901.536) (-1898.491) (-1903.693) [-1901.040] -- 0:03:31
282000 -- (-1898.862) (-1901.449) [-1904.588] (-1901.076) * (-1907.843) [-1904.516] (-1910.057) (-1899.288) -- 0:03:33
282500 -- (-1900.512) (-1905.119) [-1892.878] (-1899.171) * (-1899.243) [-1899.484] (-1895.296) (-1892.735) -- 0:03:33
283000 -- (-1895.451) (-1900.542) [-1892.858] (-1902.883) * (-1901.827) (-1908.254) (-1896.879) [-1898.839] -- 0:03:32
283500 -- [-1892.873] (-1895.316) (-1901.434) (-1909.490) * [-1898.780] (-1900.291) (-1901.179) (-1896.141) -- 0:03:32
284000 -- [-1893.704] (-1900.210) (-1899.827) (-1896.099) * (-1906.765) (-1901.593) [-1898.320] (-1893.721) -- 0:03:31
284500 -- (-1900.718) (-1907.599) [-1893.854] (-1897.889) * [-1904.405] (-1900.250) (-1901.840) (-1897.565) -- 0:03:31
285000 -- (-1900.314) [-1901.328] (-1905.127) (-1894.882) * (-1901.348) (-1902.373) [-1898.864] (-1900.629) -- 0:03:30
Average standard deviation of split frequencies: 0.002637
285500 -- (-1897.237) (-1899.082) (-1899.979) [-1895.788] * [-1907.037] (-1902.288) (-1893.545) (-1904.954) -- 0:03:32
286000 -- (-1894.668) (-1898.615) (-1903.040) [-1897.660] * (-1895.614) (-1904.180) (-1896.075) [-1897.011] -- 0:03:32
286500 -- (-1903.774) (-1900.824) (-1898.214) [-1902.605] * [-1895.815] (-1899.842) (-1898.695) (-1893.740) -- 0:03:31
287000 -- (-1899.182) (-1899.423) (-1898.550) [-1897.993] * (-1900.707) (-1898.609) (-1895.947) [-1892.954] -- 0:03:31
287500 -- (-1896.823) (-1891.032) [-1911.442] (-1902.007) * (-1898.209) [-1895.694] (-1899.675) (-1900.090) -- 0:03:30
288000 -- (-1895.773) (-1897.323) (-1899.187) [-1894.945] * [-1897.783] (-1891.264) (-1900.714) (-1894.027) -- 0:03:30
288500 -- (-1893.262) [-1896.423] (-1897.119) (-1904.066) * (-1895.578) [-1896.878] (-1900.205) (-1902.357) -- 0:03:29
289000 -- (-1905.335) [-1891.491] (-1897.062) (-1907.279) * (-1899.886) [-1900.722] (-1895.912) (-1902.955) -- 0:03:31
289500 -- (-1898.166) (-1895.709) (-1896.734) [-1894.407] * (-1897.653) (-1900.793) (-1898.417) [-1903.605] -- 0:03:31
290000 -- (-1902.318) [-1890.500] (-1897.579) (-1900.684) * (-1898.326) (-1899.168) [-1896.225] (-1898.492) -- 0:03:30
Average standard deviation of split frequencies: 0.001297
290500 -- (-1897.449) (-1893.369) (-1896.094) [-1899.113] * (-1901.147) [-1905.424] (-1893.345) (-1897.783) -- 0:03:30
291000 -- [-1895.561] (-1898.299) (-1899.601) (-1897.240) * [-1902.553] (-1904.869) (-1901.444) (-1895.643) -- 0:03:29
291500 -- [-1897.211] (-1895.734) (-1900.550) (-1907.551) * [-1895.612] (-1898.582) (-1899.221) (-1894.549) -- 0:03:29
292000 -- (-1899.842) (-1909.224) [-1897.779] (-1894.625) * (-1898.401) [-1903.301] (-1899.571) (-1896.489) -- 0:03:28
292500 -- (-1905.439) [-1898.932] (-1905.363) (-1897.761) * (-1900.365) [-1892.835] (-1900.506) (-1895.195) -- 0:03:30
293000 -- (-1899.433) (-1897.667) (-1905.383) [-1895.986] * (-1921.500) (-1894.595) [-1899.142] (-1901.506) -- 0:03:29
293500 -- (-1895.429) [-1900.184] (-1892.854) (-1899.901) * (-1910.694) [-1894.653] (-1907.055) (-1899.046) -- 0:03:29
294000 -- (-1901.637) [-1894.996] (-1894.961) (-1912.036) * (-1906.712) (-1897.455) [-1893.547] (-1893.644) -- 0:03:28
294500 -- (-1903.251) (-1902.243) (-1897.163) [-1899.038] * (-1905.899) (-1896.834) [-1896.482] (-1895.230) -- 0:03:28
295000 -- [-1899.258] (-1907.239) (-1905.954) (-1902.507) * (-1904.251) [-1900.085] (-1902.164) (-1902.612) -- 0:03:27
Average standard deviation of split frequencies: 0.001274
295500 -- (-1903.193) [-1893.746] (-1904.218) (-1902.625) * (-1896.230) (-1893.816) [-1894.462] (-1899.053) -- 0:03:27
296000 -- (-1899.652) [-1906.057] (-1903.361) (-1901.045) * [-1900.718] (-1895.891) (-1902.057) (-1902.341) -- 0:03:29
296500 -- (-1900.077) (-1907.891) [-1893.574] (-1895.486) * (-1899.289) [-1894.981] (-1902.263) (-1903.665) -- 0:03:28
297000 -- (-1900.457) [-1897.933] (-1898.223) (-1900.176) * (-1902.685) (-1898.736) (-1905.408) [-1899.095] -- 0:03:28
297500 -- (-1898.795) (-1894.127) [-1897.526] (-1900.822) * (-1902.555) [-1902.186] (-1898.192) (-1899.275) -- 0:03:27
298000 -- (-1898.248) (-1900.974) [-1902.086] (-1897.934) * (-1909.376) (-1902.844) (-1897.365) [-1894.179] -- 0:03:27
298500 -- (-1898.276) (-1904.744) (-1900.900) [-1896.335] * [-1907.017] (-1902.572) (-1905.793) (-1898.929) -- 0:03:26
299000 -- (-1898.671) (-1904.962) [-1901.891] (-1901.188) * (-1902.679) [-1897.693] (-1907.886) (-1896.476) -- 0:03:28
299500 -- [-1893.907] (-1898.539) (-1912.098) (-1900.143) * (-1912.273) (-1895.547) (-1897.649) [-1895.007] -- 0:03:28
300000 -- [-1892.070] (-1903.216) (-1902.299) (-1897.476) * (-1915.436) (-1908.742) (-1892.467) [-1897.123] -- 0:03:27
Average standard deviation of split frequencies: 0.000941
300500 -- (-1894.142) (-1904.723) (-1901.403) [-1893.032] * (-1897.988) [-1899.627] (-1893.701) (-1904.161) -- 0:03:27
301000 -- (-1891.927) (-1902.114) (-1909.770) [-1894.881] * (-1892.231) (-1914.803) [-1898.643] (-1892.197) -- 0:03:26
301500 -- (-1894.024) [-1900.164] (-1901.758) (-1892.964) * (-1900.931) (-1894.765) [-1892.361] (-1899.363) -- 0:03:26
302000 -- (-1895.622) (-1907.242) (-1890.097) [-1902.377] * (-1903.184) (-1894.271) (-1897.346) [-1891.484] -- 0:03:25
302500 -- [-1901.831] (-1894.615) (-1900.895) (-1901.984) * (-1897.752) [-1895.863] (-1896.731) (-1897.755) -- 0:03:27
303000 -- (-1901.832) (-1897.200) (-1902.220) [-1893.182] * (-1898.617) (-1899.757) [-1902.692] (-1901.696) -- 0:03:27
303500 -- (-1891.893) (-1906.178) (-1893.661) [-1891.795] * [-1890.596] (-1901.754) (-1903.138) (-1898.059) -- 0:03:26
304000 -- [-1898.548] (-1908.727) (-1904.216) (-1913.704) * (-1910.800) [-1896.802] (-1893.510) (-1903.903) -- 0:03:26
304500 -- [-1900.487] (-1896.386) (-1904.047) (-1905.455) * (-1901.486) [-1900.523] (-1908.212) (-1900.540) -- 0:03:25
305000 -- [-1900.768] (-1908.126) (-1895.818) (-1913.272) * (-1896.938) (-1900.439) (-1903.939) [-1897.236] -- 0:03:25
Average standard deviation of split frequencies: 0.000924
305500 -- (-1900.048) (-1896.358) (-1902.576) [-1905.995] * [-1893.521] (-1903.217) (-1909.697) (-1900.463) -- 0:03:24
306000 -- (-1889.201) (-1901.014) [-1892.933] (-1899.666) * [-1894.027] (-1903.792) (-1899.783) (-1900.717) -- 0:03:26
306500 -- (-1899.231) [-1901.136] (-1898.926) (-1898.568) * (-1899.363) (-1905.033) [-1902.448] (-1900.798) -- 0:03:25
307000 -- [-1897.732] (-1899.950) (-1900.849) (-1900.346) * [-1899.155] (-1901.372) (-1898.775) (-1893.157) -- 0:03:25
307500 -- (-1891.836) [-1896.587] (-1899.096) (-1901.216) * (-1900.434) [-1894.141] (-1910.040) (-1897.875) -- 0:03:24
308000 -- [-1896.738] (-1892.262) (-1895.602) (-1899.938) * (-1892.638) [-1895.462] (-1901.937) (-1899.557) -- 0:03:24
308500 -- [-1895.255] (-1904.858) (-1903.285) (-1896.820) * (-1899.157) [-1896.209] (-1912.269) (-1903.451) -- 0:03:23
309000 -- [-1892.348] (-1904.528) (-1901.329) (-1894.771) * [-1898.210] (-1897.214) (-1906.050) (-1908.542) -- 0:03:23
309500 -- (-1891.610) [-1901.660] (-1894.420) (-1897.282) * (-1900.131) [-1895.712] (-1908.227) (-1902.721) -- 0:03:25
310000 -- (-1901.158) (-1892.265) (-1899.067) [-1896.582] * (-1903.823) [-1898.802] (-1905.683) (-1902.886) -- 0:03:24
Average standard deviation of split frequencies: 0.001517
310500 -- (-1898.226) [-1899.448] (-1904.778) (-1902.312) * [-1893.012] (-1897.361) (-1902.536) (-1893.707) -- 0:03:24
311000 -- (-1893.570) (-1898.645) [-1900.062] (-1910.547) * (-1895.250) (-1899.416) (-1901.447) [-1894.572] -- 0:03:23
311500 -- (-1895.079) (-1893.498) (-1898.104) [-1898.802] * [-1897.088] (-1904.557) (-1895.739) (-1899.629) -- 0:03:23
312000 -- (-1895.009) [-1894.783] (-1895.737) (-1900.405) * (-1901.025) (-1902.235) (-1900.502) [-1896.603] -- 0:03:22
312500 -- [-1893.699] (-1897.638) (-1891.970) (-1898.490) * (-1905.372) [-1898.405] (-1896.960) (-1909.906) -- 0:03:22
313000 -- [-1893.213] (-1894.209) (-1901.389) (-1909.821) * (-1901.975) [-1898.490] (-1896.983) (-1903.442) -- 0:03:24
313500 -- [-1892.176] (-1893.879) (-1900.163) (-1906.323) * [-1899.324] (-1900.633) (-1905.492) (-1891.609) -- 0:03:23
314000 -- [-1896.488] (-1899.843) (-1900.143) (-1899.420) * (-1899.716) (-1898.008) (-1899.728) [-1896.566] -- 0:03:23
314500 -- (-1897.709) (-1898.933) (-1899.633) [-1896.299] * (-1896.888) [-1890.754] (-1895.846) (-1891.323) -- 0:03:22
315000 -- (-1900.042) (-1908.664) [-1898.608] (-1905.783) * [-1899.321] (-1903.762) (-1899.702) (-1893.522) -- 0:03:22
Average standard deviation of split frequencies: 0.002089
315500 -- (-1903.347) (-1904.081) (-1895.937) [-1905.046] * (-1899.527) (-1899.369) (-1906.207) [-1890.438] -- 0:03:21
316000 -- [-1899.740] (-1889.077) (-1901.604) (-1901.099) * (-1892.760) (-1902.209) [-1899.168] (-1900.117) -- 0:03:21
316500 -- (-1898.704) [-1897.361] (-1900.679) (-1904.384) * (-1899.938) [-1895.904] (-1897.521) (-1895.603) -- 0:03:22
317000 -- (-1890.792) [-1897.757] (-1904.578) (-1900.029) * (-1894.747) [-1896.828] (-1903.678) (-1901.954) -- 0:03:22
317500 -- (-1900.165) (-1890.207) (-1893.227) [-1891.311] * (-1898.915) [-1892.559] (-1900.282) (-1896.661) -- 0:03:22
318000 -- (-1894.437) (-1905.657) [-1896.160] (-1895.490) * [-1901.509] (-1896.534) (-1898.683) (-1895.655) -- 0:03:21
318500 -- (-1910.426) (-1899.184) (-1905.253) [-1888.325] * (-1897.990) (-1896.360) [-1898.158] (-1897.418) -- 0:03:21
319000 -- (-1897.993) (-1898.992) (-1899.013) [-1898.040] * (-1900.045) (-1897.493) [-1893.747] (-1903.951) -- 0:03:20
319500 -- (-1901.281) (-1895.171) [-1896.702] (-1902.060) * (-1901.151) (-1901.375) [-1894.622] (-1905.683) -- 0:03:20
320000 -- [-1897.363] (-1896.189) (-1904.442) (-1900.016) * (-1900.807) (-1891.068) [-1889.936] (-1907.233) -- 0:03:21
Average standard deviation of split frequencies: 0.001764
320500 -- (-1905.775) [-1901.450] (-1897.624) (-1900.743) * (-1900.945) [-1901.206] (-1893.510) (-1895.586) -- 0:03:21
321000 -- (-1902.536) (-1902.117) (-1902.056) [-1900.636] * (-1888.746) (-1912.210) (-1895.663) [-1895.410] -- 0:03:20
321500 -- (-1898.059) (-1896.865) [-1894.511] (-1897.442) * (-1890.154) [-1895.465] (-1899.796) (-1896.236) -- 0:03:20
322000 -- [-1898.492] (-1898.030) (-1898.106) (-1896.391) * [-1899.977] (-1914.319) (-1900.916) (-1901.146) -- 0:03:20
322500 -- (-1897.838) [-1896.524] (-1902.218) (-1893.710) * (-1902.554) (-1903.625) (-1905.425) [-1898.152] -- 0:03:19
323000 -- (-1901.397) (-1902.684) [-1897.273] (-1904.452) * (-1898.620) [-1896.096] (-1902.536) (-1908.179) -- 0:03:21
323500 -- [-1893.336] (-1903.281) (-1894.110) (-1902.031) * (-1897.468) [-1895.278] (-1896.268) (-1895.184) -- 0:03:20
324000 -- (-1895.422) (-1899.615) [-1891.070] (-1908.250) * [-1901.645] (-1902.723) (-1895.394) (-1907.241) -- 0:03:20
324500 -- (-1898.449) (-1904.780) [-1897.798] (-1899.415) * (-1903.416) (-1895.929) (-1894.803) [-1899.320] -- 0:03:19
325000 -- [-1900.255] (-1896.758) (-1896.957) (-1899.683) * (-1899.801) [-1905.190] (-1906.072) (-1898.782) -- 0:03:19
Average standard deviation of split frequencies: 0.001446
325500 -- (-1902.511) (-1910.196) (-1893.604) [-1898.080] * [-1896.786] (-1901.382) (-1899.074) (-1902.287) -- 0:03:18
326000 -- (-1894.084) (-1901.138) (-1901.587) [-1898.554] * (-1903.032) (-1897.351) [-1891.381] (-1904.862) -- 0:03:18
326500 -- (-1896.763) [-1894.727] (-1895.710) (-1900.946) * (-1903.652) (-1893.043) [-1895.902] (-1907.258) -- 0:03:20
327000 -- (-1900.145) (-1892.876) (-1896.384) [-1895.752] * (-1896.219) (-1891.790) [-1896.933] (-1906.137) -- 0:03:19
327500 -- (-1898.309) [-1894.869] (-1899.550) (-1892.707) * (-1893.474) [-1891.320] (-1896.641) (-1895.106) -- 0:03:19
328000 -- (-1896.184) (-1907.015) [-1901.140] (-1895.869) * (-1899.081) (-1890.845) [-1901.372] (-1898.489) -- 0:03:18
328500 -- [-1895.538] (-1898.631) (-1896.592) (-1896.602) * [-1899.982] (-1896.522) (-1898.121) (-1894.024) -- 0:03:18
329000 -- (-1903.994) (-1899.526) [-1895.510] (-1891.038) * [-1894.445] (-1897.706) (-1897.892) (-1904.576) -- 0:03:17
329500 -- [-1900.358] (-1906.918) (-1896.260) (-1907.568) * (-1899.649) (-1897.321) (-1897.666) [-1897.993] -- 0:03:17
330000 -- [-1899.315] (-1896.433) (-1901.304) (-1894.809) * [-1894.566] (-1894.374) (-1898.860) (-1896.250) -- 0:03:18
Average standard deviation of split frequencies: 0.001140
330500 -- [-1917.489] (-1894.312) (-1901.908) (-1894.098) * (-1896.201) (-1895.957) [-1899.039] (-1897.309) -- 0:03:18
331000 -- (-1902.538) (-1891.587) (-1897.484) [-1892.551] * [-1896.123] (-1896.199) (-1901.941) (-1900.375) -- 0:03:18
331500 -- (-1902.708) (-1894.072) [-1892.122] (-1900.573) * (-1898.086) [-1900.228] (-1901.104) (-1896.757) -- 0:03:17
332000 -- [-1898.699] (-1895.511) (-1905.846) (-1896.130) * [-1890.745] (-1905.882) (-1893.365) (-1900.751) -- 0:03:17
332500 -- (-1910.579) (-1903.436) [-1909.329] (-1896.441) * (-1898.918) (-1898.787) [-1897.337] (-1908.493) -- 0:03:16
333000 -- (-1890.983) (-1900.233) [-1902.310] (-1892.826) * (-1915.013) [-1895.484] (-1892.721) (-1896.377) -- 0:03:16
333500 -- (-1896.474) (-1903.436) (-1893.146) [-1889.548] * (-1902.222) (-1914.742) (-1903.483) [-1897.469] -- 0:03:17
334000 -- [-1896.685] (-1897.979) (-1899.997) (-1894.498) * [-1895.828] (-1896.996) (-1897.216) (-1907.812) -- 0:03:17
334500 -- (-1893.614) (-1896.842) [-1890.904] (-1900.222) * (-1904.946) (-1899.899) [-1900.961] (-1899.757) -- 0:03:16
335000 -- (-1896.764) (-1902.692) (-1895.191) [-1898.260] * (-1895.770) [-1903.635] (-1905.157) (-1902.988) -- 0:03:16
Average standard deviation of split frequencies: 0.000281
335500 -- (-1896.179) (-1894.479) (-1896.980) [-1894.807] * (-1903.993) [-1892.692] (-1903.193) (-1894.741) -- 0:03:16
336000 -- (-1894.376) (-1897.256) (-1903.505) [-1900.609] * (-1900.929) (-1897.548) (-1901.855) [-1899.411] -- 0:03:15
336500 -- (-1902.799) [-1893.925] (-1908.171) (-1893.267) * [-1898.059] (-1894.502) (-1897.920) (-1900.926) -- 0:03:15
337000 -- [-1899.431] (-1901.370) (-1898.161) (-1896.864) * (-1903.049) [-1899.971] (-1903.587) (-1912.279) -- 0:03:16
337500 -- (-1909.849) (-1902.672) (-1893.784) [-1895.817] * (-1907.864) [-1894.767] (-1900.452) (-1900.500) -- 0:03:16
338000 -- (-1899.900) (-1895.669) [-1894.485] (-1898.517) * (-1896.737) (-1896.194) (-1894.383) [-1895.962] -- 0:03:15
338500 -- (-1891.787) (-1900.601) (-1899.227) [-1898.421] * (-1902.500) [-1894.352] (-1901.809) (-1895.475) -- 0:03:15
339000 -- (-1906.135) (-1897.199) (-1905.293) [-1900.808] * (-1905.246) (-1895.701) (-1901.075) [-1894.401] -- 0:03:14
339500 -- (-1898.797) (-1894.474) [-1903.374] (-1895.535) * (-1898.719) (-1911.452) (-1897.043) [-1892.719] -- 0:03:14
340000 -- (-1898.911) (-1899.637) [-1900.145] (-1897.875) * (-1898.721) [-1897.646] (-1895.672) (-1904.084) -- 0:03:16
Average standard deviation of split frequencies: 0.000830
340500 -- (-1909.785) [-1897.717] (-1899.251) (-1902.177) * [-1895.296] (-1895.100) (-1902.483) (-1902.997) -- 0:03:15
341000 -- (-1903.133) (-1896.381) (-1907.866) [-1894.400] * (-1894.664) [-1904.923] (-1892.923) (-1903.073) -- 0:03:15
341500 -- (-1902.631) (-1910.505) (-1895.531) [-1895.467] * (-1909.251) (-1904.475) [-1899.458] (-1896.360) -- 0:03:14
342000 -- (-1903.854) (-1911.339) (-1903.432) [-1889.833] * (-1901.369) (-1900.307) [-1898.952] (-1901.117) -- 0:03:14
342500 -- (-1899.109) (-1903.192) [-1898.494] (-1895.468) * [-1907.681] (-1901.270) (-1902.885) (-1896.743) -- 0:03:13
343000 -- (-1896.204) (-1905.354) [-1892.947] (-1901.409) * (-1894.014) (-1902.071) (-1901.994) [-1900.389] -- 0:03:13
343500 -- (-1896.337) [-1894.944] (-1896.366) (-1900.803) * (-1909.304) (-1902.195) (-1899.229) [-1897.938] -- 0:03:14
344000 -- (-1897.725) [-1897.203] (-1899.850) (-1906.436) * [-1893.204] (-1893.807) (-1901.829) (-1896.895) -- 0:03:14
344500 -- (-1901.287) (-1894.217) (-1895.521) [-1896.249] * [-1896.880] (-1896.788) (-1901.568) (-1894.331) -- 0:03:14
345000 -- (-1897.215) (-1898.648) [-1893.496] (-1908.685) * [-1896.529] (-1890.367) (-1894.559) (-1901.763) -- 0:03:13
Average standard deviation of split frequencies: 0.000545
345500 -- (-1892.662) [-1894.779] (-1897.317) (-1908.446) * (-1900.373) (-1896.642) (-1899.650) [-1894.804] -- 0:03:13
346000 -- (-1896.567) (-1897.587) [-1901.599] (-1910.683) * [-1898.203] (-1906.240) (-1894.861) (-1901.050) -- 0:03:12
346500 -- (-1897.391) [-1899.226] (-1893.346) (-1902.328) * (-1903.190) (-1903.190) [-1892.219] (-1904.015) -- 0:03:12
347000 -- (-1896.767) [-1891.764] (-1895.001) (-1898.594) * (-1897.936) (-1895.932) [-1900.481] (-1900.651) -- 0:03:13
347500 -- (-1903.922) (-1902.703) (-1896.535) [-1893.820] * (-1903.421) [-1893.643] (-1904.188) (-1900.919) -- 0:03:13
348000 -- (-1897.420) (-1903.659) [-1893.668] (-1895.693) * [-1901.932] (-1894.805) (-1902.997) (-1896.149) -- 0:03:12
348500 -- (-1899.503) [-1896.260] (-1900.003) (-1897.580) * (-1901.257) (-1898.244) (-1896.799) [-1901.810] -- 0:03:12
349000 -- (-1907.095) (-1899.020) (-1897.455) [-1897.826] * (-1899.809) (-1896.506) [-1891.232] (-1895.276) -- 0:03:12
349500 -- (-1894.675) (-1906.816) (-1909.624) [-1893.601] * (-1893.641) (-1896.661) [-1894.398] (-1897.074) -- 0:03:11
350000 -- (-1896.262) (-1894.330) [-1892.336] (-1902.853) * [-1898.830] (-1908.116) (-1894.489) (-1891.409) -- 0:03:11
Average standard deviation of split frequencies: 0.001344
350500 -- [-1895.996] (-1895.626) (-1900.038) (-1893.036) * [-1892.858] (-1900.608) (-1899.243) (-1902.285) -- 0:03:12
351000 -- (-1903.326) [-1895.149] (-1895.046) (-1899.957) * (-1906.614) (-1895.996) (-1900.412) [-1905.316] -- 0:03:12
351500 -- (-1901.428) [-1895.771] (-1896.257) (-1896.944) * (-1898.519) [-1901.755] (-1899.762) (-1905.762) -- 0:03:11
352000 -- (-1898.453) (-1898.141) (-1905.442) [-1897.662] * (-1902.698) (-1893.810) (-1905.932) [-1904.325] -- 0:03:11
352500 -- (-1891.927) (-1889.488) [-1895.715] (-1908.096) * (-1896.337) (-1891.490) (-1904.719) [-1895.629] -- 0:03:11
353000 -- [-1895.102] (-1897.358) (-1895.390) (-1905.831) * [-1904.568] (-1898.352) (-1904.210) (-1900.479) -- 0:03:10
353500 -- [-1894.788] (-1903.082) (-1896.270) (-1899.909) * (-1898.776) [-1906.047] (-1912.041) (-1897.615) -- 0:03:12
354000 -- (-1894.724) (-1889.832) (-1900.066) [-1896.731] * (-1898.502) (-1901.685) (-1897.134) [-1897.365] -- 0:03:11
354500 -- (-1894.546) (-1901.315) (-1907.519) [-1907.129] * (-1897.647) (-1900.196) [-1904.119] (-1906.937) -- 0:03:11
355000 -- (-1898.027) (-1903.728) [-1900.477] (-1898.185) * (-1895.007) (-1904.960) (-1907.332) [-1895.318] -- 0:03:10
Average standard deviation of split frequencies: 0.001589
355500 -- (-1894.528) (-1893.480) (-1892.771) [-1898.537] * (-1896.725) (-1900.849) [-1894.412] (-1904.242) -- 0:03:10
356000 -- [-1895.598] (-1898.213) (-1906.035) (-1900.494) * (-1895.420) (-1901.923) [-1900.744] (-1911.247) -- 0:03:09
356500 -- (-1897.046) (-1896.084) (-1901.137) [-1893.806] * (-1892.446) (-1902.332) [-1904.425] (-1905.704) -- 0:03:11
357000 -- (-1897.349) (-1898.253) [-1893.737] (-1902.708) * (-1896.035) (-1899.706) (-1905.767) [-1893.599] -- 0:03:10
357500 -- (-1899.501) (-1908.240) (-1898.429) [-1896.887] * (-1903.079) [-1896.685] (-1912.041) (-1905.085) -- 0:03:10
358000 -- (-1899.565) (-1898.162) [-1890.720] (-1900.986) * [-1902.270] (-1902.254) (-1905.191) (-1894.564) -- 0:03:10
358500 -- (-1892.524) (-1902.208) [-1894.345] (-1896.852) * (-1903.668) (-1900.005) (-1902.082) [-1898.014] -- 0:03:09
359000 -- [-1894.362] (-1891.515) (-1903.605) (-1898.808) * (-1905.942) (-1902.406) [-1902.562] (-1902.557) -- 0:03:09
359500 -- (-1898.363) (-1895.659) [-1901.856] (-1900.464) * (-1893.320) [-1900.047] (-1907.813) (-1893.648) -- 0:03:08
360000 -- (-1896.744) [-1897.456] (-1901.940) (-1898.014) * (-1905.100) [-1893.844] (-1899.722) (-1898.078) -- 0:03:10
Average standard deviation of split frequencies: 0.001830
360500 -- (-1894.311) [-1893.708] (-1902.979) (-1899.311) * (-1895.087) [-1898.330] (-1898.290) (-1898.409) -- 0:03:09
361000 -- (-1894.623) (-1909.093) [-1905.066] (-1908.808) * [-1894.969] (-1906.228) (-1896.995) (-1897.677) -- 0:03:09
361500 -- (-1894.649) [-1897.597] (-1899.681) (-1905.443) * (-1902.008) [-1904.522] (-1900.216) (-1901.421) -- 0:03:08
362000 -- (-1901.038) (-1898.312) [-1903.713] (-1906.364) * (-1902.303) (-1901.351) [-1898.079] (-1897.217) -- 0:03:08
362500 -- (-1898.998) (-1893.117) [-1898.642] (-1902.805) * (-1904.368) (-1898.646) [-1897.846] (-1913.878) -- 0:03:09
363000 -- (-1898.320) (-1902.868) [-1901.336] (-1902.559) * [-1895.427] (-1900.936) (-1895.038) (-1895.198) -- 0:03:09
363500 -- (-1898.946) (-1898.412) (-1896.388) [-1893.618] * (-1900.339) [-1893.630] (-1899.320) (-1889.767) -- 0:03:09
364000 -- (-1901.605) (-1898.768) (-1897.028) [-1898.739] * (-1897.829) (-1901.795) (-1894.728) [-1902.337] -- 0:03:08
364500 -- (-1898.788) (-1900.682) [-1892.910] (-1908.075) * (-1903.466) (-1898.226) (-1900.419) [-1894.270] -- 0:03:08
365000 -- (-1898.906) [-1897.203] (-1901.890) (-1898.220) * (-1900.869) [-1893.815] (-1897.860) (-1906.503) -- 0:03:07
Average standard deviation of split frequencies: 0.001030
365500 -- [-1894.212] (-1898.684) (-1892.540) (-1895.930) * (-1904.806) [-1891.174] (-1895.657) (-1898.584) -- 0:03:07
366000 -- (-1900.973) (-1898.554) (-1895.279) [-1896.543] * (-1904.680) (-1897.611) [-1894.842] (-1903.307) -- 0:03:08
366500 -- (-1893.256) (-1900.539) [-1896.716] (-1897.326) * (-1898.852) (-1891.322) [-1892.620] (-1899.122) -- 0:03:08
367000 -- (-1896.171) (-1901.486) [-1895.875] (-1901.081) * (-1901.226) (-1903.182) (-1892.415) [-1896.588] -- 0:03:08
367500 -- (-1898.927) [-1892.241] (-1901.549) (-1903.284) * (-1902.329) (-1903.389) [-1890.608] (-1898.372) -- 0:03:07
368000 -- (-1896.804) [-1892.400] (-1899.747) (-1901.593) * (-1898.363) (-1900.640) (-1901.615) [-1889.930] -- 0:03:07
368500 -- (-1891.665) (-1892.979) [-1903.499] (-1902.186) * (-1895.058) (-1897.748) (-1896.098) [-1897.324] -- 0:03:06
369000 -- (-1902.934) [-1900.053] (-1906.500) (-1893.163) * (-1903.697) (-1905.743) [-1896.444] (-1895.363) -- 0:03:06
369500 -- (-1898.828) (-1900.575) (-1896.639) [-1896.127] * (-1895.136) (-1898.790) [-1903.672] (-1898.113) -- 0:03:07
370000 -- (-1905.214) (-1904.171) (-1909.806) [-1898.007] * (-1895.531) (-1899.305) (-1900.889) [-1896.601] -- 0:03:07
Average standard deviation of split frequencies: 0.001526
370500 -- (-1898.814) [-1891.917] (-1898.544) (-1901.594) * [-1911.161] (-1903.118) (-1908.542) (-1895.878) -- 0:03:06
371000 -- (-1896.651) (-1900.455) [-1901.464] (-1904.336) * (-1898.426) (-1897.787) (-1904.673) [-1895.770] -- 0:03:06
371500 -- [-1896.275] (-1892.937) (-1895.695) (-1897.465) * (-1895.207) (-1892.774) (-1905.767) [-1892.614] -- 0:03:06
372000 -- (-1904.099) (-1906.379) (-1903.273) [-1898.200] * (-1892.145) (-1895.813) [-1900.186] (-1909.790) -- 0:03:05
372500 -- (-1896.750) (-1894.822) (-1901.904) [-1894.059] * (-1894.396) [-1897.343] (-1899.163) (-1905.751) -- 0:03:06
373000 -- (-1902.696) [-1904.031] (-1893.729) (-1902.209) * [-1890.412] (-1892.273) (-1907.587) (-1892.175) -- 0:03:06
373500 -- (-1904.894) (-1896.966) [-1892.431] (-1896.817) * (-1898.548) (-1902.408) (-1904.177) [-1896.730] -- 0:03:06
374000 -- [-1889.634] (-1893.374) (-1904.143) (-1901.183) * (-1901.658) [-1894.036] (-1913.404) (-1897.755) -- 0:03:05
374500 -- (-1910.875) (-1909.184) [-1896.782] (-1894.805) * (-1908.081) [-1899.558] (-1896.695) (-1898.874) -- 0:03:05
375000 -- (-1900.127) (-1901.885) [-1902.343] (-1896.051) * (-1896.664) (-1895.498) [-1902.815] (-1895.425) -- 0:03:05
Average standard deviation of split frequencies: 0.001504
375500 -- [-1895.283] (-1903.016) (-1901.785) (-1895.418) * (-1903.957) (-1899.544) (-1906.371) [-1895.943] -- 0:03:04
376000 -- (-1893.236) (-1902.046) [-1901.272] (-1896.826) * (-1906.245) (-1902.424) [-1899.585] (-1894.448) -- 0:03:05
376500 -- [-1896.787] (-1905.026) (-1900.848) (-1899.800) * [-1897.146] (-1901.779) (-1901.823) (-1897.913) -- 0:03:05
377000 -- (-1893.885) (-1893.901) [-1893.420] (-1893.613) * (-1901.536) (-1901.337) (-1902.529) [-1898.633] -- 0:03:05
377500 -- (-1901.423) (-1897.845) (-1894.863) [-1894.546] * [-1898.268] (-1899.113) (-1899.487) (-1900.171) -- 0:03:04
378000 -- (-1903.003) [-1901.241] (-1899.141) (-1895.549) * (-1898.805) (-1903.245) (-1904.069) [-1892.038] -- 0:03:04
378500 -- (-1892.415) (-1899.627) (-1899.173) [-1895.592] * [-1896.261] (-1899.418) (-1900.977) (-1900.096) -- 0:03:03
379000 -- (-1906.846) (-1897.084) [-1898.589] (-1898.889) * (-1896.869) [-1902.062] (-1907.440) (-1897.861) -- 0:03:03
379500 -- [-1901.049] (-1896.620) (-1901.433) (-1904.062) * (-1902.237) [-1901.108] (-1900.449) (-1896.234) -- 0:03:04
380000 -- (-1899.964) (-1899.219) (-1899.624) [-1892.159] * (-1902.204) (-1902.367) [-1901.479] (-1890.853) -- 0:03:04
Average standard deviation of split frequencies: 0.001238
380500 -- [-1891.715] (-1896.632) (-1904.511) (-1896.375) * (-1897.871) [-1889.985] (-1899.474) (-1901.185) -- 0:03:03
381000 -- (-1891.630) (-1894.192) (-1901.989) [-1893.970] * [-1895.942] (-1897.426) (-1897.647) (-1894.686) -- 0:03:03
381500 -- (-1893.885) (-1895.265) [-1898.941] (-1899.239) * (-1901.365) (-1901.684) (-1896.524) [-1895.761] -- 0:03:03
382000 -- (-1900.344) [-1903.360] (-1895.076) (-1899.501) * (-1905.230) (-1894.542) (-1900.305) [-1900.844] -- 0:03:02
382500 -- (-1892.453) (-1898.571) (-1899.061) [-1897.441] * (-1906.969) (-1892.460) [-1893.473] (-1909.966) -- 0:03:02
383000 -- (-1894.123) [-1895.688] (-1892.777) (-1902.209) * (-1896.029) [-1892.588] (-1905.501) (-1906.610) -- 0:03:03
383500 -- (-1895.371) (-1894.527) [-1896.838] (-1898.855) * (-1893.555) (-1902.900) [-1895.756] (-1894.831) -- 0:03:03
384000 -- (-1906.213) (-1900.899) (-1904.495) [-1892.292] * (-1902.514) [-1897.874] (-1902.443) (-1908.986) -- 0:03:02
384500 -- (-1894.364) (-1894.651) [-1892.465] (-1905.183) * (-1904.874) (-1900.011) [-1899.605] (-1897.571) -- 0:03:02
385000 -- (-1897.340) (-1904.856) [-1901.076] (-1904.904) * [-1895.495] (-1892.243) (-1899.662) (-1898.138) -- 0:03:02
Average standard deviation of split frequencies: 0.001466
385500 -- (-1899.712) (-1902.891) [-1904.013] (-1914.224) * (-1903.873) [-1897.365] (-1909.778) (-1895.131) -- 0:03:01
386000 -- [-1895.641] (-1898.367) (-1894.600) (-1895.683) * (-1897.598) (-1900.461) (-1896.707) [-1899.929] -- 0:03:01
386500 -- [-1890.025] (-1900.440) (-1900.575) (-1896.268) * (-1911.405) (-1898.279) (-1900.681) [-1896.611] -- 0:03:02
387000 -- (-1899.598) (-1898.993) (-1899.650) [-1896.731] * (-1905.118) (-1898.086) (-1897.332) [-1899.654] -- 0:03:02
387500 -- [-1897.641] (-1897.168) (-1896.405) (-1899.067) * (-1894.745) [-1898.978] (-1899.348) (-1894.182) -- 0:03:01
388000 -- (-1897.385) [-1895.663] (-1894.773) (-1901.487) * (-1897.117) [-1892.336] (-1899.199) (-1896.010) -- 0:03:01
388500 -- (-1898.358) (-1898.639) [-1894.391] (-1896.466) * (-1898.523) (-1896.338) (-1894.439) [-1894.044] -- 0:03:01
389000 -- (-1899.830) (-1895.947) (-1889.530) [-1901.423] * (-1897.768) (-1897.891) (-1896.036) [-1904.141] -- 0:03:00
389500 -- [-1899.920] (-1895.580) (-1894.028) (-1894.817) * (-1900.892) (-1905.518) [-1895.447] (-1895.412) -- 0:03:01
390000 -- (-1896.334) [-1896.855] (-1900.995) (-1893.046) * (-1898.044) [-1897.986] (-1902.452) (-1892.229) -- 0:03:01
Average standard deviation of split frequencies: 0.002413
390500 -- (-1909.354) (-1900.530) (-1913.923) [-1894.541] * (-1900.835) [-1892.046] (-1893.314) (-1897.904) -- 0:03:01
391000 -- (-1902.513) [-1897.645] (-1916.446) (-1900.319) * (-1903.589) [-1896.598] (-1894.542) (-1899.556) -- 0:03:00
391500 -- [-1893.898] (-1898.209) (-1901.915) (-1901.672) * (-1896.006) (-1908.249) (-1895.750) [-1892.817] -- 0:03:00
392000 -- [-1892.199] (-1907.179) (-1905.424) (-1897.154) * (-1905.974) (-1893.999) [-1898.012] (-1904.741) -- 0:02:59
392500 -- [-1892.759] (-1902.562) (-1906.214) (-1903.179) * (-1903.375) (-1895.170) [-1903.255] (-1902.870) -- 0:02:59
393000 -- (-1901.055) [-1907.428] (-1899.413) (-1904.745) * (-1898.624) [-1891.168] (-1894.742) (-1898.039) -- 0:03:00
393500 -- (-1896.928) (-1896.492) [-1898.824] (-1901.722) * (-1907.627) (-1895.650) (-1895.950) [-1906.175] -- 0:03:00
394000 -- (-1890.746) (-1892.616) [-1895.696] (-1897.194) * (-1899.426) [-1895.680] (-1900.101) (-1894.677) -- 0:02:59
394500 -- (-1892.998) (-1899.048) (-1896.134) [-1896.895] * (-1901.081) [-1899.610] (-1900.449) (-1899.573) -- 0:02:59
395000 -- (-1904.708) (-1890.447) (-1901.221) [-1896.673] * [-1897.896] (-1900.551) (-1896.183) (-1896.434) -- 0:02:59
Average standard deviation of split frequencies: 0.002619
395500 -- (-1901.154) (-1893.882) [-1897.008] (-1905.896) * (-1891.776) [-1896.148] (-1905.464) (-1905.176) -- 0:02:58
396000 -- (-1901.761) [-1895.832] (-1892.337) (-1907.873) * (-1894.888) [-1896.847] (-1897.503) (-1898.131) -- 0:02:58
396500 -- [-1891.059] (-1898.749) (-1899.864) (-1910.841) * (-1899.381) (-1896.957) [-1901.283] (-1911.721) -- 0:02:59
397000 -- (-1896.224) [-1894.264] (-1901.324) (-1906.352) * [-1894.089] (-1895.614) (-1893.753) (-1896.488) -- 0:02:59
397500 -- [-1900.772] (-1901.894) (-1891.222) (-1905.573) * (-1896.721) (-1896.767) [-1896.503] (-1904.837) -- 0:02:58
398000 -- (-1896.471) [-1897.544] (-1907.440) (-1905.739) * (-1900.207) [-1895.731] (-1892.143) (-1904.492) -- 0:02:58
398500 -- (-1894.775) [-1890.127] (-1898.725) (-1895.180) * (-1902.064) [-1893.398] (-1890.908) (-1896.973) -- 0:02:58
399000 -- (-1897.203) (-1894.852) (-1893.239) [-1898.126] * (-1894.174) [-1900.842] (-1894.879) (-1900.878) -- 0:02:57
399500 -- (-1895.682) (-1897.067) (-1899.541) [-1895.159] * (-1889.008) (-1897.406) (-1899.762) [-1897.337] -- 0:02:57
400000 -- (-1907.428) (-1894.376) (-1900.117) [-1901.006] * (-1903.046) (-1899.218) (-1899.831) [-1901.562] -- 0:02:58
Average standard deviation of split frequencies: 0.002588
400500 -- (-1910.882) (-1896.006) [-1895.216] (-1909.636) * (-1898.289) (-1893.281) [-1896.309] (-1901.627) -- 0:02:58
401000 -- [-1896.244] (-1895.329) (-1894.758) (-1895.641) * (-1892.086) (-1897.213) [-1894.186] (-1906.093) -- 0:02:57
401500 -- (-1897.086) (-1894.807) [-1897.939] (-1900.013) * [-1899.623] (-1895.971) (-1900.797) (-1907.081) -- 0:02:57
402000 -- (-1898.246) (-1903.214) (-1894.367) [-1888.729] * (-1900.692) [-1898.455] (-1897.390) (-1913.583) -- 0:02:57
402500 -- (-1902.147) (-1904.557) [-1895.328] (-1908.238) * (-1894.721) [-1899.377] (-1894.080) (-1908.069) -- 0:02:56
403000 -- (-1899.080) (-1898.299) [-1895.676] (-1907.499) * (-1894.157) [-1895.695] (-1894.784) (-1904.121) -- 0:02:57
403500 -- (-1903.340) (-1895.591) (-1892.780) [-1892.514] * (-1899.538) (-1894.260) [-1895.460] (-1904.001) -- 0:02:57
404000 -- (-1906.457) (-1897.583) [-1899.006] (-1896.027) * (-1900.290) (-1901.204) [-1895.979] (-1902.768) -- 0:02:57
404500 -- (-1919.760) (-1901.574) [-1901.469] (-1898.445) * (-1898.674) (-1900.048) [-1895.182] (-1909.115) -- 0:02:56
405000 -- (-1892.208) (-1898.158) [-1897.738] (-1901.013) * [-1900.370] (-1900.532) (-1909.614) (-1895.547) -- 0:02:56
Average standard deviation of split frequencies: 0.002322
405500 -- (-1891.952) [-1893.977] (-1907.816) (-1908.667) * (-1898.890) (-1901.973) [-1903.205] (-1901.800) -- 0:02:55
406000 -- (-1900.283) [-1898.231] (-1899.466) (-1892.125) * (-1899.204) (-1896.055) (-1904.742) [-1895.427] -- 0:02:55
406500 -- [-1901.189] (-1914.223) (-1897.300) (-1900.243) * [-1900.236] (-1900.918) (-1894.363) (-1894.925) -- 0:02:56
407000 -- (-1898.813) [-1902.834] (-1906.502) (-1889.292) * (-1894.925) (-1899.098) [-1904.122] (-1897.230) -- 0:02:56
407500 -- [-1893.497] (-1903.408) (-1911.896) (-1891.365) * (-1899.720) (-1898.660) (-1893.871) [-1894.980] -- 0:02:55
408000 -- [-1895.579] (-1901.107) (-1904.022) (-1901.879) * (-1905.023) (-1900.779) [-1895.304] (-1896.307) -- 0:02:55
408500 -- (-1904.121) (-1891.969) [-1894.384] (-1902.418) * (-1902.274) (-1900.734) (-1895.979) [-1896.525] -- 0:02:55
409000 -- (-1905.143) [-1900.740] (-1897.793) (-1903.016) * (-1897.081) [-1900.337] (-1903.074) (-1901.374) -- 0:02:54
409500 -- (-1897.675) (-1897.158) [-1898.805] (-1895.171) * (-1900.578) [-1894.014] (-1901.867) (-1898.231) -- 0:02:54
410000 -- [-1900.999] (-1899.703) (-1906.559) (-1901.804) * (-1903.920) (-1907.892) [-1893.341] (-1901.782) -- 0:02:55
Average standard deviation of split frequencies: 0.001837
410500 -- [-1896.360] (-1896.556) (-1897.550) (-1896.293) * (-1907.213) [-1895.371] (-1902.188) (-1897.391) -- 0:02:55
411000 -- [-1893.573] (-1895.366) (-1895.103) (-1901.455) * [-1898.028] (-1896.110) (-1905.337) (-1906.070) -- 0:02:54
411500 -- (-1896.278) [-1894.447] (-1907.084) (-1897.197) * (-1900.473) [-1899.052] (-1896.449) (-1901.816) -- 0:02:54
412000 -- [-1895.606] (-1906.455) (-1905.324) (-1901.128) * (-1898.136) [-1895.974] (-1898.009) (-1905.408) -- 0:02:54
412500 -- (-1897.950) [-1896.996] (-1912.855) (-1900.907) * (-1901.036) (-1906.956) [-1904.958] (-1894.013) -- 0:02:53
413000 -- [-1897.907] (-1905.640) (-1916.148) (-1898.058) * [-1900.981] (-1905.778) (-1901.484) (-1899.978) -- 0:02:53
413500 -- [-1903.410] (-1896.089) (-1904.372) (-1898.603) * (-1894.635) (-1899.688) (-1902.424) [-1903.951] -- 0:02:54
414000 -- (-1896.660) (-1900.451) (-1896.088) [-1902.720] * (-1894.996) (-1902.658) (-1897.485) [-1894.987] -- 0:02:54
414500 -- [-1894.268] (-1896.053) (-1900.642) (-1899.705) * (-1907.077) [-1889.735] (-1908.055) (-1900.081) -- 0:02:53
415000 -- (-1897.885) [-1898.684] (-1903.857) (-1898.796) * (-1897.209) (-1894.264) (-1901.792) [-1895.962] -- 0:02:53
Average standard deviation of split frequencies: 0.001360
415500 -- (-1898.199) (-1903.329) [-1896.620] (-1898.259) * (-1900.947) (-1899.331) [-1893.210] (-1896.799) -- 0:02:53
416000 -- [-1895.341] (-1902.132) (-1903.582) (-1898.535) * [-1899.871] (-1900.474) (-1895.303) (-1899.280) -- 0:02:52
416500 -- (-1894.829) (-1902.146) (-1899.978) [-1895.306] * (-1903.827) [-1901.666] (-1900.994) (-1896.141) -- 0:02:52
417000 -- (-1898.734) (-1903.166) (-1898.510) [-1892.006] * (-1912.190) (-1900.387) (-1900.516) [-1901.280] -- 0:02:53
417500 -- (-1899.373) [-1904.618] (-1892.770) (-1902.171) * (-1909.494) (-1904.809) [-1896.473] (-1902.720) -- 0:02:53
418000 -- (-1912.688) (-1896.667) [-1901.534] (-1898.726) * (-1904.477) (-1902.415) [-1895.692] (-1897.099) -- 0:02:52
418500 -- [-1902.641] (-1904.362) (-1900.100) (-1901.093) * (-1895.595) (-1899.098) (-1899.303) [-1894.338] -- 0:02:52
419000 -- [-1900.144] (-1898.653) (-1899.441) (-1914.615) * (-1897.525) (-1903.461) (-1893.468) [-1892.649] -- 0:02:51
419500 -- [-1892.798] (-1894.317) (-1898.942) (-1897.911) * (-1903.132) (-1904.855) (-1897.621) [-1895.623] -- 0:02:51
420000 -- (-1901.593) (-1899.771) (-1910.860) [-1900.621] * (-1897.752) (-1903.291) (-1896.586) [-1903.089] -- 0:02:52
Average standard deviation of split frequencies: 0.000896
420500 -- [-1895.583] (-1897.020) (-1900.783) (-1902.897) * (-1900.462) (-1907.043) (-1896.459) [-1892.688] -- 0:02:52
421000 -- (-1907.541) (-1898.539) [-1895.841] (-1896.242) * (-1897.958) (-1896.801) (-1894.217) [-1898.781] -- 0:02:51
421500 -- [-1893.571] (-1894.460) (-1924.026) (-1897.470) * (-1900.729) (-1890.745) [-1893.961] (-1904.726) -- 0:02:51
422000 -- (-1895.401) [-1893.901] (-1906.834) (-1901.105) * (-1903.156) (-1896.404) (-1892.959) [-1892.402] -- 0:02:51
422500 -- (-1897.712) (-1900.330) [-1907.660] (-1896.353) * [-1893.593] (-1906.276) (-1893.802) (-1898.691) -- 0:02:50
423000 -- (-1898.459) [-1896.703] (-1903.616) (-1893.249) * [-1897.797] (-1902.609) (-1894.909) (-1900.784) -- 0:02:50
423500 -- [-1896.317] (-1896.235) (-1900.772) (-1895.303) * (-1896.534) [-1897.765] (-1895.811) (-1901.932) -- 0:02:51
424000 -- [-1897.272] (-1902.868) (-1900.659) (-1899.911) * (-1900.883) (-1895.176) (-1898.034) [-1893.188] -- 0:02:51
424500 -- [-1898.562] (-1908.994) (-1907.626) (-1898.971) * (-1899.019) (-1895.888) [-1895.416] (-1896.621) -- 0:02:50
425000 -- [-1898.939] (-1901.794) (-1897.823) (-1901.024) * [-1894.540] (-1899.888) (-1904.507) (-1899.811) -- 0:02:50
Average standard deviation of split frequencies: 0.000885
425500 -- (-1912.751) (-1909.784) (-1894.316) [-1905.950] * (-1893.553) [-1892.613] (-1891.735) (-1891.963) -- 0:02:50
426000 -- [-1898.615] (-1899.498) (-1894.141) (-1900.131) * (-1894.564) (-1894.159) (-1898.251) [-1900.784] -- 0:02:49
426500 -- [-1902.192] (-1901.679) (-1896.638) (-1902.327) * (-1902.484) (-1901.601) (-1899.729) [-1891.978] -- 0:02:49
427000 -- (-1903.683) (-1905.141) [-1899.889] (-1900.258) * (-1898.775) (-1896.708) [-1895.373] (-1891.856) -- 0:02:50
427500 -- (-1903.498) [-1897.449] (-1901.568) (-1906.518) * [-1895.000] (-1896.668) (-1898.279) (-1901.146) -- 0:02:50
428000 -- [-1898.948] (-1905.969) (-1900.772) (-1901.264) * (-1897.400) (-1905.779) (-1906.924) [-1898.899] -- 0:02:49
428500 -- (-1902.816) (-1900.807) [-1904.219] (-1904.502) * (-1899.493) [-1903.179] (-1900.015) (-1894.468) -- 0:02:49
429000 -- (-1898.017) [-1900.913] (-1910.293) (-1906.326) * [-1897.873] (-1905.924) (-1890.236) (-1903.594) -- 0:02:49
429500 -- (-1902.874) [-1899.598] (-1898.345) (-1909.569) * [-1896.524] (-1894.761) (-1893.503) (-1898.299) -- 0:02:48
430000 -- (-1893.077) (-1899.690) (-1896.206) [-1895.064] * [-1892.060] (-1893.694) (-1900.318) (-1904.312) -- 0:02:48
Average standard deviation of split frequencies: 0.001095
430500 -- [-1894.201] (-1898.244) (-1903.923) (-1894.225) * [-1895.341] (-1905.255) (-1895.683) (-1899.318) -- 0:02:49
431000 -- (-1892.571) (-1908.586) [-1902.436] (-1906.032) * (-1903.535) (-1903.275) [-1891.547] (-1906.597) -- 0:02:48
431500 -- (-1905.589) (-1909.788) (-1898.956) [-1897.430] * (-1899.225) [-1904.994] (-1899.110) (-1900.308) -- 0:02:48
432000 -- (-1895.869) (-1904.200) (-1900.259) [-1895.994] * [-1894.773] (-1910.161) (-1899.833) (-1904.331) -- 0:02:48
432500 -- [-1892.269] (-1902.805) (-1896.282) (-1900.466) * (-1902.637) [-1892.168] (-1896.231) (-1891.365) -- 0:02:47
433000 -- (-1899.544) (-1906.156) (-1904.100) [-1901.698] * [-1894.606] (-1904.148) (-1893.617) (-1903.096) -- 0:02:47
433500 -- (-1904.870) [-1897.118] (-1909.356) (-1895.713) * (-1895.963) (-1893.015) [-1896.758] (-1894.065) -- 0:02:48
434000 -- (-1896.975) [-1897.335] (-1900.652) (-1902.088) * (-1899.547) (-1895.606) [-1901.357] (-1901.621) -- 0:02:48
434500 -- (-1897.023) (-1894.381) [-1900.122] (-1894.904) * (-1895.838) [-1896.763] (-1900.509) (-1896.032) -- 0:02:47
435000 -- (-1896.437) (-1905.779) (-1899.051) [-1898.922] * [-1894.473] (-1901.579) (-1897.661) (-1893.298) -- 0:02:47
Average standard deviation of split frequencies: 0.003244
435500 -- (-1892.728) (-1897.997) (-1900.724) [-1903.848] * (-1898.906) (-1899.105) [-1894.832] (-1896.426) -- 0:02:47
436000 -- (-1895.129) [-1890.226] (-1903.158) (-1896.525) * (-1899.154) (-1894.392) (-1895.252) [-1893.339] -- 0:02:46
436500 -- (-1894.865) [-1895.640] (-1905.903) (-1896.224) * (-1894.137) (-1898.134) [-1898.978] (-1895.771) -- 0:02:46
437000 -- [-1895.651] (-1893.204) (-1903.581) (-1902.159) * (-1896.676) (-1903.511) (-1896.318) [-1900.450] -- 0:02:47
437500 -- (-1894.738) (-1899.449) (-1901.527) [-1901.410] * (-1911.490) (-1905.136) (-1900.291) [-1901.805] -- 0:02:47
438000 -- (-1897.507) (-1902.868) [-1897.271] (-1896.562) * (-1900.688) (-1910.868) [-1897.569] (-1898.043) -- 0:02:46
438500 -- [-1896.668] (-1904.835) (-1901.140) (-1898.602) * (-1903.556) [-1895.220] (-1901.644) (-1898.069) -- 0:02:46
439000 -- (-1907.514) [-1895.683] (-1909.274) (-1898.479) * (-1899.449) (-1895.995) [-1907.932] (-1899.702) -- 0:02:46
439500 -- (-1900.516) [-1894.057] (-1900.634) (-1903.088) * (-1894.050) (-1898.996) (-1904.565) [-1895.827] -- 0:02:45
440000 -- (-1904.580) (-1896.697) (-1897.351) [-1900.853] * (-1905.502) [-1900.705] (-1901.467) (-1900.180) -- 0:02:45
Average standard deviation of split frequencies: 0.001498
440500 -- (-1900.211) (-1890.176) (-1897.704) [-1897.472] * (-1903.012) [-1901.359] (-1894.848) (-1896.446) -- 0:02:46
441000 -- (-1893.195) (-1897.396) [-1894.204] (-1893.939) * (-1898.146) [-1902.099] (-1894.817) (-1901.971) -- 0:02:46
441500 -- (-1901.286) [-1889.099] (-1894.600) (-1899.617) * (-1899.662) [-1898.189] (-1903.850) (-1905.895) -- 0:02:45
442000 -- (-1900.174) (-1892.365) [-1893.378] (-1894.892) * (-1892.545) [-1896.186] (-1904.394) (-1903.097) -- 0:02:45
442500 -- [-1900.393] (-1899.559) (-1893.979) (-1895.521) * (-1895.788) [-1897.314] (-1902.977) (-1910.126) -- 0:02:45
443000 -- (-1903.991) [-1895.168] (-1894.631) (-1895.940) * (-1893.734) (-1903.263) (-1901.555) [-1903.157] -- 0:02:44
443500 -- (-1895.448) [-1901.589] (-1898.602) (-1898.870) * (-1896.617) (-1898.839) (-1901.055) [-1889.710] -- 0:02:44
444000 -- (-1891.315) (-1897.000) (-1895.466) [-1891.263] * (-1901.226) [-1898.163] (-1903.879) (-1905.682) -- 0:02:45
444500 -- (-1902.999) [-1893.295] (-1897.178) (-1903.484) * (-1900.429) (-1902.807) (-1901.764) [-1896.243] -- 0:02:44
445000 -- (-1898.045) [-1894.238] (-1899.673) (-1898.757) * (-1901.202) (-1902.147) [-1903.359] (-1903.817) -- 0:02:44
Average standard deviation of split frequencies: 0.001480
445500 -- (-1903.516) [-1894.894] (-1899.001) (-1899.931) * (-1898.951) (-1896.863) [-1892.130] (-1900.617) -- 0:02:44
446000 -- (-1898.173) [-1893.623] (-1906.923) (-1899.429) * (-1891.055) (-1900.210) [-1899.059] (-1908.464) -- 0:02:43
446500 -- (-1900.758) [-1892.999] (-1902.623) (-1923.791) * [-1894.921] (-1897.999) (-1895.653) (-1898.092) -- 0:02:43
447000 -- (-1896.646) (-1895.528) (-1896.376) [-1901.365] * [-1890.934] (-1901.791) (-1896.709) (-1906.710) -- 0:02:44
447500 -- (-1902.098) [-1905.207] (-1891.995) (-1895.004) * (-1897.569) (-1896.995) (-1898.345) [-1898.765] -- 0:02:44
448000 -- (-1897.318) (-1899.820) [-1895.232] (-1896.042) * (-1893.324) [-1899.398] (-1898.672) (-1895.087) -- 0:02:43
448500 -- (-1903.090) (-1900.186) (-1896.922) [-1900.577] * [-1892.671] (-1897.983) (-1905.450) (-1894.219) -- 0:02:43
449000 -- (-1896.832) [-1898.328] (-1896.236) (-1900.779) * (-1896.319) [-1896.997] (-1898.780) (-1898.477) -- 0:02:43
449500 -- (-1903.137) (-1903.865) [-1899.045] (-1900.519) * (-1896.324) (-1894.463) [-1899.044] (-1903.985) -- 0:02:42
450000 -- (-1906.024) (-1897.541) (-1904.635) [-1897.434] * (-1894.576) [-1892.272] (-1896.268) (-1893.818) -- 0:02:42
Average standard deviation of split frequencies: 0.001046
450500 -- (-1896.401) (-1897.498) (-1895.023) [-1889.811] * (-1897.303) [-1893.055] (-1897.042) (-1897.396) -- 0:02:43
451000 -- (-1893.688) (-1902.055) (-1905.971) [-1892.770] * (-1904.867) (-1899.502) (-1895.542) [-1894.391] -- 0:02:43
451500 -- [-1903.346] (-1898.699) (-1900.191) (-1907.602) * (-1904.125) [-1891.581] (-1901.041) (-1898.977) -- 0:02:42
452000 -- (-1900.755) (-1908.545) [-1899.068] (-1896.804) * (-1906.021) (-1888.699) [-1898.806] (-1896.635) -- 0:02:42
452500 -- [-1896.267] (-1902.509) (-1894.186) (-1896.022) * (-1895.867) (-1897.063) [-1896.736] (-1894.248) -- 0:02:42
453000 -- (-1897.336) (-1904.557) (-1899.997) [-1894.518] * (-1897.501) [-1898.887] (-1904.197) (-1900.519) -- 0:02:41
453500 -- [-1893.292] (-1895.541) (-1916.482) (-1900.869) * [-1893.846] (-1904.740) (-1897.584) (-1895.363) -- 0:02:41
454000 -- (-1905.885) (-1894.405) (-1895.875) [-1893.270] * (-1903.507) (-1892.514) [-1895.271] (-1898.751) -- 0:02:42
454500 -- [-1896.596] (-1896.571) (-1895.967) (-1891.917) * (-1898.047) [-1896.474] (-1890.964) (-1898.692) -- 0:02:42
455000 -- (-1897.286) (-1897.725) (-1897.817) [-1898.688] * (-1901.826) (-1906.818) [-1893.542] (-1898.543) -- 0:02:41
Average standard deviation of split frequencies: 0.001034
455500 -- (-1908.002) [-1897.013] (-1896.056) (-1898.345) * (-1904.443) (-1893.601) [-1895.671] (-1898.403) -- 0:02:41
456000 -- (-1896.751) (-1896.715) [-1899.156] (-1893.176) * (-1900.100) [-1896.011] (-1896.086) (-1894.157) -- 0:02:41
456500 -- (-1898.461) [-1898.199] (-1894.798) (-1896.924) * [-1895.401] (-1896.345) (-1895.557) (-1897.411) -- 0:02:40
457000 -- (-1905.004) (-1899.208) [-1895.406] (-1899.926) * (-1895.632) (-1897.099) (-1898.291) [-1899.773] -- 0:02:40
457500 -- [-1894.755] (-1902.239) (-1891.133) (-1898.736) * [-1894.915] (-1898.394) (-1908.586) (-1893.412) -- 0:02:41
458000 -- (-1898.771) (-1892.488) [-1895.012] (-1903.423) * [-1892.287] (-1896.351) (-1902.974) (-1907.210) -- 0:02:40
458500 -- [-1893.102] (-1903.932) (-1897.306) (-1900.064) * (-1894.584) [-1891.360] (-1902.722) (-1899.476) -- 0:02:40
459000 -- (-1897.733) (-1898.603) [-1895.227] (-1896.411) * (-1892.403) (-1898.127) [-1892.414] (-1901.562) -- 0:02:40
459500 -- (-1902.735) (-1901.436) [-1893.496] (-1899.636) * (-1892.679) (-1904.915) [-1897.114] (-1899.557) -- 0:02:39
460000 -- [-1901.393] (-1897.033) (-1899.208) (-1900.576) * (-1907.234) (-1901.919) [-1891.257] (-1897.265) -- 0:02:39
Average standard deviation of split frequencies: 0.001228
460500 -- (-1897.306) [-1893.538] (-1898.366) (-1902.135) * (-1911.169) (-1902.341) [-1896.183] (-1903.870) -- 0:02:39
461000 -- (-1903.775) [-1897.785] (-1897.356) (-1899.660) * [-1902.615] (-1895.238) (-1894.714) (-1894.825) -- 0:02:40
461500 -- (-1896.935) [-1889.124] (-1889.640) (-1899.362) * (-1895.264) (-1895.532) [-1896.241] (-1899.046) -- 0:02:39
462000 -- (-1906.871) (-1893.155) [-1902.272] (-1902.146) * [-1897.846] (-1907.885) (-1898.516) (-1894.097) -- 0:02:39
462500 -- (-1897.366) (-1895.898) (-1895.620) [-1892.061] * (-1903.303) (-1900.554) [-1893.869] (-1894.821) -- 0:02:39
463000 -- [-1893.675] (-1899.509) (-1902.628) (-1893.318) * (-1899.665) (-1895.522) (-1894.844) [-1894.273] -- 0:02:38
463500 -- (-1888.270) (-1894.868) (-1899.665) [-1903.867] * [-1895.382] (-1896.865) (-1896.857) (-1897.737) -- 0:02:38
464000 -- (-1897.115) (-1899.666) (-1899.932) [-1898.569] * [-1896.662] (-1901.462) (-1897.281) (-1910.634) -- 0:02:39
464500 -- [-1897.679] (-1898.032) (-1903.413) (-1902.466) * (-1896.837) [-1898.109] (-1897.417) (-1893.345) -- 0:02:39
465000 -- (-1900.640) [-1896.664] (-1900.426) (-1898.580) * (-1901.156) (-1898.483) [-1895.960] (-1898.990) -- 0:02:38
Average standard deviation of split frequencies: 0.003541
465500 -- (-1901.755) [-1895.390] (-1900.823) (-1905.435) * (-1895.700) (-1892.730) [-1898.266] (-1890.070) -- 0:02:38
466000 -- (-1899.982) (-1900.375) [-1901.171] (-1894.509) * (-1895.217) [-1891.980] (-1904.312) (-1901.497) -- 0:02:38
466500 -- (-1898.373) (-1893.059) [-1903.912] (-1897.963) * (-1903.053) [-1900.000] (-1902.198) (-1900.639) -- 0:02:37
467000 -- [-1895.844] (-1899.574) (-1904.213) (-1907.400) * (-1898.425) (-1908.430) (-1900.906) [-1899.234] -- 0:02:37
467500 -- [-1896.233] (-1898.911) (-1899.878) (-1913.552) * (-1899.367) [-1897.913] (-1899.830) (-1901.790) -- 0:02:38
468000 -- (-1902.447) [-1896.908] (-1907.360) (-1901.418) * (-1901.244) (-1900.482) [-1890.451] (-1898.328) -- 0:02:38
468500 -- (-1897.737) [-1892.316] (-1905.658) (-1897.320) * [-1897.166] (-1907.444) (-1899.313) (-1898.016) -- 0:02:37
469000 -- [-1897.561] (-1893.973) (-1906.807) (-1895.749) * (-1899.788) [-1901.597] (-1898.325) (-1901.003) -- 0:02:37
469500 -- (-1894.708) [-1900.142] (-1904.873) (-1899.153) * (-1891.778) [-1895.965] (-1898.066) (-1897.295) -- 0:02:37
470000 -- (-1894.277) (-1902.126) [-1895.057] (-1898.384) * (-1901.776) (-1895.475) (-1902.351) [-1895.193] -- 0:02:36
Average standard deviation of split frequencies: 0.001402
470500 -- (-1898.232) [-1894.446] (-1901.746) (-1898.422) * (-1905.027) (-1897.442) (-1910.904) [-1900.707] -- 0:02:36
471000 -- (-1918.371) [-1896.295] (-1896.984) (-1900.519) * (-1900.892) (-1902.077) (-1895.759) [-1898.203] -- 0:02:37
471500 -- (-1902.318) [-1897.358] (-1899.542) (-1906.556) * (-1896.689) [-1898.372] (-1909.617) (-1904.793) -- 0:02:36
472000 -- (-1905.873) (-1899.345) (-1896.871) [-1898.895] * [-1904.455] (-1896.562) (-1903.301) (-1901.568) -- 0:02:36
472500 -- [-1899.469] (-1898.089) (-1898.526) (-1899.431) * (-1904.042) (-1907.752) [-1892.172] (-1897.264) -- 0:02:36
473000 -- (-1905.356) (-1900.211) [-1893.199] (-1905.395) * [-1893.619] (-1894.175) (-1900.501) (-1900.778) -- 0:02:35
473500 -- (-1899.529) (-1900.854) [-1895.578] (-1893.501) * (-1900.684) [-1894.765] (-1901.311) (-1898.559) -- 0:02:35
474000 -- (-1901.409) (-1902.622) [-1892.962] (-1895.907) * (-1901.579) (-1892.750) [-1898.276] (-1903.040) -- 0:02:35
474500 -- (-1902.380) [-1893.176] (-1905.518) (-1899.006) * (-1896.033) [-1895.022] (-1900.061) (-1898.673) -- 0:02:36
475000 -- (-1894.584) [-1901.330] (-1904.924) (-1897.914) * (-1894.928) [-1893.884] (-1914.628) (-1898.091) -- 0:02:35
Average standard deviation of split frequencies: 0.001783
475500 -- [-1894.391] (-1896.773) (-1900.604) (-1895.397) * (-1897.525) (-1898.220) (-1895.833) [-1901.519] -- 0:02:35
476000 -- (-1897.287) (-1902.664) [-1896.798] (-1898.856) * (-1894.003) [-1894.087] (-1893.967) (-1903.846) -- 0:02:35
476500 -- (-1897.073) (-1900.904) (-1897.747) [-1894.840] * (-1896.472) (-1898.847) (-1901.580) [-1896.337] -- 0:02:34
477000 -- (-1891.283) [-1891.690] (-1897.805) (-1901.371) * (-1895.923) (-1904.669) [-1894.550] (-1904.615) -- 0:02:34
477500 -- (-1899.085) (-1891.876) [-1891.639] (-1897.876) * (-1899.131) (-1893.911) [-1894.760] (-1903.552) -- 0:02:35
478000 -- (-1895.727) (-1897.640) [-1891.933] (-1893.630) * [-1904.903] (-1896.131) (-1899.822) (-1899.153) -- 0:02:35
478500 -- (-1907.079) [-1893.543] (-1889.685) (-1895.575) * (-1905.758) (-1895.453) [-1898.874] (-1902.852) -- 0:02:34
479000 -- [-1891.920] (-1892.564) (-1896.522) (-1904.184) * (-1906.276) [-1895.558] (-1900.182) (-1893.290) -- 0:02:34
479500 -- (-1898.852) [-1895.597] (-1903.034) (-1906.676) * (-1907.882) (-1900.296) [-1894.857] (-1899.102) -- 0:02:34
480000 -- (-1901.490) [-1904.757] (-1906.410) (-1901.289) * [-1905.364] (-1893.427) (-1895.201) (-1902.140) -- 0:02:33
Average standard deviation of split frequencies: 0.001373
480500 -- (-1897.864) (-1891.514) [-1898.644] (-1894.869) * (-1896.958) (-1892.497) [-1895.542] (-1903.374) -- 0:02:33
481000 -- (-1906.383) (-1904.554) (-1899.607) [-1898.801] * (-1900.487) (-1895.582) (-1897.458) [-1908.176] -- 0:02:34
481500 -- (-1904.556) [-1896.194] (-1894.155) (-1900.661) * (-1906.792) (-1901.436) (-1902.439) [-1897.400] -- 0:02:33
482000 -- (-1901.328) [-1898.917] (-1900.557) (-1900.553) * (-1909.670) (-1894.787) [-1899.246] (-1897.119) -- 0:02:33
482500 -- [-1900.078] (-1903.558) (-1901.054) (-1900.623) * (-1896.121) [-1894.173] (-1897.365) (-1894.518) -- 0:02:33
483000 -- (-1894.196) (-1893.721) (-1890.152) [-1902.958] * (-1902.653) (-1900.572) [-1895.882] (-1894.143) -- 0:02:33
483500 -- (-1890.752) (-1900.702) [-1899.455] (-1901.890) * (-1897.855) (-1909.647) [-1901.689] (-1902.442) -- 0:02:32
484000 -- [-1895.753] (-1898.425) (-1893.930) (-1897.374) * (-1893.047) (-1902.270) [-1896.774] (-1899.506) -- 0:02:32
484500 -- (-1896.018) [-1897.422] (-1904.594) (-1903.332) * (-1906.557) [-1892.435] (-1893.143) (-1897.730) -- 0:02:33
485000 -- (-1904.684) (-1904.860) (-1896.339) [-1920.422] * (-1898.790) [-1898.691] (-1900.211) (-1911.549) -- 0:02:32
Average standard deviation of split frequencies: 0.001358
485500 -- (-1916.558) (-1897.895) [-1894.769] (-1897.476) * [-1903.491] (-1895.298) (-1905.265) (-1897.456) -- 0:02:32
486000 -- (-1903.390) (-1902.194) [-1897.173] (-1896.996) * [-1892.860] (-1892.493) (-1894.721) (-1900.904) -- 0:02:32
486500 -- (-1901.844) (-1898.836) (-1907.514) [-1899.082] * (-1899.079) (-1906.943) (-1899.650) [-1888.141] -- 0:02:31
487000 -- (-1901.274) (-1909.448) (-1900.162) [-1896.876] * [-1900.389] (-1899.574) (-1901.785) (-1897.505) -- 0:02:31
487500 -- (-1900.562) (-1903.184) [-1897.424] (-1894.289) * (-1898.957) [-1899.497] (-1894.292) (-1894.768) -- 0:02:31
488000 -- (-1898.450) [-1902.766] (-1896.712) (-1895.945) * [-1906.616] (-1902.711) (-1896.892) (-1911.333) -- 0:02:32
488500 -- (-1907.832) [-1894.263] (-1898.272) (-1892.909) * (-1896.253) [-1893.299] (-1894.044) (-1902.605) -- 0:02:31
489000 -- (-1893.738) (-1895.561) (-1896.397) [-1898.618] * (-1896.927) [-1896.433] (-1897.820) (-1900.242) -- 0:02:31
489500 -- (-1893.195) (-1899.223) [-1899.017] (-1907.315) * (-1896.596) (-1897.079) (-1897.130) [-1891.941] -- 0:02:31
490000 -- (-1902.023) (-1897.290) (-1891.958) [-1895.392] * (-1894.311) [-1897.214] (-1909.301) (-1897.243) -- 0:02:30
Average standard deviation of split frequencies: 0.001153
490500 -- (-1903.690) [-1895.187] (-1891.777) (-1897.361) * (-1904.279) (-1891.992) (-1897.798) [-1896.381] -- 0:02:30
491000 -- (-1905.537) [-1896.088] (-1892.639) (-1896.200) * [-1893.538] (-1891.761) (-1907.847) (-1897.772) -- 0:02:31
491500 -- [-1900.270] (-1901.332) (-1896.150) (-1895.989) * (-1900.288) (-1894.609) (-1900.277) [-1901.102] -- 0:02:31
492000 -- [-1893.220] (-1904.172) (-1904.997) (-1900.641) * (-1900.212) [-1896.274] (-1906.076) (-1909.048) -- 0:02:30
492500 -- (-1897.824) (-1904.063) [-1899.536] (-1898.258) * (-1892.803) [-1895.994] (-1894.690) (-1905.060) -- 0:02:30
493000 -- (-1897.458) (-1898.754) (-1903.251) [-1895.526] * [-1898.278] (-1896.562) (-1896.394) (-1897.865) -- 0:02:30
493500 -- [-1895.665] (-1897.048) (-1901.742) (-1900.276) * [-1895.539] (-1903.469) (-1902.404) (-1892.447) -- 0:02:29
494000 -- (-1898.001) [-1898.324] (-1898.791) (-1900.024) * [-1895.413] (-1893.521) (-1896.114) (-1901.707) -- 0:02:29
494500 -- (-1899.209) (-1903.510) [-1895.066] (-1897.176) * (-1899.833) (-1895.379) [-1897.584] (-1902.651) -- 0:02:30
495000 -- (-1892.383) [-1902.878] (-1904.203) (-1896.318) * (-1898.121) [-1891.866] (-1895.678) (-1898.270) -- 0:02:29
Average standard deviation of split frequencies: 0.001521
495500 -- [-1896.670] (-1903.903) (-1894.439) (-1904.254) * [-1896.223] (-1903.411) (-1896.587) (-1900.687) -- 0:02:29
496000 -- [-1895.336] (-1901.823) (-1905.434) (-1896.999) * [-1890.631] (-1899.672) (-1901.962) (-1893.920) -- 0:02:29
496500 -- [-1896.366] (-1898.687) (-1895.461) (-1901.234) * (-1895.714) (-1896.049) (-1903.191) [-1895.553] -- 0:02:29
497000 -- [-1892.020] (-1906.366) (-1895.941) (-1904.316) * [-1892.948] (-1892.024) (-1896.442) (-1906.973) -- 0:02:28
497500 -- [-1892.919] (-1896.239) (-1903.846) (-1907.266) * (-1895.724) [-1889.726] (-1901.845) (-1897.171) -- 0:02:28
498000 -- [-1896.033] (-1901.910) (-1900.167) (-1898.044) * (-1904.499) [-1893.351] (-1903.002) (-1896.601) -- 0:02:29
498500 -- (-1893.055) (-1906.391) [-1892.805] (-1902.699) * [-1891.431] (-1897.454) (-1898.846) (-1916.973) -- 0:02:28
499000 -- (-1902.152) (-1901.044) [-1893.927] (-1903.045) * (-1898.258) (-1895.243) [-1895.589] (-1904.301) -- 0:02:28
499500 -- [-1894.448] (-1899.334) (-1895.132) (-1901.033) * (-1894.643) [-1899.535] (-1896.908) (-1898.948) -- 0:02:28
500000 -- [-1891.911] (-1900.414) (-1902.589) (-1899.154) * (-1892.989) [-1896.684] (-1897.696) (-1893.718) -- 0:02:28
Average standard deviation of split frequencies: 0.001318
500500 -- (-1903.445) [-1894.379] (-1896.131) (-1904.142) * (-1896.410) [-1894.851] (-1900.650) (-1891.197) -- 0:02:27
501000 -- (-1907.360) (-1903.499) (-1892.516) [-1894.546] * [-1904.177] (-1902.536) (-1903.109) (-1909.302) -- 0:02:27
501500 -- [-1897.025] (-1896.254) (-1900.329) (-1903.786) * (-1905.995) (-1902.709) (-1901.724) [-1904.208] -- 0:02:28
502000 -- [-1898.919] (-1896.584) (-1901.832) (-1893.096) * (-1902.920) [-1902.717] (-1908.173) (-1896.797) -- 0:02:27
502500 -- (-1897.997) (-1892.552) (-1898.998) [-1904.157] * (-1901.767) (-1911.383) [-1890.556] (-1899.442) -- 0:02:27
503000 -- (-1893.499) (-1905.164) [-1906.132] (-1898.523) * (-1896.562) (-1900.057) (-1897.300) [-1894.799] -- 0:02:27
503500 -- (-1898.990) [-1892.230] (-1901.705) (-1899.901) * [-1900.430] (-1897.596) (-1896.755) (-1896.585) -- 0:02:26
504000 -- (-1897.566) (-1901.730) [-1898.118] (-1896.145) * (-1897.250) (-1894.359) (-1899.854) [-1895.167] -- 0:02:26
504500 -- (-1899.415) [-1898.508] (-1902.259) (-1905.394) * (-1893.557) (-1899.016) (-1894.532) [-1904.197] -- 0:02:26
505000 -- [-1900.357] (-1897.855) (-1898.357) (-1895.537) * (-1893.151) (-1903.000) [-1892.518] (-1903.835) -- 0:02:27
Average standard deviation of split frequencies: 0.002050
505500 -- [-1893.251] (-1902.452) (-1901.874) (-1904.743) * (-1896.528) (-1910.783) [-1891.461] (-1894.642) -- 0:02:26
506000 -- (-1898.180) (-1897.304) [-1900.517] (-1900.735) * (-1901.566) (-1902.902) [-1890.000] (-1894.461) -- 0:02:26
506500 -- (-1898.887) [-1903.785] (-1895.759) (-1897.479) * (-1904.187) [-1897.953] (-1898.434) (-1895.927) -- 0:02:26
507000 -- (-1905.436) (-1898.378) (-1896.671) [-1894.804] * (-1900.210) (-1905.853) [-1893.180] (-1895.024) -- 0:02:25
507500 -- (-1897.670) (-1899.754) [-1890.435] (-1901.407) * (-1901.361) [-1897.919] (-1900.702) (-1891.306) -- 0:02:25
508000 -- (-1896.790) (-1898.857) (-1897.422) [-1889.660] * (-1896.588) (-1900.482) [-1893.193] (-1898.976) -- 0:02:26
508500 -- (-1895.749) [-1902.894] (-1897.577) (-1895.724) * (-1895.733) (-1903.304) (-1894.970) [-1897.843] -- 0:02:25
509000 -- (-1901.244) (-1901.520) [-1897.682] (-1899.589) * (-1908.058) [-1897.275] (-1891.500) (-1906.652) -- 0:02:25
509500 -- (-1904.646) (-1893.696) (-1896.582) [-1888.745] * [-1902.980] (-1894.206) (-1895.841) (-1908.688) -- 0:02:25
510000 -- [-1903.515] (-1895.391) (-1890.532) (-1898.806) * (-1893.208) [-1896.601] (-1892.058) (-1901.737) -- 0:02:25
Average standard deviation of split frequencies: 0.001662
510500 -- (-1903.995) (-1895.740) [-1898.129] (-1897.438) * (-1901.712) (-1898.069) (-1902.054) [-1901.460] -- 0:02:24
511000 -- (-1899.928) [-1893.573] (-1896.664) (-1904.309) * (-1897.173) (-1906.783) (-1894.896) [-1904.421] -- 0:02:24
511500 -- (-1897.817) (-1905.625) [-1900.833] (-1904.940) * (-1901.537) [-1903.248] (-1898.257) (-1905.182) -- 0:02:25
512000 -- (-1897.840) [-1895.461] (-1890.669) (-1902.507) * [-1900.826] (-1900.888) (-1903.047) (-1899.167) -- 0:02:24
512500 -- (-1906.805) (-1899.028) [-1898.479] (-1905.873) * (-1900.464) [-1898.761] (-1901.716) (-1908.022) -- 0:02:24
513000 -- (-1896.717) [-1896.327] (-1896.900) (-1902.433) * (-1899.745) (-1902.150) [-1899.292] (-1894.617) -- 0:02:24
513500 -- (-1903.862) (-1901.507) [-1896.498] (-1893.816) * (-1903.118) (-1892.803) (-1901.434) [-1898.426] -- 0:02:24
514000 -- [-1900.261] (-1894.824) (-1903.633) (-1903.567) * (-1901.227) (-1898.483) (-1903.439) [-1899.399] -- 0:02:23
514500 -- (-1903.979) (-1905.097) [-1894.263] (-1898.379) * (-1902.258) (-1900.098) [-1901.156] (-1903.441) -- 0:02:23
515000 -- (-1899.894) [-1900.463] (-1895.731) (-1911.441) * (-1898.569) [-1901.256] (-1903.066) (-1897.609) -- 0:02:24
Average standard deviation of split frequencies: 0.001644
515500 -- (-1901.981) (-1909.296) (-1898.063) [-1903.051] * (-1896.335) [-1895.594] (-1901.853) (-1897.358) -- 0:02:23
516000 -- (-1901.112) (-1898.544) (-1892.985) [-1897.748] * [-1902.448] (-1904.206) (-1895.942) (-1892.995) -- 0:02:23
516500 -- (-1902.583) (-1894.457) (-1891.095) [-1905.439] * (-1897.854) (-1902.332) (-1901.612) [-1899.326] -- 0:02:23
517000 -- (-1899.877) (-1904.560) [-1901.930] (-1898.944) * (-1896.408) (-1902.383) (-1895.994) [-1898.359] -- 0:02:22
517500 -- [-1903.842] (-1902.739) (-1905.578) (-1901.119) * (-1902.897) [-1899.335] (-1907.879) (-1901.914) -- 0:02:22
518000 -- [-1899.005] (-1895.927) (-1903.984) (-1902.562) * (-1891.132) (-1904.517) (-1904.918) [-1896.929] -- 0:02:22
518500 -- (-1901.209) (-1907.411) [-1895.112] (-1902.735) * (-1892.665) (-1903.904) [-1899.915] (-1904.176) -- 0:02:23
519000 -- [-1899.418] (-1897.752) (-1896.127) (-1901.129) * (-1897.051) (-1894.995) (-1892.603) [-1897.614] -- 0:02:22
519500 -- (-1890.180) (-1898.688) (-1894.770) [-1892.590] * [-1899.758] (-1902.955) (-1904.115) (-1899.910) -- 0:02:22
520000 -- (-1896.539) (-1896.421) (-1899.007) [-1894.721] * (-1902.918) (-1895.197) [-1895.358] (-1896.390) -- 0:02:22
Average standard deviation of split frequencies: 0.001992
520500 -- (-1895.716) (-1896.555) (-1900.260) [-1891.482] * (-1897.315) [-1899.206] (-1897.756) (-1894.164) -- 0:02:21
521000 -- [-1892.052] (-1904.102) (-1896.195) (-1895.987) * (-1908.717) (-1905.111) [-1894.141] (-1900.822) -- 0:02:21
521500 -- (-1910.075) (-1897.024) [-1901.115] (-1897.058) * (-1898.966) [-1905.183] (-1901.683) (-1896.523) -- 0:02:21
522000 -- [-1892.798] (-1894.411) (-1903.825) (-1903.434) * (-1896.519) (-1903.778) (-1903.884) [-1894.973] -- 0:02:21
522500 -- [-1894.037] (-1902.074) (-1905.794) (-1907.981) * (-1903.151) (-1901.791) (-1896.669) [-1903.030] -- 0:02:21
523000 -- [-1891.276] (-1899.369) (-1899.616) (-1901.334) * [-1894.622] (-1902.005) (-1893.737) (-1905.903) -- 0:02:21
523500 -- [-1898.938] (-1896.068) (-1895.508) (-1906.100) * [-1895.129] (-1911.852) (-1892.627) (-1909.745) -- 0:02:21
524000 -- (-1903.941) [-1893.053] (-1895.687) (-1903.932) * [-1896.012] (-1907.258) (-1903.755) (-1900.028) -- 0:02:20
524500 -- (-1898.837) (-1892.435) (-1895.187) [-1897.632] * (-1900.893) (-1896.274) [-1897.213] (-1898.613) -- 0:02:20
525000 -- (-1901.969) (-1894.770) (-1906.719) [-1896.409] * [-1902.800] (-1921.171) (-1897.491) (-1899.568) -- 0:02:21
Average standard deviation of split frequencies: 0.001792
525500 -- (-1903.638) (-1896.888) [-1893.416] (-1901.328) * (-1894.870) (-1902.648) (-1895.598) [-1893.656] -- 0:02:20
526000 -- (-1895.395) (-1894.144) [-1897.215] (-1894.481) * [-1894.672] (-1896.106) (-1903.223) (-1894.270) -- 0:02:20
526500 -- (-1898.774) (-1898.771) [-1901.610] (-1895.381) * (-1899.807) (-1908.341) (-1900.447) [-1897.690] -- 0:02:20
527000 -- (-1899.621) (-1898.153) (-1890.511) [-1901.185] * (-1901.879) (-1898.496) [-1902.212] (-1895.412) -- 0:02:20
527500 -- (-1893.117) [-1892.710] (-1896.804) (-1902.824) * (-1902.215) (-1903.057) (-1897.295) [-1898.502] -- 0:02:19
528000 -- [-1896.045] (-1898.989) (-1906.325) (-1899.204) * (-1901.569) (-1899.938) [-1903.266] (-1900.322) -- 0:02:19
528500 -- (-1898.186) (-1897.299) (-1896.712) [-1894.350] * (-1900.572) [-1901.247] (-1896.885) (-1895.220) -- 0:02:20
529000 -- (-1896.871) [-1901.911] (-1893.920) (-1901.239) * (-1894.767) (-1900.215) (-1907.247) [-1895.514] -- 0:02:19
529500 -- [-1897.041] (-1899.908) (-1897.886) (-1896.717) * (-1897.270) [-1897.791] (-1904.985) (-1894.522) -- 0:02:19
530000 -- (-1900.851) [-1894.657] (-1896.883) (-1893.993) * (-1895.439) (-1892.220) (-1896.960) [-1890.716] -- 0:02:19
Average standard deviation of split frequencies: 0.001599
530500 -- (-1893.077) (-1894.941) [-1900.103] (-1892.176) * (-1911.930) (-1899.438) [-1899.991] (-1896.134) -- 0:02:18
531000 -- (-1896.524) (-1894.987) [-1890.038] (-1907.658) * (-1893.561) (-1903.746) [-1899.974] (-1896.769) -- 0:02:18
531500 -- (-1900.859) [-1894.442] (-1902.988) (-1900.746) * (-1901.122) [-1898.207] (-1898.457) (-1895.760) -- 0:02:18
532000 -- (-1896.623) (-1901.806) [-1896.720] (-1895.889) * (-1895.462) (-1908.168) [-1892.702] (-1897.433) -- 0:02:18
532500 -- [-1893.402] (-1897.206) (-1898.751) (-1900.584) * (-1903.400) (-1895.674) [-1896.695] (-1899.344) -- 0:02:18
533000 -- [-1891.321] (-1890.837) (-1895.201) (-1902.720) * (-1909.866) [-1895.590] (-1894.382) (-1902.819) -- 0:02:18
533500 -- [-1895.469] (-1896.957) (-1896.311) (-1895.797) * (-1896.607) (-1903.609) [-1897.092] (-1900.997) -- 0:02:18
534000 -- (-1904.919) (-1892.617) [-1900.440] (-1902.695) * (-1894.586) [-1893.475] (-1897.704) (-1896.870) -- 0:02:17
534500 -- (-1896.741) (-1896.486) [-1899.063] (-1901.016) * (-1902.232) (-1896.334) (-1898.878) [-1892.707] -- 0:02:17
535000 -- (-1905.737) [-1901.917] (-1898.981) (-1890.339) * (-1896.735) [-1899.840] (-1902.252) (-1891.303) -- 0:02:17
Average standard deviation of split frequencies: 0.002111
535500 -- (-1900.956) (-1901.283) [-1890.692] (-1906.918) * (-1899.663) (-1908.843) [-1890.933] (-1902.734) -- 0:02:17
536000 -- (-1904.795) [-1903.879] (-1903.593) (-1901.781) * (-1897.751) (-1895.004) (-1900.929) [-1900.347] -- 0:02:17
536500 -- (-1898.087) [-1894.154] (-1889.313) (-1896.633) * (-1898.123) [-1894.360] (-1897.571) (-1901.205) -- 0:02:17
537000 -- (-1900.561) [-1901.606] (-1900.845) (-1898.856) * (-1895.240) [-1894.552] (-1902.797) (-1905.243) -- 0:02:17
537500 -- (-1895.262) [-1904.292] (-1909.845) (-1905.252) * (-1897.993) [-1896.764] (-1895.241) (-1902.973) -- 0:02:16
538000 -- (-1900.886) (-1897.202) [-1898.769] (-1897.954) * (-1897.118) (-1901.073) [-1893.678] (-1901.054) -- 0:02:16
538500 -- (-1903.673) [-1897.427] (-1894.463) (-1896.427) * (-1908.539) (-1895.252) [-1891.556] (-1902.014) -- 0:02:17
539000 -- (-1911.317) (-1895.520) (-1899.896) [-1894.463] * (-1901.200) [-1899.435] (-1897.927) (-1890.570) -- 0:02:16
539500 -- (-1895.741) (-1898.770) [-1902.841] (-1898.359) * (-1896.145) (-1893.355) [-1901.816] (-1899.420) -- 0:02:16
540000 -- (-1896.864) [-1905.361] (-1909.639) (-1891.946) * (-1896.232) (-1901.025) (-1896.545) [-1902.045] -- 0:02:16
Average standard deviation of split frequencies: 0.001918
540500 -- (-1900.094) (-1895.901) (-1896.943) [-1896.744] * (-1905.002) [-1893.625] (-1917.204) (-1907.101) -- 0:02:16
541000 -- (-1898.136) [-1891.246] (-1903.670) (-1895.519) * (-1896.354) [-1902.108] (-1899.896) (-1905.208) -- 0:02:15
541500 -- (-1912.079) (-1900.493) (-1900.638) [-1897.688] * (-1904.019) (-1896.649) (-1900.540) [-1893.753] -- 0:02:15
542000 -- (-1896.292) [-1904.453] (-1892.167) (-1899.539) * [-1898.628] (-1901.465) (-1910.056) (-1902.506) -- 0:02:16
542500 -- (-1901.995) [-1895.122] (-1894.882) (-1894.169) * (-1902.345) [-1896.133] (-1903.353) (-1897.255) -- 0:02:15
543000 -- (-1899.373) (-1899.560) [-1893.654] (-1906.651) * (-1906.688) (-1903.115) [-1900.569] (-1899.130) -- 0:02:15
543500 -- (-1902.173) (-1897.511) [-1898.773] (-1899.826) * (-1891.495) (-1893.345) (-1892.163) [-1898.066] -- 0:02:15
544000 -- (-1919.079) [-1894.819] (-1893.082) (-1893.093) * (-1899.812) [-1896.816] (-1895.266) (-1899.272) -- 0:02:14
544500 -- (-1901.832) [-1894.756] (-1903.124) (-1915.299) * (-1895.664) (-1900.440) [-1901.467] (-1894.353) -- 0:02:14
545000 -- [-1896.783] (-1899.664) (-1894.034) (-1892.737) * (-1896.286) (-1894.365) (-1900.804) [-1899.148] -- 0:02:14
Average standard deviation of split frequencies: 0.001899
545500 -- (-1895.983) (-1898.722) (-1897.159) [-1898.453] * [-1898.155] (-1893.112) (-1899.748) (-1903.415) -- 0:02:14
546000 -- (-1907.391) (-1896.821) (-1910.015) [-1902.047] * [-1901.875] (-1902.248) (-1895.337) (-1910.760) -- 0:02:14
546500 -- [-1895.292] (-1903.986) (-1899.903) (-1901.249) * (-1905.589) [-1897.748] (-1894.209) (-1906.742) -- 0:02:14
547000 -- [-1894.075] (-1902.084) (-1895.703) (-1913.030) * (-1898.738) (-1903.911) [-1897.268] (-1906.979) -- 0:02:14
547500 -- [-1894.463] (-1897.357) (-1896.937) (-1896.075) * [-1894.729] (-1903.200) (-1906.378) (-1898.574) -- 0:02:13
548000 -- (-1901.385) (-1894.992) [-1891.799] (-1899.970) * (-1890.880) (-1901.708) (-1901.413) [-1897.433] -- 0:02:13
548500 -- [-1894.271] (-1895.292) (-1897.760) (-1904.144) * [-1900.389] (-1895.237) (-1894.435) (-1897.994) -- 0:02:13
549000 -- (-1894.320) (-1900.163) (-1897.001) [-1899.474] * [-1898.161] (-1900.259) (-1900.437) (-1903.635) -- 0:02:13
549500 -- (-1899.099) (-1898.020) [-1900.433] (-1905.953) * [-1893.140] (-1906.347) (-1900.190) (-1902.786) -- 0:02:13
550000 -- (-1899.940) [-1900.290] (-1908.045) (-1897.233) * [-1898.619] (-1907.595) (-1904.713) (-1899.379) -- 0:02:13
Average standard deviation of split frequencies: 0.001883
550500 -- (-1900.734) (-1900.583) [-1907.453] (-1902.928) * (-1898.206) (-1916.568) (-1890.814) [-1894.480] -- 0:02:13
551000 -- (-1897.156) (-1902.860) (-1897.977) [-1903.090] * (-1901.973) (-1901.228) [-1892.908] (-1896.952) -- 0:02:12
551500 -- (-1898.960) [-1895.242] (-1901.220) (-1898.745) * (-1892.830) (-1904.170) (-1900.744) [-1894.455] -- 0:02:12
552000 -- (-1904.964) (-1902.997) (-1898.806) [-1903.454] * (-1895.911) (-1910.829) [-1894.772] (-1897.788) -- 0:02:13
552500 -- (-1901.722) (-1897.657) (-1891.617) [-1903.230] * (-1897.912) (-1905.140) [-1898.542] (-1895.948) -- 0:02:12
553000 -- (-1913.529) (-1895.438) (-1894.562) [-1895.068] * (-1895.335) (-1901.184) [-1899.210] (-1902.144) -- 0:02:12
553500 -- (-1904.860) [-1895.150] (-1906.900) (-1893.348) * (-1907.142) (-1912.516) [-1892.748] (-1899.793) -- 0:02:12
554000 -- (-1902.733) (-1896.200) (-1902.223) [-1902.392] * (-1892.730) (-1902.267) (-1901.736) [-1894.963] -- 0:02:12
554500 -- (-1906.282) [-1904.298] (-1900.617) (-1899.520) * (-1900.250) (-1896.642) [-1892.957] (-1898.316) -- 0:02:11
555000 -- (-1891.885) (-1902.910) (-1902.226) [-1895.693] * (-1904.331) (-1901.424) (-1900.672) [-1896.602] -- 0:02:11
Average standard deviation of split frequencies: 0.001865
555500 -- (-1892.082) (-1900.669) [-1892.151] (-1891.857) * (-1906.429) (-1897.095) (-1900.834) [-1896.336] -- 0:02:12
556000 -- (-1900.306) (-1902.900) [-1904.292] (-1890.206) * (-1900.156) (-1903.539) (-1902.225) [-1902.590] -- 0:02:11
556500 -- (-1902.282) [-1901.637] (-1904.968) (-1907.861) * [-1901.164] (-1907.512) (-1902.764) (-1899.769) -- 0:02:11
557000 -- (-1903.086) [-1899.591] (-1908.386) (-1899.485) * (-1896.360) (-1901.733) [-1899.036] (-1897.667) -- 0:02:11
557500 -- (-1899.304) (-1906.013) (-1901.786) [-1903.090] * [-1900.710] (-1897.522) (-1896.999) (-1901.866) -- 0:02:10
558000 -- (-1898.026) (-1902.343) (-1899.840) [-1903.801] * [-1892.655] (-1899.845) (-1897.286) (-1914.511) -- 0:02:10
558500 -- (-1888.983) [-1897.018] (-1901.313) (-1901.032) * [-1896.822] (-1899.033) (-1901.379) (-1896.079) -- 0:02:10
559000 -- (-1897.145) (-1901.226) (-1901.686) [-1908.092] * [-1908.165] (-1901.059) (-1900.358) (-1901.614) -- 0:02:10
559500 -- (-1895.849) (-1903.107) (-1901.243) [-1897.479] * (-1902.780) (-1898.215) [-1893.421] (-1906.696) -- 0:02:10
560000 -- [-1898.345] (-1896.328) (-1899.968) (-1899.915) * (-1899.353) (-1898.487) [-1897.287] (-1901.111) -- 0:02:10
Average standard deviation of split frequencies: 0.002354
560500 -- (-1901.070) (-1894.927) (-1898.943) [-1898.875] * (-1897.133) (-1895.651) [-1898.995] (-1907.377) -- 0:02:10
561000 -- (-1899.087) (-1894.589) [-1899.752] (-1900.863) * (-1894.345) (-1894.057) [-1909.434] (-1898.472) -- 0:02:09
561500 -- [-1897.618] (-1891.223) (-1896.396) (-1899.843) * [-1894.738] (-1899.825) (-1901.462) (-1891.707) -- 0:02:09
562000 -- (-1896.139) (-1894.379) [-1896.939] (-1902.386) * [-1898.147] (-1898.239) (-1903.692) (-1904.273) -- 0:02:09
562500 -- (-1896.891) [-1893.667] (-1896.807) (-1902.019) * (-1898.357) (-1900.867) [-1891.548] (-1892.937) -- 0:02:09
563000 -- (-1904.914) (-1893.243) (-1898.856) [-1898.627] * (-1898.695) [-1900.727] (-1900.552) (-1899.114) -- 0:02:09
563500 -- (-1903.468) (-1898.864) (-1894.319) [-1893.804] * [-1898.334] (-1895.847) (-1902.756) (-1905.428) -- 0:02:09
564000 -- (-1900.199) (-1892.660) [-1896.074] (-1898.615) * (-1893.209) (-1906.066) (-1902.745) [-1899.113] -- 0:02:09
564500 -- (-1897.648) (-1896.388) [-1901.917] (-1905.612) * (-1896.663) (-1904.605) [-1895.604] (-1902.096) -- 0:02:08
565000 -- (-1910.245) (-1896.596) [-1898.993] (-1902.218) * [-1902.729] (-1903.291) (-1896.704) (-1899.210) -- 0:02:08
Average standard deviation of split frequencies: 0.002499
565500 -- (-1901.567) [-1900.504] (-1905.697) (-1896.007) * (-1896.937) (-1906.261) (-1901.119) [-1892.868] -- 0:02:08
566000 -- [-1898.453] (-1891.176) (-1902.953) (-1901.519) * (-1895.538) (-1899.006) (-1901.154) [-1903.197] -- 0:02:08
566500 -- (-1904.200) (-1894.262) [-1893.731] (-1899.981) * (-1896.565) (-1903.813) (-1902.090) [-1893.599] -- 0:02:08
567000 -- [-1895.384] (-1916.799) (-1891.644) (-1902.851) * (-1900.682) (-1898.600) [-1895.175] (-1898.788) -- 0:02:08
567500 -- (-1895.870) (-1902.174) [-1896.746] (-1901.295) * (-1902.518) (-1905.000) (-1896.104) [-1902.084] -- 0:02:08
568000 -- (-1901.498) [-1906.458] (-1906.396) (-1908.470) * (-1891.161) (-1909.935) [-1897.549] (-1910.492) -- 0:02:07
568500 -- (-1904.098) (-1896.954) [-1891.114] (-1898.948) * (-1896.324) (-1905.148) [-1894.067] (-1898.247) -- 0:02:07
569000 -- (-1899.686) (-1895.845) [-1891.845] (-1898.932) * (-1902.849) (-1902.422) (-1891.688) [-1892.725] -- 0:02:07
569500 -- (-1900.285) (-1896.972) [-1893.067] (-1894.309) * (-1890.641) (-1900.785) (-1911.461) [-1895.856] -- 0:02:07
570000 -- [-1895.506] (-1898.324) (-1896.750) (-1898.916) * (-1899.668) (-1905.453) [-1902.286] (-1897.926) -- 0:02:07
Average standard deviation of split frequencies: 0.002809
570500 -- (-1897.329) (-1903.533) [-1898.068] (-1896.375) * [-1897.761] (-1903.322) (-1896.782) (-1893.697) -- 0:02:07
571000 -- (-1897.927) [-1895.454] (-1899.863) (-1901.455) * (-1901.462) [-1893.762] (-1895.071) (-1898.363) -- 0:02:06
571500 -- (-1901.832) [-1896.848] (-1897.066) (-1896.136) * (-1892.210) (-1896.063) [-1894.627] (-1899.157) -- 0:02:06
572000 -- (-1900.943) (-1894.764) (-1897.642) [-1898.119] * (-1907.939) (-1904.014) (-1894.798) [-1897.905] -- 0:02:06
572500 -- (-1902.161) (-1898.807) [-1900.172] (-1899.586) * [-1894.576] (-1899.682) (-1902.337) (-1907.582) -- 0:02:06
573000 -- (-1898.408) (-1891.799) [-1892.867] (-1893.493) * (-1893.980) [-1895.237] (-1897.127) (-1895.510) -- 0:02:06
573500 -- (-1901.580) (-1899.908) [-1901.222] (-1893.417) * (-1898.150) (-1904.722) [-1902.805] (-1897.495) -- 0:02:06
574000 -- [-1899.633] (-1905.534) (-1905.236) (-1895.031) * [-1897.846] (-1892.076) (-1898.441) (-1899.813) -- 0:02:06
574500 -- [-1895.399] (-1902.120) (-1903.136) (-1900.677) * (-1895.464) (-1899.550) (-1899.510) [-1891.712] -- 0:02:05
575000 -- (-1893.890) (-1893.541) [-1894.731] (-1904.466) * [-1903.928] (-1899.796) (-1898.078) (-1896.169) -- 0:02:05
Average standard deviation of split frequencies: 0.002619
575500 -- (-1897.500) (-1896.770) [-1896.139] (-1907.330) * (-1900.292) (-1902.144) (-1896.109) [-1891.727] -- 0:02:05
576000 -- (-1900.024) (-1893.858) (-1899.836) [-1899.488] * (-1901.406) [-1896.129] (-1906.621) (-1892.978) -- 0:02:05
576500 -- [-1904.525] (-1894.610) (-1895.755) (-1897.638) * (-1893.778) [-1894.329] (-1901.783) (-1892.554) -- 0:02:05
577000 -- (-1897.987) (-1895.649) (-1897.306) [-1895.808] * (-1899.661) (-1895.424) [-1895.029] (-1902.735) -- 0:02:05
577500 -- [-1900.588] (-1900.846) (-1906.651) (-1907.522) * (-1895.588) [-1890.055] (-1893.894) (-1898.975) -- 0:02:05
578000 -- (-1898.842) (-1898.951) [-1896.834] (-1894.945) * (-1896.665) [-1892.251] (-1898.114) (-1918.502) -- 0:02:04
578500 -- [-1902.495] (-1905.078) (-1904.390) (-1907.910) * (-1898.100) [-1897.652] (-1895.088) (-1901.611) -- 0:02:04
579000 -- (-1905.699) (-1898.547) (-1892.169) [-1892.967] * (-1906.784) [-1900.127] (-1903.829) (-1896.478) -- 0:02:04
579500 -- (-1899.671) [-1894.708] (-1903.086) (-1894.525) * (-1904.866) (-1897.780) (-1908.160) [-1895.617] -- 0:02:04
580000 -- (-1899.937) (-1899.953) (-1902.319) [-1891.572] * (-1902.059) [-1897.324] (-1910.331) (-1893.572) -- 0:02:04
Average standard deviation of split frequencies: 0.002435
580500 -- [-1891.692] (-1904.117) (-1896.011) (-1897.356) * (-1906.228) (-1892.263) (-1897.659) [-1890.241] -- 0:02:04
581000 -- (-1890.420) (-1902.300) [-1892.708] (-1901.931) * (-1895.709) (-1904.393) (-1900.616) [-1898.021] -- 0:02:04
581500 -- (-1902.534) [-1894.837] (-1899.483) (-1903.331) * [-1900.779] (-1896.177) (-1903.123) (-1904.604) -- 0:02:03
582000 -- (-1896.633) (-1895.252) [-1902.215] (-1910.722) * (-1907.978) (-1898.227) (-1904.186) [-1901.897] -- 0:02:03
582500 -- (-1904.647) [-1899.219] (-1893.223) (-1892.820) * (-1902.360) (-1889.248) [-1902.229] (-1903.501) -- 0:02:03
583000 -- [-1898.860] (-1897.168) (-1900.307) (-1902.546) * [-1890.492] (-1895.365) (-1909.410) (-1897.689) -- 0:02:03
583500 -- (-1900.157) [-1898.447] (-1901.790) (-1897.104) * (-1900.403) (-1901.292) (-1907.806) [-1899.020] -- 0:02:03
584000 -- (-1913.649) (-1890.536) [-1895.095] (-1905.943) * [-1903.174] (-1907.532) (-1894.589) (-1899.546) -- 0:02:03
584500 -- (-1893.698) (-1897.034) [-1896.921] (-1903.209) * [-1908.350] (-1907.218) (-1904.191) (-1898.980) -- 0:02:02
585000 -- (-1907.240) (-1895.619) (-1897.476) [-1901.680] * [-1890.972] (-1904.228) (-1907.861) (-1905.382) -- 0:02:02
Average standard deviation of split frequencies: 0.002896
585500 -- (-1902.311) [-1899.534] (-1897.589) (-1905.468) * [-1892.216] (-1899.383) (-1909.104) (-1899.314) -- 0:02:02
586000 -- (-1894.349) (-1905.735) [-1895.199] (-1900.477) * (-1904.927) (-1894.477) (-1898.118) [-1892.360] -- 0:02:02
586500 -- (-1901.521) (-1900.559) [-1893.760] (-1916.295) * (-1895.148) (-1897.325) (-1908.217) [-1899.633] -- 0:02:02
587000 -- (-1905.424) (-1894.011) [-1895.828] (-1892.232) * [-1897.890] (-1901.176) (-1892.936) (-1906.219) -- 0:02:02
587500 -- (-1895.667) (-1904.030) (-1896.686) [-1895.523] * (-1894.102) (-1902.769) (-1902.564) [-1896.246] -- 0:02:02
588000 -- [-1897.693] (-1899.523) (-1900.420) (-1903.522) * (-1897.553) (-1896.337) (-1898.492) [-1900.166] -- 0:02:01
588500 -- (-1898.904) (-1897.293) [-1896.902] (-1909.193) * (-1894.517) [-1900.086] (-1900.666) (-1902.751) -- 0:02:01
589000 -- (-1896.251) [-1895.168] (-1900.589) (-1908.683) * (-1905.566) (-1905.665) (-1896.590) [-1898.416] -- 0:02:01
589500 -- (-1900.797) (-1895.583) (-1900.273) [-1893.820] * [-1896.533] (-1898.539) (-1899.408) (-1905.150) -- 0:02:01
590000 -- (-1897.496) (-1898.541) [-1902.405] (-1900.069) * [-1897.489] (-1908.183) (-1903.096) (-1897.107) -- 0:02:01
Average standard deviation of split frequencies: 0.002714
590500 -- (-1896.801) (-1904.467) [-1899.662] (-1894.693) * (-1899.744) (-1896.869) [-1900.975] (-1895.060) -- 0:02:01
591000 -- (-1901.062) (-1898.518) [-1892.397] (-1909.233) * [-1901.429] (-1900.055) (-1896.459) (-1895.013) -- 0:02:01
591500 -- (-1900.311) [-1892.313] (-1902.057) (-1897.234) * (-1898.505) (-1903.189) (-1901.150) [-1905.921] -- 0:02:00
592000 -- (-1896.754) (-1895.608) (-1895.789) [-1891.798] * [-1896.384] (-1897.858) (-1899.044) (-1907.389) -- 0:02:00
592500 -- (-1892.374) [-1894.827] (-1902.182) (-1900.832) * (-1903.235) [-1904.636] (-1902.353) (-1899.705) -- 0:02:00
593000 -- (-1892.416) (-1900.982) [-1895.241] (-1907.931) * (-1893.697) (-1898.863) (-1902.888) [-1894.814] -- 0:02:00
593500 -- (-1899.484) [-1897.162] (-1899.343) (-1894.885) * (-1896.380) [-1904.633] (-1897.772) (-1897.768) -- 0:02:00
594000 -- (-1903.710) (-1893.262) [-1900.559] (-1902.292) * (-1897.418) (-1912.752) [-1901.449] (-1897.409) -- 0:02:00
594500 -- (-1898.080) (-1899.536) (-1896.946) [-1901.605] * [-1897.642] (-1900.708) (-1896.786) (-1904.327) -- 0:02:00
595000 -- (-1903.272) (-1901.998) (-1899.159) [-1892.926] * (-1895.364) (-1903.494) [-1894.115] (-1894.302) -- 0:01:59
Average standard deviation of split frequencies: 0.002215
595500 -- (-1899.050) [-1895.385] (-1893.536) (-1899.817) * (-1898.098) [-1901.698] (-1897.877) (-1896.665) -- 0:01:59
596000 -- (-1895.641) (-1900.082) (-1897.670) [-1903.907] * [-1898.157] (-1890.826) (-1896.472) (-1896.075) -- 0:01:59
596500 -- (-1902.112) [-1904.292] (-1903.170) (-1899.021) * [-1897.462] (-1899.323) (-1898.738) (-1894.341) -- 0:01:59
597000 -- (-1902.328) [-1893.771] (-1898.852) (-1903.510) * [-1890.909] (-1901.525) (-1898.030) (-1892.798) -- 0:01:59
597500 -- (-1899.659) (-1893.870) [-1894.104] (-1900.985) * (-1897.104) (-1903.931) [-1895.619] (-1896.230) -- 0:01:59
598000 -- (-1901.775) [-1892.964] (-1895.722) (-1893.554) * (-1893.573) [-1891.553] (-1891.316) (-1898.789) -- 0:01:58
598500 -- (-1896.075) [-1897.072] (-1901.342) (-1898.849) * (-1894.464) [-1895.866] (-1897.247) (-1908.287) -- 0:01:58
599000 -- (-1899.910) (-1902.549) [-1903.261] (-1893.857) * (-1901.667) [-1904.115] (-1899.867) (-1897.988) -- 0:01:58
599500 -- (-1905.769) (-1902.619) [-1900.522] (-1910.643) * [-1892.024] (-1907.228) (-1900.428) (-1916.515) -- 0:01:58
600000 -- (-1898.750) (-1893.048) (-1904.392) [-1892.645] * (-1901.696) (-1904.862) [-1898.381] (-1900.426) -- 0:01:58
Average standard deviation of split frequencies: 0.002511
600500 -- (-1897.374) (-1890.948) (-1899.991) [-1894.561] * (-1898.597) (-1898.632) (-1898.475) [-1900.686] -- 0:01:58
601000 -- (-1901.713) (-1895.209) [-1897.570] (-1901.182) * [-1894.062] (-1901.593) (-1895.975) (-1895.132) -- 0:01:58
601500 -- (-1898.942) (-1903.169) (-1908.524) [-1896.219] * (-1907.531) (-1894.156) [-1895.888] (-1898.371) -- 0:01:57
602000 -- (-1907.215) (-1900.936) [-1893.168] (-1901.326) * (-1906.444) [-1893.396] (-1908.443) (-1897.218) -- 0:01:57
602500 -- (-1907.023) (-1895.029) (-1900.795) [-1903.862] * (-1899.613) [-1893.114] (-1899.637) (-1899.643) -- 0:01:57
603000 -- [-1901.734] (-1896.449) (-1904.787) (-1895.532) * [-1896.254] (-1893.350) (-1893.942) (-1899.496) -- 0:01:57
603500 -- (-1921.088) [-1902.815] (-1899.298) (-1899.021) * (-1896.343) [-1893.086] (-1901.365) (-1896.373) -- 0:01:57
604000 -- (-1904.256) [-1900.738] (-1899.692) (-1896.395) * (-1899.309) [-1896.392] (-1901.173) (-1900.912) -- 0:01:57
604500 -- (-1897.504) (-1896.936) [-1902.544] (-1891.539) * (-1901.508) [-1905.312] (-1895.580) (-1900.665) -- 0:01:57
605000 -- [-1895.058] (-1901.114) (-1900.676) (-1901.477) * [-1894.690] (-1892.683) (-1905.669) (-1901.633) -- 0:01:56
Average standard deviation of split frequencies: 0.001867
605500 -- (-1904.765) (-1893.074) (-1893.748) [-1896.901] * (-1905.299) (-1894.588) (-1915.011) [-1892.674] -- 0:01:56
606000 -- (-1898.461) [-1896.148] (-1897.547) (-1896.962) * (-1904.777) [-1895.097] (-1900.977) (-1897.741) -- 0:01:56
606500 -- (-1907.498) (-1901.041) [-1895.563] (-1904.417) * (-1898.779) (-1900.923) (-1896.680) [-1895.783] -- 0:01:56
607000 -- (-1906.897) (-1902.523) [-1896.352] (-1900.192) * (-1897.891) (-1902.965) (-1907.985) [-1895.464] -- 0:01:56
607500 -- (-1902.209) (-1896.773) [-1891.604] (-1894.166) * (-1899.269) [-1902.436] (-1895.427) (-1900.403) -- 0:01:56
608000 -- (-1899.260) (-1903.567) (-1898.928) [-1894.560] * (-1898.187) (-1892.881) [-1899.054] (-1901.020) -- 0:01:56
608500 -- [-1895.610] (-1901.427) (-1900.906) (-1892.143) * (-1899.266) (-1894.419) [-1892.010] (-1900.831) -- 0:01:55
609000 -- (-1903.071) (-1901.665) (-1899.803) [-1894.253] * (-1893.611) (-1900.218) (-1901.445) [-1893.265] -- 0:01:55
609500 -- (-1905.977) (-1897.060) (-1901.786) [-1895.992] * [-1899.524] (-1903.576) (-1893.652) (-1909.334) -- 0:01:55
610000 -- (-1900.390) [-1894.596] (-1897.328) (-1902.686) * [-1889.912] (-1895.254) (-1895.279) (-1895.689) -- 0:01:55
Average standard deviation of split frequencies: 0.001698
610500 -- (-1909.289) (-1903.290) [-1903.754] (-1893.069) * (-1892.731) (-1894.449) (-1902.037) [-1897.755] -- 0:01:55
611000 -- [-1898.541] (-1898.653) (-1901.733) (-1908.322) * [-1901.558] (-1897.605) (-1893.277) (-1904.933) -- 0:01:55
611500 -- (-1906.218) (-1895.639) (-1897.731) [-1898.848] * (-1903.175) (-1895.686) (-1896.369) [-1893.965] -- 0:01:54
612000 -- [-1894.879] (-1898.826) (-1900.314) (-1893.193) * (-1899.702) [-1902.095] (-1904.548) (-1901.808) -- 0:01:54
612500 -- (-1895.689) [-1894.752] (-1898.992) (-1903.524) * (-1905.112) [-1896.205] (-1899.333) (-1899.098) -- 0:01:54
613000 -- (-1907.588) (-1901.047) (-1890.199) [-1905.900] * (-1901.210) [-1898.793] (-1895.544) (-1898.212) -- 0:01:54
613500 -- [-1902.691] (-1900.638) (-1903.194) (-1903.737) * (-1901.026) (-1897.308) [-1897.534] (-1907.450) -- 0:01:54
614000 -- (-1900.979) [-1894.658] (-1893.340) (-1904.375) * (-1895.629) (-1891.549) [-1890.356] (-1899.469) -- 0:01:54
614500 -- (-1894.962) (-1898.398) [-1899.724] (-1902.720) * (-1899.573) (-1900.206) (-1902.927) [-1900.016] -- 0:01:54
615000 -- (-1899.031) [-1894.692] (-1897.775) (-1900.469) * [-1887.863] (-1900.888) (-1899.059) (-1898.957) -- 0:01:53
Average standard deviation of split frequencies: 0.001071
615500 -- (-1900.353) [-1896.468] (-1897.736) (-1911.010) * (-1900.544) [-1897.423] (-1900.358) (-1895.441) -- 0:01:53
616000 -- (-1912.538) [-1899.086] (-1897.838) (-1895.085) * (-1911.791) (-1900.639) (-1892.752) [-1899.283] -- 0:01:53
616500 -- (-1902.972) [-1891.938] (-1901.289) (-1896.375) * (-1912.127) (-1901.728) [-1897.574] (-1892.011) -- 0:01:53
617000 -- (-1901.594) [-1895.325] (-1901.063) (-1900.441) * (-1902.350) [-1896.880] (-1898.776) (-1892.214) -- 0:01:53
617500 -- (-1903.146) (-1893.744) (-1896.970) [-1891.395] * (-1902.354) (-1894.375) (-1893.382) [-1896.215] -- 0:01:53
618000 -- (-1899.298) (-1908.130) [-1893.474] (-1903.155) * (-1900.685) (-1898.952) [-1898.124] (-1901.407) -- 0:01:53
618500 -- (-1895.402) (-1898.881) (-1898.762) [-1896.893] * [-1892.720] (-1898.514) (-1891.211) (-1894.697) -- 0:01:52
619000 -- (-1902.247) (-1900.622) [-1903.833] (-1892.443) * (-1891.986) (-1898.402) [-1900.119] (-1891.123) -- 0:01:52
619500 -- (-1896.898) (-1901.576) (-1893.833) [-1900.401] * (-1894.861) (-1896.788) [-1895.971] (-1899.984) -- 0:01:52
620000 -- [-1898.117] (-1898.313) (-1895.554) (-1908.574) * (-1895.736) [-1898.207] (-1899.828) (-1905.913) -- 0:01:52
Average standard deviation of split frequencies: 0.001215
620500 -- (-1904.731) [-1891.951] (-1897.205) (-1898.867) * (-1894.913) (-1896.131) (-1902.766) [-1901.647] -- 0:01:52
621000 -- [-1907.187] (-1896.244) (-1897.701) (-1904.359) * (-1896.523) [-1895.232] (-1903.867) (-1897.190) -- 0:01:52
621500 -- (-1902.735) (-1898.197) [-1892.807] (-1901.870) * [-1897.503] (-1901.448) (-1909.412) (-1903.994) -- 0:01:52
622000 -- (-1899.447) (-1895.965) (-1895.249) [-1902.584] * (-1894.915) [-1901.151] (-1901.374) (-1898.374) -- 0:01:51
622500 -- (-1901.554) [-1896.289] (-1900.177) (-1898.698) * (-1897.897) (-1898.897) [-1897.461] (-1895.589) -- 0:01:51
623000 -- (-1899.299) (-1895.218) [-1901.207] (-1906.111) * (-1897.985) [-1898.757] (-1895.266) (-1906.790) -- 0:01:51
623500 -- (-1900.885) (-1894.308) [-1898.479] (-1897.854) * (-1900.131) (-1898.762) (-1899.049) [-1899.057] -- 0:01:51
624000 -- (-1893.304) [-1909.357] (-1893.404) (-1904.753) * (-1903.700) (-1904.053) [-1891.248] (-1899.956) -- 0:01:51
624500 -- (-1898.003) (-1902.851) (-1895.799) [-1896.047] * (-1905.580) [-1894.741] (-1902.633) (-1912.058) -- 0:01:51
625000 -- (-1896.924) [-1900.998] (-1905.066) (-1903.929) * (-1905.837) [-1901.277] (-1910.025) (-1903.117) -- 0:01:51
Average standard deviation of split frequencies: 0.000452
625500 -- (-1907.085) (-1898.096) [-1906.828] (-1899.543) * (-1898.951) [-1899.339] (-1903.433) (-1894.192) -- 0:01:50
626000 -- (-1893.090) (-1901.288) (-1906.563) [-1905.121] * (-1899.135) (-1893.825) [-1899.368] (-1900.451) -- 0:01:50
626500 -- (-1891.942) (-1905.124) [-1893.370] (-1901.045) * [-1897.800] (-1912.205) (-1894.300) (-1906.556) -- 0:01:50
627000 -- (-1898.209) (-1901.864) (-1900.964) [-1902.325] * [-1892.403] (-1897.143) (-1895.120) (-1899.806) -- 0:01:50
627500 -- (-1897.439) [-1895.790] (-1897.276) (-1897.395) * (-1900.364) [-1895.206] (-1905.485) (-1898.918) -- 0:01:50
628000 -- (-1899.473) (-1898.563) (-1896.039) [-1900.510] * [-1892.987] (-1901.118) (-1898.679) (-1900.119) -- 0:01:50
628500 -- [-1896.757] (-1905.211) (-1894.709) (-1899.692) * (-1895.560) [-1897.342] (-1905.952) (-1892.245) -- 0:01:49
629000 -- (-1898.689) (-1906.076) (-1907.741) [-1899.545] * [-1893.381] (-1896.139) (-1899.624) (-1901.878) -- 0:01:49
629500 -- (-1898.089) [-1894.596] (-1907.411) (-1900.514) * [-1896.581] (-1892.665) (-1898.338) (-1900.481) -- 0:01:49
630000 -- (-1899.020) (-1897.543) (-1907.181) [-1902.151] * [-1890.453] (-1908.675) (-1902.941) (-1890.826) -- 0:01:49
Average standard deviation of split frequencies: 0.000747
630500 -- [-1900.800] (-1895.698) (-1903.309) (-1898.348) * (-1892.208) (-1897.782) (-1897.419) [-1894.971] -- 0:01:49
631000 -- [-1903.017] (-1900.134) (-1892.956) (-1900.647) * (-1900.434) (-1908.183) [-1891.912] (-1898.692) -- 0:01:49
631500 -- [-1897.762] (-1897.682) (-1903.316) (-1899.452) * (-1898.477) (-1896.029) (-1903.447) [-1899.011] -- 0:01:49
632000 -- (-1898.699) (-1903.651) [-1898.225] (-1900.300) * (-1903.710) [-1893.534] (-1900.100) (-1898.877) -- 0:01:48
632500 -- (-1899.676) [-1893.331] (-1900.325) (-1906.427) * (-1896.274) (-1898.996) (-1906.682) [-1896.345] -- 0:01:48
633000 -- (-1890.448) (-1891.161) [-1894.750] (-1907.818) * (-1902.495) (-1905.455) (-1906.553) [-1895.604] -- 0:01:48
633500 -- (-1895.910) (-1899.906) (-1904.874) [-1897.128] * (-1894.132) (-1906.833) [-1895.594] (-1901.441) -- 0:01:48
634000 -- (-1900.357) [-1897.807] (-1901.673) (-1896.997) * [-1896.611] (-1902.579) (-1899.998) (-1896.623) -- 0:01:48
634500 -- (-1899.641) (-1894.494) [-1901.485] (-1893.852) * [-1895.479] (-1897.957) (-1904.005) (-1899.451) -- 0:01:48
635000 -- (-1898.646) (-1901.282) [-1899.849] (-1900.371) * (-1895.905) (-1901.843) [-1901.492] (-1892.774) -- 0:01:48
Average standard deviation of split frequencies: 0.001038
635500 -- [-1897.339] (-1891.830) (-1903.856) (-1908.268) * (-1899.066) (-1900.689) [-1899.707] (-1892.518) -- 0:01:47
636000 -- (-1898.993) (-1906.355) [-1894.288] (-1899.534) * (-1900.102) (-1900.587) (-1903.374) [-1894.063] -- 0:01:47
636500 -- [-1899.461] (-1904.254) (-1897.917) (-1905.066) * (-1894.878) [-1903.891] (-1901.594) (-1897.046) -- 0:01:47
637000 -- (-1894.711) (-1902.201) (-1896.327) [-1900.579] * [-1890.092] (-1905.040) (-1899.238) (-1904.573) -- 0:01:47
637500 -- [-1894.207] (-1898.319) (-1895.117) (-1903.293) * [-1895.472] (-1895.568) (-1898.233) (-1899.291) -- 0:01:47
638000 -- [-1889.352] (-1900.341) (-1891.982) (-1910.412) * [-1895.286] (-1890.198) (-1898.217) (-1900.863) -- 0:01:47
638500 -- (-1908.759) [-1899.573] (-1900.198) (-1898.349) * [-1898.016] (-1896.841) (-1898.510) (-1893.865) -- 0:01:47
639000 -- (-1900.373) (-1902.696) (-1903.961) [-1902.277] * (-1899.368) [-1898.154] (-1899.771) (-1898.921) -- 0:01:46
639500 -- [-1902.033] (-1893.641) (-1902.098) (-1906.811) * (-1900.730) (-1899.416) [-1894.714] (-1902.565) -- 0:01:46
640000 -- (-1900.826) [-1896.132] (-1902.657) (-1897.454) * (-1894.435) (-1912.902) (-1895.411) [-1898.448] -- 0:01:46
Average standard deviation of split frequencies: 0.001177
640500 -- (-1896.843) (-1903.969) (-1902.695) [-1899.349] * (-1897.359) (-1896.946) [-1896.882] (-1900.966) -- 0:01:46
641000 -- (-1895.704) [-1894.321] (-1899.500) (-1900.159) * (-1898.518) (-1893.567) (-1907.678) [-1901.713] -- 0:01:46
641500 -- [-1890.413] (-1899.480) (-1899.005) (-1903.457) * (-1903.863) [-1903.094] (-1902.198) (-1889.469) -- 0:01:46
642000 -- (-1895.935) (-1899.785) (-1896.930) [-1891.127] * (-1901.749) (-1895.904) (-1891.500) [-1890.882] -- 0:01:45
642500 -- [-1893.685] (-1901.059) (-1908.869) (-1896.809) * (-1904.611) (-1900.349) [-1902.638] (-1907.441) -- 0:01:45
643000 -- (-1897.339) [-1894.542] (-1905.057) (-1899.089) * (-1893.909) (-1908.420) (-1897.524) [-1893.022] -- 0:01:45
643500 -- (-1901.898) (-1897.417) (-1896.176) [-1901.401] * [-1900.253] (-1900.439) (-1904.965) (-1902.830) -- 0:01:45
644000 -- (-1901.088) (-1900.978) (-1898.196) [-1902.136] * [-1897.494] (-1902.548) (-1904.269) (-1901.798) -- 0:01:45
644500 -- (-1900.041) [-1894.236] (-1898.856) (-1901.419) * (-1895.739) (-1903.611) [-1896.199] (-1897.906) -- 0:01:45
645000 -- (-1902.574) [-1891.285] (-1905.581) (-1905.046) * [-1891.265] (-1898.528) (-1896.952) (-1898.507) -- 0:01:45
Average standard deviation of split frequencies: 0.001459
645500 -- (-1896.408) (-1900.999) [-1902.881] (-1899.688) * [-1893.824] (-1897.751) (-1898.024) (-1903.028) -- 0:01:44
646000 -- [-1896.585] (-1905.952) (-1900.032) (-1900.941) * (-1904.546) (-1898.402) (-1892.351) [-1897.100] -- 0:01:44
646500 -- (-1899.564) (-1904.973) [-1897.346] (-1891.454) * (-1896.890) [-1899.524] (-1890.112) (-1894.620) -- 0:01:44
647000 -- (-1895.967) (-1905.040) (-1899.463) [-1895.357] * [-1889.957] (-1899.319) (-1898.592) (-1897.432) -- 0:01:44
647500 -- (-1897.277) (-1897.061) [-1895.686] (-1896.028) * [-1895.302] (-1900.660) (-1904.344) (-1907.241) -- 0:01:44
648000 -- (-1899.243) [-1894.073] (-1898.812) (-1904.825) * (-1900.520) (-1896.337) [-1897.236] (-1895.333) -- 0:01:44
648500 -- (-1893.912) (-1903.256) [-1895.216] (-1897.395) * (-1898.729) (-1898.216) [-1895.750] (-1904.677) -- 0:01:44
649000 -- (-1903.871) (-1895.775) (-1898.254) [-1901.196] * (-1896.639) (-1895.443) (-1905.701) [-1892.661] -- 0:01:43
649500 -- (-1904.297) (-1900.194) [-1910.360] (-1907.116) * [-1893.777] (-1899.190) (-1905.219) (-1900.761) -- 0:01:43
650000 -- (-1900.091) [-1892.969] (-1899.330) (-1912.556) * (-1900.008) (-1898.137) [-1892.601] (-1898.557) -- 0:01:43
Average standard deviation of split frequencies: 0.001304
650500 -- [-1899.091] (-1902.077) (-1903.941) (-1897.621) * (-1900.014) [-1903.074] (-1894.335) (-1899.387) -- 0:01:43
651000 -- (-1901.352) (-1907.119) [-1903.451] (-1894.751) * (-1903.449) (-1905.277) [-1894.172] (-1900.259) -- 0:01:43
651500 -- (-1896.747) (-1905.384) (-1905.407) [-1892.365] * (-1899.421) [-1893.750] (-1893.801) (-1901.882) -- 0:01:43
652000 -- (-1892.610) [-1901.517] (-1901.875) (-1903.271) * (-1900.397) (-1903.989) (-1905.158) [-1901.317] -- 0:01:43
652500 -- (-1899.050) (-1900.120) (-1903.691) [-1900.233] * (-1902.208) [-1894.764] (-1899.361) (-1895.341) -- 0:01:42
653000 -- (-1895.167) (-1903.580) [-1893.661] (-1900.340) * (-1904.775) [-1901.741] (-1902.120) (-1895.755) -- 0:01:42
653500 -- (-1900.340) [-1901.749] (-1898.302) (-1896.476) * (-1901.392) [-1894.050] (-1897.808) (-1898.450) -- 0:01:42
654000 -- (-1891.716) (-1896.450) [-1897.078] (-1898.869) * [-1899.143] (-1895.814) (-1893.588) (-1897.480) -- 0:01:42
654500 -- (-1900.244) [-1899.032] (-1896.172) (-1903.026) * (-1893.906) (-1897.318) (-1893.907) [-1898.529] -- 0:01:42
655000 -- [-1894.989] (-1896.487) (-1904.389) (-1915.780) * (-1897.668) (-1892.011) [-1893.465] (-1899.437) -- 0:01:42
Average standard deviation of split frequencies: 0.001150
655500 -- (-1903.487) [-1894.800] (-1905.166) (-1905.866) * (-1897.976) [-1898.199] (-1895.700) (-1903.697) -- 0:01:41
656000 -- (-1900.537) (-1897.564) [-1896.029] (-1898.637) * (-1900.366) (-1899.913) (-1902.547) [-1905.013] -- 0:01:41
656500 -- (-1896.578) (-1906.678) (-1898.288) [-1900.596] * [-1889.008] (-1903.934) (-1898.781) (-1894.305) -- 0:01:41
657000 -- (-1894.180) [-1898.796] (-1893.435) (-1896.773) * [-1892.627] (-1908.183) (-1895.264) (-1905.198) -- 0:01:41
657500 -- (-1896.912) (-1895.376) (-1899.245) [-1897.701] * (-1897.744) (-1903.973) (-1900.788) [-1894.115] -- 0:01:41
658000 -- (-1894.126) (-1901.034) (-1901.144) [-1890.427] * (-1896.014) [-1898.497] (-1897.420) (-1892.924) -- 0:01:41
658500 -- (-1905.633) (-1898.703) (-1899.178) [-1901.086] * (-1893.666) (-1906.448) (-1900.247) [-1896.231] -- 0:01:41
659000 -- (-1900.310) (-1903.908) [-1897.804] (-1898.130) * (-1906.461) (-1898.302) [-1896.658] (-1895.535) -- 0:01:40
659500 -- (-1899.693) [-1904.159] (-1902.500) (-1900.524) * (-1895.101) (-1904.557) (-1906.747) [-1894.759] -- 0:01:40
660000 -- [-1895.446] (-1902.924) (-1906.903) (-1898.233) * (-1897.914) (-1900.315) (-1898.846) [-1895.458] -- 0:01:40
Average standard deviation of split frequencies: 0.000999
660500 -- [-1900.233] (-1896.350) (-1912.239) (-1899.505) * (-1905.277) (-1900.467) (-1900.508) [-1896.988] -- 0:01:40
661000 -- (-1903.140) (-1888.809) (-1896.066) [-1896.176] * (-1901.028) (-1905.268) [-1899.877] (-1891.475) -- 0:01:40
661500 -- (-1896.571) (-1891.499) (-1893.935) [-1897.634] * (-1898.836) (-1894.747) (-1898.402) [-1894.942] -- 0:01:40
662000 -- (-1908.889) (-1898.637) (-1901.699) [-1896.624] * (-1900.291) [-1896.492] (-1897.971) (-1896.220) -- 0:01:40
662500 -- (-1902.497) (-1893.083) [-1895.570] (-1899.135) * (-1899.501) (-1897.163) [-1899.955] (-1895.156) -- 0:01:39
663000 -- (-1903.195) (-1896.215) [-1894.717] (-1898.456) * (-1900.835) (-1900.674) (-1901.928) [-1894.963] -- 0:01:39
663500 -- (-1907.727) (-1901.734) (-1897.779) [-1899.690] * (-1899.047) (-1903.192) (-1903.767) [-1899.699] -- 0:01:39
664000 -- (-1894.138) [-1896.851] (-1906.691) (-1899.812) * [-1894.261] (-1897.220) (-1898.899) (-1898.554) -- 0:01:39
664500 -- (-1906.820) [-1900.902] (-1904.227) (-1899.084) * (-1896.223) [-1898.509] (-1897.963) (-1911.975) -- 0:01:39
665000 -- [-1907.381] (-1906.663) (-1903.160) (-1907.434) * (-1895.323) (-1898.511) (-1905.634) [-1897.858] -- 0:01:39
Average standard deviation of split frequencies: 0.001133
665500 -- [-1893.202] (-1900.315) (-1895.120) (-1909.553) * (-1906.653) (-1901.766) (-1898.480) [-1894.971] -- 0:01:39
666000 -- (-1896.204) (-1895.292) [-1896.950] (-1903.323) * [-1897.450] (-1892.932) (-1892.818) (-1897.443) -- 0:01:38
666500 -- (-1898.966) (-1909.991) [-1899.616] (-1905.495) * (-1907.464) [-1892.498] (-1895.579) (-1904.348) -- 0:01:38
667000 -- (-1896.073) (-1913.317) [-1900.875] (-1896.444) * [-1907.481] (-1897.643) (-1896.062) (-1902.330) -- 0:01:38
667500 -- (-1898.349) [-1895.689] (-1899.852) (-1898.184) * [-1895.665] (-1897.253) (-1894.077) (-1901.257) -- 0:01:38
668000 -- (-1900.150) (-1897.329) (-1895.314) [-1897.802] * (-1901.515) [-1897.307] (-1893.398) (-1895.009) -- 0:01:38
668500 -- (-1894.328) (-1899.251) [-1893.050] (-1894.492) * (-1906.342) [-1894.814] (-1893.160) (-1895.586) -- 0:01:38
669000 -- (-1893.842) (-1902.281) [-1894.726] (-1899.881) * (-1898.300) (-1902.018) [-1890.085] (-1899.690) -- 0:01:37
669500 -- (-1905.725) [-1893.337] (-1897.314) (-1894.777) * (-1899.247) [-1896.419] (-1900.489) (-1906.919) -- 0:01:37
670000 -- [-1897.966] (-1898.427) (-1895.585) (-1908.161) * (-1892.485) (-1898.452) (-1900.096) [-1894.386] -- 0:01:37
Average standard deviation of split frequencies: 0.000843
670500 -- (-1902.841) (-1904.048) (-1898.887) [-1895.842] * (-1899.489) (-1901.218) [-1895.482] (-1898.894) -- 0:01:37
671000 -- (-1900.957) (-1903.569) (-1896.144) [-1891.640] * (-1897.834) (-1900.603) [-1900.384] (-1898.494) -- 0:01:37
671500 -- (-1900.737) (-1898.374) [-1893.437] (-1896.527) * (-1906.413) (-1893.020) [-1897.542] (-1902.099) -- 0:01:37
672000 -- (-1904.534) (-1903.951) (-1898.475) [-1897.919] * (-1896.333) [-1899.844] (-1903.923) (-1896.390) -- 0:01:37
672500 -- (-1894.845) (-1907.535) (-1907.460) [-1897.295] * (-1902.573) [-1898.157] (-1906.207) (-1897.602) -- 0:01:36
673000 -- (-1899.022) (-1901.617) (-1901.816) [-1892.974] * [-1899.593] (-1894.906) (-1901.379) (-1903.127) -- 0:01:36
673500 -- (-1892.104) [-1894.494] (-1905.393) (-1896.704) * [-1898.248] (-1910.660) (-1899.449) (-1911.633) -- 0:01:36
674000 -- [-1902.799] (-1908.283) (-1897.528) (-1903.951) * (-1894.750) (-1914.635) [-1892.410] (-1917.821) -- 0:01:36
674500 -- (-1898.694) (-1893.175) [-1894.669] (-1902.193) * [-1892.571] (-1902.818) (-1904.625) (-1901.733) -- 0:01:36
675000 -- (-1905.345) [-1898.078] (-1896.913) (-1895.792) * (-1903.201) [-1897.091] (-1899.935) (-1900.703) -- 0:01:36
Average standard deviation of split frequencies: 0.001116
675500 -- (-1902.338) [-1894.712] (-1904.714) (-1902.449) * [-1894.890] (-1896.376) (-1900.161) (-1897.151) -- 0:01:36
676000 -- (-1915.958) (-1896.184) [-1897.633] (-1903.508) * (-1893.840) (-1903.314) [-1897.888] (-1908.514) -- 0:01:35
676500 -- (-1898.521) (-1899.005) (-1891.558) [-1892.972] * (-1909.783) [-1898.009] (-1903.955) (-1894.275) -- 0:01:35
677000 -- [-1899.664] (-1898.697) (-1894.583) (-1894.448) * (-1902.970) [-1902.181] (-1903.423) (-1902.398) -- 0:01:35
677500 -- [-1905.437] (-1899.401) (-1901.319) (-1898.202) * (-1892.361) (-1900.393) [-1902.534] (-1905.995) -- 0:01:35
678000 -- (-1903.416) (-1900.689) [-1894.882] (-1902.062) * [-1896.954] (-1900.604) (-1904.296) (-1896.919) -- 0:01:35
678500 -- (-1901.790) [-1900.787] (-1907.453) (-1898.065) * (-1905.880) (-1906.259) [-1897.548] (-1896.760) -- 0:01:35
679000 -- (-1902.375) [-1893.275] (-1903.587) (-1904.835) * (-1898.866) (-1898.293) [-1898.164] (-1895.390) -- 0:01:35
679500 -- (-1899.163) (-1897.836) [-1901.150] (-1901.577) * (-1898.888) [-1895.693] (-1901.587) (-1898.352) -- 0:01:34
680000 -- (-1903.518) (-1899.799) [-1894.005] (-1898.616) * (-1898.721) [-1899.282] (-1897.460) (-1895.796) -- 0:01:34
Average standard deviation of split frequencies: 0.001108
680500 -- (-1907.529) (-1904.485) [-1897.981] (-1899.877) * (-1895.065) (-1904.679) [-1890.733] (-1897.518) -- 0:01:34
681000 -- (-1896.935) (-1919.117) [-1899.715] (-1896.062) * (-1899.315) (-1908.335) (-1896.813) [-1895.536] -- 0:01:34
681500 -- [-1899.683] (-1902.523) (-1895.805) (-1893.221) * (-1901.956) (-1894.892) [-1895.746] (-1901.151) -- 0:01:34
682000 -- (-1899.413) (-1892.687) [-1893.876] (-1899.084) * (-1895.956) (-1892.730) (-1896.737) [-1895.565] -- 0:01:34
682500 -- (-1906.586) (-1909.905) (-1893.413) [-1895.995] * [-1899.869] (-1894.577) (-1898.464) (-1904.167) -- 0:01:33
683000 -- (-1895.258) [-1893.069] (-1893.356) (-1902.986) * [-1907.480] (-1897.586) (-1904.779) (-1902.349) -- 0:01:33
683500 -- (-1902.555) [-1901.159] (-1897.383) (-1898.345) * (-1896.763) (-1900.665) [-1897.901] (-1898.788) -- 0:01:33
684000 -- [-1901.543] (-1896.330) (-1905.635) (-1896.567) * (-1893.980) (-1899.393) [-1896.975] (-1897.241) -- 0:01:33
684500 -- (-1897.644) (-1898.853) (-1902.197) [-1896.536] * [-1901.881] (-1905.691) (-1891.573) (-1895.199) -- 0:01:33
685000 -- [-1893.226] (-1899.817) (-1907.216) (-1894.920) * (-1894.434) [-1902.659] (-1895.469) (-1904.226) -- 0:01:33
Average standard deviation of split frequencies: 0.000825
685500 -- (-1900.752) (-1901.726) (-1895.602) [-1901.051] * [-1896.477] (-1897.387) (-1897.616) (-1902.985) -- 0:01:33
686000 -- (-1896.072) [-1893.511] (-1904.712) (-1903.379) * [-1892.830] (-1906.852) (-1897.905) (-1895.101) -- 0:01:32
686500 -- (-1894.896) (-1904.006) [-1901.650] (-1895.791) * (-1902.776) (-1904.471) [-1900.487] (-1899.719) -- 0:01:32
687000 -- (-1898.111) [-1896.281] (-1902.371) (-1905.338) * (-1894.812) [-1895.727] (-1893.070) (-1897.294) -- 0:01:32
687500 -- (-1899.404) (-1903.165) [-1897.754] (-1894.160) * (-1889.034) (-1900.234) [-1902.935] (-1897.869) -- 0:01:32
688000 -- (-1897.664) (-1904.255) (-1890.003) [-1900.721] * (-1897.129) [-1904.151] (-1898.073) (-1896.668) -- 0:01:32
688500 -- (-1902.226) (-1893.228) (-1901.702) [-1890.984] * (-1907.593) (-1894.892) (-1897.697) [-1895.469] -- 0:01:32
689000 -- (-1891.717) [-1896.670] (-1898.567) (-1893.654) * (-1902.934) (-1895.334) [-1902.575] (-1899.372) -- 0:01:32
689500 -- [-1902.658] (-1902.970) (-1895.599) (-1895.178) * (-1907.623) [-1900.703] (-1893.019) (-1908.259) -- 0:01:31
690000 -- (-1894.875) (-1893.380) (-1895.503) [-1899.639] * (-1910.319) [-1894.112] (-1891.898) (-1904.346) -- 0:01:31
Average standard deviation of split frequencies: 0.001365
690500 -- (-1900.099) (-1901.380) (-1902.630) [-1892.423] * (-1906.344) (-1896.935) [-1894.012] (-1895.645) -- 0:01:31
691000 -- [-1897.213] (-1905.926) (-1903.999) (-1895.092) * [-1896.029] (-1890.793) (-1893.310) (-1897.289) -- 0:01:31
691500 -- [-1904.272] (-1902.769) (-1897.371) (-1896.521) * (-1903.998) (-1894.191) (-1899.892) [-1892.820] -- 0:01:31
692000 -- (-1912.270) (-1901.964) (-1902.098) [-1898.298] * (-1903.703) [-1898.489] (-1894.652) (-1901.308) -- 0:01:31
692500 -- (-1901.724) [-1896.524] (-1897.877) (-1904.353) * (-1907.674) [-1893.169] (-1896.378) (-1896.967) -- 0:01:31
693000 -- (-1901.980) (-1910.397) [-1894.263] (-1900.770) * (-1901.201) (-1892.613) (-1903.176) [-1902.486] -- 0:01:30
693500 -- (-1896.413) (-1908.935) (-1895.059) [-1901.803] * (-1895.360) [-1904.643] (-1903.203) (-1901.440) -- 0:01:30
694000 -- (-1900.405) (-1902.954) [-1893.703] (-1901.913) * (-1896.813) [-1896.639] (-1897.310) (-1898.126) -- 0:01:30
694500 -- (-1900.506) (-1905.111) [-1897.505] (-1903.411) * (-1894.563) [-1894.763] (-1904.657) (-1904.720) -- 0:01:30
695000 -- (-1893.545) [-1896.212] (-1897.917) (-1906.801) * [-1892.218] (-1896.327) (-1898.836) (-1900.878) -- 0:01:30
Average standard deviation of split frequencies: 0.001761
695500 -- (-1902.383) [-1894.497] (-1899.280) (-1898.349) * [-1898.165] (-1897.098) (-1913.249) (-1898.741) -- 0:01:30
696000 -- [-1894.045] (-1912.971) (-1897.657) (-1895.563) * [-1895.372] (-1893.205) (-1899.270) (-1901.230) -- 0:01:29
696500 -- (-1902.964) (-1907.424) (-1894.569) [-1891.410] * (-1901.048) (-1902.723) (-1901.604) [-1890.910] -- 0:01:29
697000 -- (-1907.452) [-1902.081] (-1905.665) (-1909.345) * (-1916.969) [-1891.508] (-1904.198) (-1896.511) -- 0:01:29
697500 -- (-1903.653) (-1894.301) (-1895.227) [-1890.906] * (-1895.426) (-1900.974) (-1902.921) [-1893.851] -- 0:01:29
698000 -- (-1895.516) (-1895.899) [-1897.570] (-1893.494) * (-1905.178) (-1899.903) (-1902.675) [-1898.819] -- 0:01:29
698500 -- (-1904.758) [-1899.383] (-1902.785) (-1894.269) * (-1901.743) (-1896.793) (-1899.179) [-1903.244] -- 0:01:29
699000 -- (-1900.831) [-1892.100] (-1898.127) (-1899.908) * (-1898.731) [-1898.096] (-1907.600) (-1893.439) -- 0:01:29
699500 -- (-1898.015) (-1907.080) (-1906.778) [-1895.576] * (-1894.144) (-1900.008) [-1895.755] (-1903.277) -- 0:01:28
700000 -- (-1900.240) (-1892.442) [-1893.233] (-1893.649) * (-1900.103) [-1902.646] (-1900.543) (-1901.758) -- 0:01:28
Average standard deviation of split frequencies: 0.002288
700500 -- [-1895.739] (-1896.873) (-1899.067) (-1899.264) * (-1902.532) (-1896.832) (-1899.277) [-1903.370] -- 0:01:28
701000 -- (-1904.206) [-1896.715] (-1898.113) (-1904.281) * (-1899.109) (-1899.168) [-1895.349] (-1900.754) -- 0:01:28
701500 -- (-1896.586) (-1893.167) (-1901.991) [-1897.392] * [-1901.766] (-1907.568) (-1904.581) (-1900.659) -- 0:01:28
702000 -- [-1900.881] (-1900.715) (-1899.646) (-1906.163) * [-1892.312] (-1895.282) (-1899.580) (-1900.206) -- 0:01:28
702500 -- (-1896.089) [-1894.018] (-1908.042) (-1898.597) * [-1894.526] (-1897.601) (-1898.159) (-1897.324) -- 0:01:28
703000 -- (-1902.890) (-1903.630) [-1894.544] (-1902.592) * (-1905.099) (-1902.419) (-1897.744) [-1894.120] -- 0:01:27
703500 -- [-1898.216] (-1893.730) (-1900.620) (-1892.104) * [-1897.972] (-1899.233) (-1900.652) (-1893.023) -- 0:01:27
704000 -- (-1899.137) (-1896.529) (-1915.482) [-1892.130] * [-1893.284] (-1908.172) (-1895.457) (-1901.319) -- 0:01:27
704500 -- [-1895.666] (-1905.722) (-1904.469) (-1900.484) * [-1892.899] (-1904.370) (-1895.332) (-1896.535) -- 0:01:27
705000 -- (-1905.441) [-1892.525] (-1900.059) (-1899.178) * (-1897.535) [-1895.616] (-1895.178) (-1904.595) -- 0:01:27
Average standard deviation of split frequencies: 0.002537
705500 -- (-1899.601) (-1903.603) [-1896.734] (-1901.931) * [-1892.782] (-1905.982) (-1908.515) (-1903.582) -- 0:01:27
706000 -- [-1895.259] (-1895.768) (-1901.798) (-1910.296) * (-1896.974) (-1899.195) (-1898.828) [-1899.913] -- 0:01:27
706500 -- (-1906.438) [-1905.617] (-1898.953) (-1909.528) * (-1899.011) (-1893.631) (-1905.445) [-1897.066] -- 0:01:26
707000 -- (-1892.096) (-1909.964) (-1897.988) [-1897.722] * (-1895.615) (-1895.548) [-1897.374] (-1888.232) -- 0:01:26
707500 -- (-1907.687) (-1895.115) [-1897.284] (-1897.010) * (-1905.077) (-1902.195) [-1898.171] (-1896.212) -- 0:01:26
708000 -- (-1900.584) (-1896.338) (-1894.651) [-1895.442] * [-1902.249] (-1903.945) (-1898.142) (-1897.109) -- 0:01:26
708500 -- (-1900.159) (-1897.588) (-1893.112) [-1896.126] * [-1892.789] (-1905.195) (-1897.606) (-1896.161) -- 0:01:26
709000 -- (-1900.295) (-1894.093) (-1893.961) [-1897.879] * (-1900.121) (-1896.972) [-1890.547] (-1898.722) -- 0:01:26
709500 -- (-1894.581) (-1897.788) [-1905.433] (-1904.819) * (-1893.361) (-1903.537) [-1898.946] (-1900.241) -- 0:01:25
710000 -- (-1901.690) (-1896.739) [-1904.695] (-1895.811) * (-1897.410) (-1901.862) [-1894.045] (-1901.350) -- 0:01:25
Average standard deviation of split frequencies: 0.002653
710500 -- (-1898.465) (-1897.524) (-1900.908) [-1896.511] * (-1897.857) [-1898.342] (-1898.154) (-1900.576) -- 0:01:25
711000 -- (-1895.330) [-1900.047] (-1892.283) (-1897.063) * [-1906.098] (-1899.082) (-1901.936) (-1893.651) -- 0:01:25
711500 -- (-1899.968) (-1908.636) (-1891.717) [-1894.598] * (-1899.997) (-1893.670) (-1897.930) [-1891.633] -- 0:01:25
712000 -- (-1894.798) (-1909.732) (-1896.139) [-1894.864] * (-1896.850) [-1901.486] (-1896.451) (-1894.500) -- 0:01:25
712500 -- (-1910.638) (-1893.467) (-1896.006) [-1895.200] * (-1901.977) (-1896.011) (-1902.096) [-1904.503] -- 0:01:25
713000 -- [-1891.267] (-1896.411) (-1895.178) (-1904.582) * (-1906.203) (-1895.689) [-1897.320] (-1899.157) -- 0:01:24
713500 -- (-1896.384) [-1894.704] (-1898.008) (-1899.566) * (-1902.502) (-1899.427) (-1902.856) [-1889.486] -- 0:01:24
714000 -- (-1894.448) (-1908.597) (-1896.260) [-1893.488] * [-1900.419] (-1899.241) (-1903.072) (-1895.651) -- 0:01:24
714500 -- (-1893.927) (-1896.127) [-1899.229] (-1894.595) * (-1899.606) (-1895.946) (-1907.932) [-1892.246] -- 0:01:24
715000 -- [-1898.423] (-1894.665) (-1904.483) (-1897.829) * [-1902.938] (-1900.008) (-1900.258) (-1894.390) -- 0:01:24
Average standard deviation of split frequencies: 0.002502
715500 -- (-1896.636) (-1897.234) (-1900.741) [-1894.370] * [-1903.138] (-1899.357) (-1904.617) (-1904.293) -- 0:01:24
716000 -- (-1893.237) (-1898.135) (-1900.329) [-1895.897] * (-1896.631) [-1892.572] (-1897.805) (-1895.682) -- 0:01:24
716500 -- (-1897.298) (-1903.351) [-1897.111] (-1894.034) * (-1895.748) (-1905.637) [-1898.301] (-1901.656) -- 0:01:23
717000 -- (-1902.376) (-1902.734) (-1900.011) [-1891.023] * [-1895.213] (-1902.362) (-1890.448) (-1902.082) -- 0:01:23
717500 -- (-1900.328) (-1899.832) [-1895.231] (-1894.307) * [-1903.577] (-1895.065) (-1900.626) (-1908.354) -- 0:01:23
718000 -- (-1901.289) [-1895.856] (-1897.316) (-1897.409) * (-1899.637) [-1895.760] (-1898.180) (-1899.495) -- 0:01:23
718500 -- [-1897.827] (-1903.291) (-1899.746) (-1899.369) * [-1893.558] (-1901.755) (-1896.556) (-1894.085) -- 0:01:23
719000 -- (-1897.649) (-1906.022) [-1895.930] (-1904.985) * [-1897.717] (-1895.291) (-1907.350) (-1901.329) -- 0:01:23
719500 -- (-1906.522) (-1900.427) [-1897.006] (-1899.431) * (-1903.820) [-1893.564] (-1901.419) (-1898.232) -- 0:01:23
720000 -- (-1900.607) (-1901.201) [-1898.686] (-1899.378) * (-1898.899) (-1898.930) (-1898.663) [-1897.924] -- 0:01:22
Average standard deviation of split frequencies: 0.003009
720500 -- (-1913.860) (-1896.084) [-1899.638] (-1907.850) * (-1900.664) (-1912.254) (-1900.278) [-1891.517] -- 0:01:22
721000 -- (-1902.436) (-1901.080) (-1914.632) [-1897.070] * (-1900.422) (-1894.115) (-1898.429) [-1890.274] -- 0:01:22
721500 -- (-1899.824) (-1905.364) (-1906.762) [-1898.615] * (-1907.781) (-1906.581) (-1898.206) [-1896.849] -- 0:01:22
722000 -- (-1900.944) (-1907.759) (-1902.436) [-1893.897] * (-1897.643) (-1899.087) [-1895.779] (-1896.105) -- 0:01:22
722500 -- (-1889.316) (-1895.249) [-1899.116] (-1894.982) * (-1898.264) (-1905.981) (-1899.280) [-1897.653] -- 0:01:22
723000 -- [-1892.090] (-1898.579) (-1904.418) (-1892.597) * (-1900.008) (-1904.717) [-1892.415] (-1897.703) -- 0:01:21
723500 -- [-1897.231] (-1892.808) (-1903.874) (-1897.567) * (-1906.657) (-1909.770) (-1895.502) [-1899.187] -- 0:01:21
724000 -- [-1898.838] (-1892.565) (-1900.251) (-1900.440) * (-1898.338) (-1901.711) (-1901.501) [-1895.492] -- 0:01:21
724500 -- [-1905.912] (-1898.873) (-1894.065) (-1898.872) * [-1895.430] (-1903.403) (-1898.825) (-1888.090) -- 0:01:21
725000 -- (-1899.861) [-1898.149] (-1894.593) (-1897.053) * (-1908.032) (-1902.129) [-1894.096] (-1898.312) -- 0:01:21
Average standard deviation of split frequencies: 0.002467
725500 -- (-1896.964) (-1890.154) (-1899.099) [-1893.739] * [-1891.356] (-1894.901) (-1899.817) (-1890.687) -- 0:01:21
726000 -- (-1897.135) [-1897.813] (-1903.000) (-1894.318) * (-1900.065) (-1909.579) (-1901.486) [-1893.643] -- 0:01:21
726500 -- [-1895.038] (-1896.086) (-1896.086) (-1898.871) * (-1896.901) (-1910.414) (-1901.500) [-1895.252] -- 0:01:20
727000 -- (-1901.227) (-1901.239) [-1891.556] (-1893.949) * (-1905.333) (-1907.120) (-1901.859) [-1894.584] -- 0:01:20
727500 -- [-1899.184] (-1893.112) (-1897.290) (-1895.867) * (-1898.247) [-1898.530] (-1899.987) (-1896.731) -- 0:01:20
728000 -- (-1898.901) [-1897.987] (-1904.831) (-1907.986) * (-1904.188) [-1893.011] (-1905.896) (-1900.514) -- 0:01:20
728500 -- [-1890.795] (-1899.980) (-1895.347) (-1900.031) * (-1897.552) (-1894.129) [-1896.358] (-1891.492) -- 0:01:20
729000 -- (-1899.708) (-1900.949) [-1896.168] (-1895.736) * (-1902.883) (-1896.265) [-1894.797] (-1896.796) -- 0:01:20
729500 -- (-1903.567) [-1902.132] (-1899.777) (-1898.717) * (-1898.609) (-1890.414) [-1900.889] (-1891.567) -- 0:01:20
730000 -- [-1896.885] (-1900.865) (-1898.496) (-1899.173) * [-1897.966] (-1904.284) (-1897.659) (-1899.772) -- 0:01:19
Average standard deviation of split frequencies: 0.002323
730500 -- (-1897.502) [-1889.804] (-1905.271) (-1893.128) * (-1896.058) [-1903.473] (-1895.851) (-1903.980) -- 0:01:20
731000 -- (-1894.578) (-1899.615) (-1904.606) [-1895.100] * (-1892.771) [-1899.973] (-1901.511) (-1908.571) -- 0:01:19
731500 -- (-1899.247) (-1909.798) (-1910.449) [-1895.109] * [-1903.378] (-1893.833) (-1901.980) (-1895.132) -- 0:01:19
732000 -- (-1892.803) [-1900.831] (-1900.142) (-1899.618) * (-1901.365) (-1901.784) [-1897.929] (-1894.474) -- 0:01:19
732500 -- (-1899.697) (-1906.689) [-1898.050] (-1898.687) * (-1895.286) (-1899.239) (-1903.205) [-1902.869] -- 0:01:19
733000 -- [-1897.802] (-1900.367) (-1901.302) (-1899.790) * [-1896.860] (-1905.745) (-1899.889) (-1905.273) -- 0:01:19
733500 -- (-1907.807) (-1895.603) (-1902.926) [-1897.336] * (-1900.293) [-1891.705] (-1894.021) (-1904.117) -- 0:01:18
734000 -- (-1906.343) (-1897.790) [-1896.079] (-1906.901) * (-1911.159) (-1900.006) [-1898.430] (-1894.062) -- 0:01:19
734500 -- (-1901.772) (-1894.677) [-1902.716] (-1899.967) * (-1898.206) (-1895.357) (-1905.190) [-1897.222] -- 0:01:18
735000 -- [-1897.351] (-1903.924) (-1906.363) (-1897.969) * (-1896.276) [-1894.587] (-1897.559) (-1897.042) -- 0:01:18
Average standard deviation of split frequencies: 0.002306
735500 -- (-1896.005) (-1900.564) (-1902.091) [-1896.074] * [-1903.768] (-1905.960) (-1911.459) (-1896.445) -- 0:01:18
736000 -- [-1897.184] (-1900.472) (-1904.301) (-1901.264) * (-1896.756) [-1899.694] (-1913.994) (-1900.138) -- 0:01:18
736500 -- (-1904.045) (-1897.049) (-1908.167) [-1898.744] * [-1891.659] (-1899.178) (-1923.783) (-1905.275) -- 0:01:17
737000 -- (-1896.058) [-1899.297] (-1905.922) (-1890.237) * (-1896.511) (-1900.674) (-1913.769) [-1896.735] -- 0:01:17
737500 -- [-1895.728] (-1896.971) (-1896.247) (-1898.321) * [-1898.164] (-1897.364) (-1900.739) (-1902.265) -- 0:01:17
738000 -- (-1891.440) (-1895.278) [-1895.983] (-1899.893) * (-1893.501) (-1901.808) [-1895.771] (-1901.790) -- 0:01:17
738500 -- (-1902.903) (-1898.378) (-1896.861) [-1897.749] * [-1896.199] (-1905.799) (-1891.230) (-1897.178) -- 0:01:17
739000 -- [-1896.867] (-1895.489) (-1898.003) (-1912.191) * (-1896.288) (-1895.197) [-1895.604] (-1900.466) -- 0:01:17
739500 -- [-1895.214] (-1896.025) (-1901.793) (-1903.140) * [-1899.861] (-1899.759) (-1891.552) (-1897.779) -- 0:01:17
740000 -- (-1903.917) (-1899.726) [-1898.774] (-1912.135) * (-1898.837) [-1895.425] (-1892.619) (-1900.071) -- 0:01:16
Average standard deviation of split frequencies: 0.002546
740500 -- (-1889.765) (-1906.889) [-1900.257] (-1899.639) * (-1904.745) (-1897.224) [-1898.258] (-1900.882) -- 0:01:17
741000 -- (-1907.349) (-1900.663) [-1896.022] (-1898.754) * (-1895.556) (-1903.173) (-1903.425) [-1897.982] -- 0:01:16
741500 -- (-1897.850) [-1894.743] (-1900.646) (-1902.962) * [-1900.299] (-1895.502) (-1895.172) (-1898.618) -- 0:01:16
742000 -- [-1896.639] (-1896.504) (-1907.216) (-1908.891) * (-1902.459) (-1902.168) (-1899.138) [-1894.697] -- 0:01:16
742500 -- (-1899.469) [-1897.209] (-1900.457) (-1902.852) * (-1898.174) [-1889.978] (-1899.862) (-1903.514) -- 0:01:16
743000 -- (-1907.643) (-1897.045) (-1894.577) [-1893.621] * (-1893.198) (-1896.781) (-1905.907) [-1896.717] -- 0:01:16
743500 -- (-1897.513) (-1897.192) (-1894.121) [-1901.169] * (-1905.247) (-1903.295) (-1900.514) [-1901.817] -- 0:01:15
744000 -- (-1899.138) [-1895.079] (-1893.728) (-1890.333) * (-1897.639) (-1897.555) [-1899.142] (-1905.883) -- 0:01:16
744500 -- (-1899.809) [-1893.243] (-1902.987) (-1894.596) * (-1905.617) (-1898.065) (-1899.976) [-1904.948] -- 0:01:15
745000 -- (-1899.750) [-1898.889] (-1895.453) (-1904.741) * (-1909.249) (-1896.280) [-1894.063] (-1895.717) -- 0:01:15
Average standard deviation of split frequencies: 0.002275
745500 -- [-1895.362] (-1910.654) (-1893.126) (-1894.182) * (-1900.813) (-1902.041) [-1894.385] (-1900.078) -- 0:01:15
746000 -- (-1907.200) (-1908.539) [-1903.136] (-1897.542) * [-1896.711] (-1903.968) (-1897.997) (-1892.726) -- 0:01:15
746500 -- (-1906.032) (-1897.062) (-1897.942) [-1897.816] * (-1896.406) [-1894.216] (-1897.859) (-1902.224) -- 0:01:15
747000 -- [-1894.353] (-1896.859) (-1899.179) (-1902.581) * (-1898.653) [-1901.755] (-1894.459) (-1897.864) -- 0:01:14
747500 -- [-1894.357] (-1900.855) (-1893.327) (-1897.956) * [-1892.715] (-1896.262) (-1895.384) (-1899.905) -- 0:01:14
748000 -- [-1890.593] (-1901.410) (-1903.447) (-1899.395) * (-1900.446) [-1895.780] (-1897.020) (-1894.280) -- 0:01:14
748500 -- (-1899.839) [-1897.382] (-1901.851) (-1904.066) * (-1900.601) [-1901.515] (-1897.512) (-1899.264) -- 0:01:14
749000 -- [-1898.682] (-1906.621) (-1894.295) (-1897.598) * (-1896.784) [-1902.032] (-1904.236) (-1904.803) -- 0:01:14
749500 -- (-1905.730) (-1904.565) [-1900.858] (-1902.839) * [-1888.850] (-1894.401) (-1904.912) (-1898.991) -- 0:01:14
750000 -- (-1902.116) [-1890.902] (-1896.635) (-1898.823) * (-1897.567) [-1893.068] (-1912.553) (-1907.561) -- 0:01:14
Average standard deviation of split frequencies: 0.002386
750500 -- (-1905.590) (-1903.355) (-1897.757) [-1895.680] * (-1899.426) (-1896.293) [-1893.185] (-1899.188) -- 0:01:13
751000 -- (-1907.080) [-1888.604] (-1907.963) (-1896.232) * (-1913.118) [-1897.674] (-1909.349) (-1900.877) -- 0:01:13
751500 -- (-1893.291) (-1894.543) (-1909.058) [-1902.885] * (-1899.913) (-1909.586) [-1893.468] (-1893.842) -- 0:01:13
752000 -- (-1894.567) (-1906.943) (-1902.912) [-1892.828] * (-1905.649) [-1897.931] (-1898.317) (-1902.149) -- 0:01:13
752500 -- (-1899.045) [-1901.812] (-1898.758) (-1893.548) * (-1896.848) (-1907.622) [-1893.334] (-1895.572) -- 0:01:13
753000 -- (-1898.414) [-1899.870] (-1901.003) (-1909.999) * (-1895.668) (-1904.224) (-1908.342) [-1904.556] -- 0:01:13
753500 -- (-1899.963) (-1893.228) [-1896.816] (-1902.985) * (-1901.973) (-1893.175) (-1899.641) [-1900.562] -- 0:01:12
754000 -- (-1899.205) (-1904.092) [-1895.408] (-1909.802) * [-1892.265] (-1899.239) (-1898.184) (-1897.023) -- 0:01:12
754500 -- [-1895.987] (-1906.981) (-1894.706) (-1893.335) * [-1900.697] (-1900.945) (-1892.109) (-1901.962) -- 0:01:12
755000 -- (-1895.763) (-1893.078) [-1898.059] (-1898.011) * (-1893.668) [-1894.459] (-1899.036) (-1900.260) -- 0:01:12
Average standard deviation of split frequencies: 0.002494
755500 -- [-1890.633] (-1894.456) (-1894.083) (-1901.806) * (-1904.324) [-1899.423] (-1897.892) (-1905.486) -- 0:01:12
756000 -- (-1894.507) [-1897.225] (-1904.811) (-1902.335) * [-1898.398] (-1904.410) (-1898.357) (-1896.868) -- 0:01:12
756500 -- (-1895.876) [-1892.149] (-1906.602) (-1900.904) * [-1892.882] (-1899.335) (-1905.221) (-1896.714) -- 0:01:12
757000 -- [-1897.510] (-1888.859) (-1903.363) (-1895.103) * (-1899.580) (-1895.238) [-1899.768] (-1897.620) -- 0:01:11
757500 -- (-1895.718) (-1904.711) (-1910.110) [-1897.480] * (-1900.532) (-1904.533) (-1909.356) [-1901.732] -- 0:01:12
758000 -- (-1900.229) (-1902.573) (-1906.681) [-1896.454] * [-1896.047] (-1895.945) (-1906.238) (-1906.170) -- 0:01:11
758500 -- [-1893.818] (-1901.477) (-1900.201) (-1901.120) * (-1895.503) (-1903.285) [-1891.302] (-1897.821) -- 0:01:11
759000 -- (-1908.420) (-1903.355) (-1901.062) [-1891.269] * (-1896.310) (-1902.784) (-1901.539) [-1905.058] -- 0:01:11
759500 -- [-1902.052] (-1896.340) (-1898.073) (-1892.874) * (-1895.350) (-1900.921) [-1900.949] (-1897.971) -- 0:01:11
760000 -- (-1902.278) (-1902.724) (-1912.275) [-1898.093] * [-1896.768] (-1917.323) (-1898.119) (-1901.526) -- 0:01:11
Average standard deviation of split frequencies: 0.002975
760500 -- (-1896.409) [-1900.082] (-1897.689) (-1895.877) * [-1904.529] (-1897.558) (-1906.255) (-1913.115) -- 0:01:10
761000 -- [-1891.704] (-1899.870) (-1904.802) (-1903.601) * (-1896.834) (-1902.057) (-1895.646) [-1896.986] -- 0:01:10
761500 -- (-1895.152) (-1894.675) [-1896.504] (-1902.334) * (-1894.772) [-1893.438] (-1909.254) (-1902.266) -- 0:01:10
762000 -- (-1907.580) (-1899.144) (-1899.097) [-1897.300] * (-1903.637) (-1901.853) (-1899.294) [-1892.774] -- 0:01:10
762500 -- (-1896.164) [-1895.096] (-1900.395) (-1902.441) * (-1903.135) (-1901.255) [-1899.957] (-1902.016) -- 0:01:10
763000 -- (-1904.682) [-1904.915] (-1892.473) (-1894.022) * (-1899.743) (-1897.718) [-1896.808] (-1892.729) -- 0:01:10
763500 -- (-1899.524) (-1904.652) (-1898.935) [-1908.858] * (-1906.038) [-1894.054] (-1900.876) (-1897.372) -- 0:01:10
764000 -- (-1899.684) (-1895.920) [-1902.483] (-1891.979) * (-1897.966) [-1897.802] (-1895.620) (-1901.079) -- 0:01:09
764500 -- [-1900.826] (-1896.821) (-1895.287) (-1892.536) * (-1901.587) (-1900.966) [-1895.569] (-1894.870) -- 0:01:09
765000 -- [-1895.380] (-1895.987) (-1898.783) (-1899.027) * (-1890.595) (-1897.949) [-1890.920] (-1905.445) -- 0:01:09
Average standard deviation of split frequencies: 0.003077
765500 -- (-1901.350) (-1901.847) (-1905.223) [-1895.566] * (-1898.720) (-1905.561) (-1905.109) [-1903.358] -- 0:01:09
766000 -- (-1903.423) (-1899.668) [-1906.526] (-1902.705) * (-1900.114) (-1894.038) (-1903.297) [-1898.321] -- 0:01:09
766500 -- (-1897.233) (-1906.779) [-1898.378] (-1904.252) * (-1898.548) [-1898.015] (-1903.160) (-1897.621) -- 0:01:09
767000 -- (-1895.887) (-1899.591) [-1898.429] (-1898.393) * (-1900.669) [-1894.789] (-1899.588) (-1907.869) -- 0:01:08
767500 -- (-1894.031) [-1905.349] (-1899.936) (-1901.192) * (-1895.211) (-1896.372) (-1897.403) [-1901.725] -- 0:01:08
768000 -- (-1893.487) (-1892.446) [-1894.302] (-1906.526) * [-1899.453] (-1895.313) (-1904.558) (-1908.855) -- 0:01:08
768500 -- [-1900.041] (-1907.034) (-1900.376) (-1902.780) * (-1899.599) (-1905.598) [-1893.493] (-1897.840) -- 0:01:08
769000 -- (-1896.614) [-1897.310] (-1908.821) (-1892.484) * (-1898.480) (-1895.399) [-1899.430] (-1902.571) -- 0:01:08
769500 -- [-1894.491] (-1895.927) (-1898.984) (-1901.745) * [-1896.045] (-1909.446) (-1909.921) (-1903.387) -- 0:01:08
770000 -- (-1902.948) [-1897.462] (-1904.868) (-1894.037) * (-1899.556) (-1896.356) (-1895.891) [-1903.729] -- 0:01:08
Average standard deviation of split frequencies: 0.003303
770500 -- [-1894.791] (-1906.173) (-1903.926) (-1902.061) * (-1902.406) (-1902.854) [-1888.105] (-1903.623) -- 0:01:07
771000 -- [-1896.500] (-1904.529) (-1901.920) (-1899.499) * (-1907.820) (-1901.991) [-1892.907] (-1895.055) -- 0:01:08
771500 -- (-1895.933) (-1909.653) (-1900.544) [-1895.454] * [-1896.531] (-1901.965) (-1894.617) (-1896.778) -- 0:01:07
772000 -- [-1891.777] (-1899.580) (-1899.325) (-1900.468) * [-1901.549] (-1894.576) (-1890.172) (-1901.167) -- 0:01:07
772500 -- [-1894.366] (-1903.026) (-1901.725) (-1898.301) * (-1901.350) [-1895.108] (-1904.421) (-1905.976) -- 0:01:07
773000 -- [-1897.785] (-1897.594) (-1898.504) (-1900.813) * (-1893.800) [-1895.657] (-1903.355) (-1904.698) -- 0:01:07
773500 -- (-1901.286) [-1901.563] (-1898.467) (-1904.101) * (-1896.919) [-1898.356] (-1893.397) (-1904.525) -- 0:01:07
774000 -- (-1901.869) (-1909.432) (-1897.133) [-1896.003] * (-1894.325) [-1896.272] (-1900.998) (-1909.092) -- 0:01:06
774500 -- [-1897.612] (-1917.075) (-1910.758) (-1899.654) * (-1898.951) (-1896.058) (-1896.751) [-1902.751] -- 0:01:06
775000 -- (-1899.021) [-1895.535] (-1900.458) (-1898.540) * [-1897.699] (-1896.629) (-1898.165) (-1899.488) -- 0:01:06
Average standard deviation of split frequencies: 0.003523
775500 -- (-1900.810) (-1901.609) (-1900.295) [-1894.332] * (-1896.777) (-1892.097) [-1894.391] (-1897.019) -- 0:01:06
776000 -- (-1892.910) (-1899.893) (-1900.935) [-1899.247] * (-1896.763) (-1898.677) (-1901.274) [-1904.485] -- 0:01:06
776500 -- (-1897.605) [-1907.455] (-1897.828) (-1903.787) * [-1897.116] (-1901.112) (-1897.274) (-1900.720) -- 0:01:06
777000 -- (-1898.579) [-1895.329] (-1900.312) (-1895.145) * (-1902.945) (-1909.589) [-1894.378] (-1897.225) -- 0:01:06
777500 -- (-1904.391) (-1897.769) [-1906.835] (-1900.831) * (-1900.794) [-1896.362] (-1890.552) (-1903.125) -- 0:01:05
778000 -- (-1904.050) (-1899.322) [-1900.371] (-1891.620) * (-1891.553) (-1899.845) [-1893.995] (-1894.505) -- 0:01:05
778500 -- (-1910.029) [-1893.067] (-1897.720) (-1899.425) * (-1898.026) [-1893.332] (-1900.752) (-1898.553) -- 0:01:05
779000 -- (-1903.211) (-1893.448) (-1893.143) [-1893.131] * (-1900.067) (-1900.227) (-1904.490) [-1903.391] -- 0:01:05
779500 -- (-1898.133) (-1900.951) [-1894.312] (-1894.663) * (-1898.075) (-1897.059) [-1899.800] (-1899.469) -- 0:01:05
780000 -- (-1903.519) (-1900.691) [-1898.407] (-1898.785) * (-1894.728) (-1902.486) [-1899.873] (-1911.373) -- 0:01:05
Average standard deviation of split frequencies: 0.003382
780500 -- [-1897.215] (-1891.250) (-1890.031) (-1900.207) * [-1896.530] (-1908.789) (-1894.696) (-1899.414) -- 0:01:04
781000 -- (-1895.502) [-1898.419] (-1895.807) (-1905.318) * (-1899.579) (-1904.664) [-1898.879] (-1895.676) -- 0:01:04
781500 -- [-1894.756] (-1896.415) (-1907.587) (-1897.396) * (-1902.528) (-1899.126) (-1895.229) [-1893.138] -- 0:01:04
782000 -- [-1902.352] (-1893.835) (-1896.504) (-1896.073) * (-1900.368) (-1894.194) (-1893.328) [-1894.426] -- 0:01:04
782500 -- (-1893.045) (-1893.022) (-1894.422) [-1891.180] * (-1904.688) [-1890.821] (-1904.278) (-1895.500) -- 0:01:04
783000 -- (-1898.817) [-1895.655] (-1900.420) (-1891.414) * (-1917.531) (-1899.743) (-1902.616) [-1891.560] -- 0:01:04
783500 -- [-1895.418] (-1893.943) (-1901.308) (-1902.707) * (-1904.583) (-1896.177) [-1897.165] (-1899.418) -- 0:01:04
784000 -- [-1897.533] (-1905.372) (-1895.250) (-1891.883) * (-1905.012) (-1910.569) (-1903.990) [-1892.641] -- 0:01:03
784500 -- (-1900.484) (-1902.580) [-1895.822] (-1906.656) * (-1904.559) [-1901.280] (-1896.832) (-1900.941) -- 0:01:04
785000 -- (-1898.352) (-1901.912) [-1895.922] (-1905.945) * (-1905.403) (-1896.557) (-1910.132) [-1897.901] -- 0:01:03
Average standard deviation of split frequencies: 0.003359
785500 -- (-1904.435) (-1899.711) (-1909.420) [-1901.952] * (-1898.296) (-1910.699) (-1905.155) [-1891.994] -- 0:01:03
786000 -- [-1893.718] (-1900.662) (-1901.751) (-1905.259) * (-1902.331) (-1899.365) (-1898.589) [-1899.109] -- 0:01:03
786500 -- (-1893.229) (-1896.591) [-1894.730] (-1907.352) * (-1909.254) (-1896.884) [-1897.397] (-1900.581) -- 0:01:03
787000 -- (-1896.728) [-1890.576] (-1903.829) (-1898.746) * (-1895.633) [-1898.579] (-1903.820) (-1903.582) -- 0:01:03
787500 -- [-1896.030] (-1900.585) (-1903.188) (-1901.952) * (-1894.430) [-1904.170] (-1893.567) (-1898.007) -- 0:01:02
788000 -- (-1897.626) (-1897.724) [-1892.784] (-1902.236) * [-1898.650] (-1897.526) (-1900.118) (-1891.148) -- 0:01:02
788500 -- (-1905.502) (-1908.196) [-1892.483] (-1904.202) * (-1901.177) (-1907.010) [-1900.918] (-1895.826) -- 0:01:02
789000 -- (-1903.193) (-1901.971) [-1901.770] (-1899.111) * (-1902.716) [-1898.004] (-1900.961) (-1895.366) -- 0:01:02
789500 -- (-1899.467) (-1900.593) (-1900.444) [-1897.816] * (-1898.293) (-1897.567) [-1896.064] (-1898.008) -- 0:01:02
790000 -- (-1903.595) (-1900.157) (-1897.109) [-1893.706] * (-1896.902) (-1903.615) [-1892.233] (-1897.013) -- 0:01:02
Average standard deviation of split frequencies: 0.003339
790500 -- (-1906.420) (-1897.402) (-1892.982) [-1892.190] * (-1895.955) (-1899.207) (-1898.931) [-1902.586] -- 0:01:02
791000 -- (-1900.045) [-1898.322] (-1909.948) (-1895.923) * (-1897.914) (-1899.475) (-1899.504) [-1895.677] -- 0:01:01
791500 -- (-1907.027) (-1899.894) (-1893.752) [-1897.561] * (-1910.824) [-1896.423] (-1899.704) (-1901.939) -- 0:01:01
792000 -- [-1895.125] (-1901.004) (-1903.960) (-1898.778) * [-1904.273] (-1899.641) (-1892.711) (-1899.060) -- 0:01:01
792500 -- [-1896.456] (-1899.332) (-1903.887) (-1902.909) * (-1895.827) [-1897.486] (-1900.532) (-1890.131) -- 0:01:01
793000 -- (-1901.114) [-1904.181] (-1909.178) (-1901.266) * [-1892.012] (-1900.004) (-1894.171) (-1900.600) -- 0:01:01
793500 -- (-1895.605) (-1895.340) (-1901.669) [-1898.737] * (-1903.604) [-1904.942] (-1901.614) (-1896.053) -- 0:01:01
794000 -- (-1893.073) (-1896.650) [-1899.163] (-1898.439) * (-1898.502) (-1901.792) [-1892.054] (-1902.345) -- 0:01:00
794500 -- (-1901.292) (-1913.539) [-1894.230] (-1895.215) * (-1904.104) [-1893.738] (-1895.232) (-1901.826) -- 0:01:00
795000 -- [-1897.787] (-1890.019) (-1895.839) (-1902.293) * (-1892.759) [-1898.373] (-1896.894) (-1895.817) -- 0:01:00
Average standard deviation of split frequencies: 0.003198
795500 -- (-1903.469) (-1893.045) (-1894.294) [-1892.414] * [-1906.417] (-1907.435) (-1897.969) (-1894.746) -- 0:01:00
796000 -- (-1899.731) [-1897.877] (-1896.000) (-1904.633) * [-1896.844] (-1899.981) (-1895.542) (-1900.271) -- 0:01:00
796500 -- (-1904.821) [-1892.152] (-1892.338) (-1902.470) * (-1910.360) [-1892.324] (-1901.382) (-1895.916) -- 0:01:00
797000 -- (-1906.483) [-1895.823] (-1906.144) (-1908.212) * (-1894.647) (-1900.371) [-1900.280] (-1898.808) -- 0:01:00
797500 -- (-1904.458) (-1897.479) (-1898.582) [-1889.641] * (-1908.774) (-1896.993) [-1894.447] (-1899.227) -- 0:00:59
798000 -- [-1903.361] (-1895.174) (-1897.446) (-1899.093) * (-1896.005) (-1896.085) [-1890.452] (-1896.558) -- 0:00:59
798500 -- [-1898.195] (-1895.921) (-1898.862) (-1897.146) * [-1891.239] (-1907.210) (-1901.041) (-1901.705) -- 0:00:59
799000 -- [-1895.413] (-1897.394) (-1898.088) (-1896.867) * (-1901.586) (-1900.852) (-1901.379) [-1907.488] -- 0:00:59
799500 -- [-1893.231] (-1895.088) (-1898.404) (-1897.024) * (-1895.563) [-1904.418] (-1897.206) (-1905.403) -- 0:00:59
800000 -- (-1897.995) [-1895.693] (-1905.671) (-1899.381) * (-1900.463) (-1897.796) [-1892.754] (-1906.183) -- 0:00:59
Average standard deviation of split frequencies: 0.003062
800500 -- (-1902.157) (-1905.346) [-1892.957] (-1898.169) * (-1911.692) [-1897.519] (-1899.417) (-1917.054) -- 0:00:59
801000 -- [-1899.614] (-1896.502) (-1893.396) (-1911.948) * (-1906.021) (-1902.421) [-1895.486] (-1901.193) -- 0:00:58
801500 -- (-1896.739) (-1901.009) [-1898.089] (-1905.933) * (-1905.931) (-1901.911) (-1902.971) [-1897.415] -- 0:00:58
802000 -- (-1895.334) (-1896.255) [-1894.156] (-1907.075) * (-1897.554) (-1905.683) (-1905.950) [-1897.764] -- 0:00:58
802500 -- (-1901.602) (-1908.912) (-1894.145) [-1892.660] * (-1905.562) (-1898.090) (-1905.720) [-1894.293] -- 0:00:58
803000 -- [-1897.578] (-1913.503) (-1904.712) (-1900.201) * (-1893.638) (-1898.124) [-1895.282] (-1895.297) -- 0:00:58
803500 -- (-1895.792) [-1905.678] (-1899.885) (-1893.591) * (-1904.808) (-1897.843) [-1897.823] (-1905.050) -- 0:00:58
804000 -- (-1895.691) (-1901.468) [-1900.532] (-1893.021) * (-1903.473) (-1895.668) [-1904.422] (-1898.039) -- 0:00:58
804500 -- (-1906.237) [-1893.650] (-1899.125) (-1898.633) * [-1897.368] (-1900.781) (-1903.100) (-1901.253) -- 0:00:57
805000 -- (-1902.502) (-1903.165) [-1895.905] (-1899.355) * (-1900.355) (-1898.480) (-1897.723) [-1890.131] -- 0:00:57
Average standard deviation of split frequencies: 0.003275
805500 -- [-1889.942] (-1904.622) (-1899.793) (-1898.851) * [-1895.294] (-1904.993) (-1900.987) (-1895.134) -- 0:00:57
806000 -- [-1896.587] (-1893.202) (-1900.159) (-1894.138) * (-1893.933) (-1903.753) (-1911.835) [-1899.489] -- 0:00:57
806500 -- (-1895.021) (-1903.374) [-1899.882] (-1898.847) * (-1896.108) [-1892.954] (-1906.372) (-1896.968) -- 0:00:57
807000 -- (-1903.777) (-1913.555) (-1896.870) [-1895.582] * [-1896.871] (-1899.620) (-1902.623) (-1897.357) -- 0:00:57
807500 -- [-1895.250] (-1895.766) (-1907.949) (-1904.302) * (-1894.248) (-1901.278) [-1895.063] (-1901.421) -- 0:00:56
808000 -- (-1902.059) (-1902.092) (-1898.671) [-1892.298] * [-1897.592] (-1907.152) (-1895.675) (-1905.151) -- 0:00:56
808500 -- (-1908.816) [-1897.604] (-1901.027) (-1896.880) * [-1891.863] (-1903.470) (-1900.143) (-1901.401) -- 0:00:56
809000 -- (-1908.642) [-1896.115] (-1905.327) (-1894.931) * (-1899.346) [-1899.098] (-1901.564) (-1895.792) -- 0:00:56
809500 -- [-1897.453] (-1894.840) (-1905.897) (-1897.678) * [-1892.434] (-1894.335) (-1899.216) (-1896.730) -- 0:00:56
810000 -- (-1899.708) [-1901.201] (-1897.791) (-1901.216) * (-1899.857) [-1890.586] (-1902.342) (-1900.937) -- 0:00:56
Average standard deviation of split frequencies: 0.003024
810500 -- (-1900.871) (-1906.017) [-1901.583] (-1897.662) * (-1901.871) (-1898.394) [-1898.831] (-1897.132) -- 0:00:56
811000 -- (-1903.700) (-1903.091) (-1898.175) [-1891.979] * (-1900.539) (-1895.821) [-1894.209] (-1911.129) -- 0:00:55
811500 -- (-1903.297) [-1896.449] (-1893.379) (-1900.075) * (-1895.353) (-1894.935) (-1896.862) [-1894.989] -- 0:00:55
812000 -- (-1904.146) (-1894.317) (-1899.712) [-1901.854] * (-1899.334) [-1901.722] (-1900.161) (-1895.718) -- 0:00:55
812500 -- (-1908.348) [-1895.877] (-1905.262) (-1896.276) * [-1902.277] (-1897.603) (-1902.811) (-1891.779) -- 0:00:55
813000 -- (-1902.952) [-1895.879] (-1901.637) (-1891.922) * [-1899.841] (-1903.481) (-1903.674) (-1889.067) -- 0:00:55
813500 -- (-1903.219) [-1892.290] (-1901.911) (-1899.401) * [-1897.773] (-1903.698) (-1909.058) (-1893.431) -- 0:00:55
814000 -- (-1911.282) [-1894.613] (-1909.418) (-1898.874) * (-1901.878) (-1894.091) (-1897.434) [-1898.155] -- 0:00:55
814500 -- [-1896.608] (-1903.681) (-1900.743) (-1901.678) * [-1901.869] (-1893.435) (-1903.863) (-1899.753) -- 0:00:54
815000 -- (-1901.562) [-1892.603] (-1902.179) (-1895.788) * (-1903.875) (-1891.492) [-1900.696] (-1897.858) -- 0:00:54
Average standard deviation of split frequencies: 0.002542
815500 -- (-1895.197) [-1893.029] (-1903.966) (-1896.638) * (-1899.023) [-1899.494] (-1900.344) (-1896.055) -- 0:00:54
816000 -- [-1896.679] (-1892.484) (-1901.296) (-1898.234) * (-1903.893) (-1898.132) (-1895.656) [-1900.051] -- 0:00:54
816500 -- [-1891.049] (-1899.681) (-1902.572) (-1902.110) * (-1905.913) [-1895.534] (-1892.634) (-1900.451) -- 0:00:54
817000 -- (-1898.962) (-1903.586) [-1901.024] (-1902.467) * [-1896.763] (-1896.140) (-1900.467) (-1900.664) -- 0:00:54
817500 -- [-1888.750] (-1899.336) (-1901.208) (-1891.287) * [-1896.798] (-1895.496) (-1904.022) (-1893.769) -- 0:00:54
818000 -- [-1901.139] (-1901.971) (-1902.925) (-1895.959) * (-1904.869) [-1898.785] (-1903.336) (-1897.753) -- 0:00:53
818500 -- (-1899.734) (-1908.494) (-1893.885) [-1898.069] * (-1894.508) (-1903.327) (-1899.768) [-1900.792] -- 0:00:53
819000 -- (-1903.379) [-1892.099] (-1897.364) (-1900.744) * (-1894.724) [-1891.796] (-1894.277) (-1895.195) -- 0:00:53
819500 -- (-1899.498) (-1896.702) [-1894.130] (-1894.286) * (-1899.766) [-1892.143] (-1907.879) (-1898.030) -- 0:00:53
820000 -- (-1898.624) [-1892.498] (-1897.993) (-1895.855) * (-1897.157) [-1896.745] (-1895.902) (-1903.280) -- 0:00:53
Average standard deviation of split frequencies: 0.002757
820500 -- (-1896.311) [-1899.486] (-1898.401) (-1897.696) * (-1900.541) [-1895.313] (-1901.078) (-1902.926) -- 0:00:53
821000 -- (-1898.972) [-1900.449] (-1892.703) (-1906.859) * (-1899.297) [-1896.082] (-1902.944) (-1897.792) -- 0:00:52
821500 -- (-1902.265) (-1901.200) (-1894.469) [-1892.114] * (-1901.147) (-1897.542) (-1899.408) [-1895.624] -- 0:00:52
822000 -- (-1900.231) (-1895.637) [-1896.929] (-1899.000) * (-1900.577) (-1900.284) [-1901.858] (-1894.087) -- 0:00:52
822500 -- (-1901.332) (-1902.887) [-1894.831] (-1898.986) * (-1901.489) (-1903.951) (-1908.736) [-1898.927] -- 0:00:52
823000 -- (-1905.866) [-1900.914] (-1896.428) (-1902.274) * (-1895.622) (-1904.299) (-1907.523) [-1899.366] -- 0:00:52
823500 -- (-1895.955) [-1895.291] (-1902.197) (-1896.744) * [-1901.974] (-1893.517) (-1903.475) (-1904.107) -- 0:00:52
824000 -- (-1902.644) (-1900.327) [-1900.116] (-1900.389) * (-1905.023) [-1891.877] (-1896.956) (-1909.829) -- 0:00:52
824500 -- (-1904.142) (-1898.671) (-1897.404) [-1907.577] * (-1899.966) (-1900.929) (-1903.391) [-1898.174] -- 0:00:51
825000 -- (-1903.878) [-1895.895] (-1896.556) (-1895.166) * [-1897.907] (-1902.623) (-1909.354) (-1908.157) -- 0:00:51
Average standard deviation of split frequencies: 0.002397
825500 -- (-1900.637) (-1899.712) (-1903.668) [-1894.936] * (-1895.758) (-1895.938) [-1898.147] (-1902.801) -- 0:00:51
826000 -- (-1901.967) [-1900.943] (-1902.516) (-1900.646) * (-1893.027) (-1900.238) (-1899.882) [-1900.037] -- 0:00:51
826500 -- [-1899.978] (-1897.958) (-1915.740) (-1898.454) * (-1891.995) (-1899.738) [-1892.080] (-1902.797) -- 0:00:51
827000 -- (-1898.126) [-1898.305] (-1902.408) (-1894.370) * [-1900.410] (-1907.174) (-1897.046) (-1909.062) -- 0:00:51
827500 -- (-1901.777) (-1893.183) (-1902.717) [-1898.258] * (-1896.777) (-1899.816) [-1900.250] (-1901.480) -- 0:00:51
828000 -- (-1893.206) (-1905.546) (-1897.934) [-1896.409] * (-1894.567) (-1899.153) [-1890.457] (-1910.422) -- 0:00:50
828500 -- (-1902.675) [-1891.612] (-1897.220) (-1907.936) * (-1891.341) (-1907.573) (-1893.672) [-1894.201] -- 0:00:50
829000 -- (-1893.290) (-1897.820) [-1898.434] (-1897.871) * (-1892.179) (-1897.895) [-1898.302] (-1900.599) -- 0:00:50
829500 -- (-1901.457) [-1902.283] (-1905.856) (-1901.318) * [-1891.197] (-1906.739) (-1897.765) (-1905.869) -- 0:00:50
830000 -- [-1895.843] (-1905.348) (-1898.547) (-1908.590) * (-1905.706) (-1903.078) [-1893.240] (-1893.190) -- 0:00:50
Average standard deviation of split frequencies: 0.002611
830500 -- [-1894.565] (-1891.681) (-1906.500) (-1901.363) * (-1899.423) (-1896.715) (-1896.004) [-1895.042] -- 0:00:50
831000 -- [-1894.879] (-1900.652) (-1906.761) (-1897.102) * (-1898.130) (-1906.348) (-1894.620) [-1897.863] -- 0:00:50
831500 -- (-1896.073) (-1900.228) (-1904.923) [-1899.286] * (-1901.885) (-1901.336) [-1902.537] (-1898.026) -- 0:00:49
832000 -- (-1898.187) (-1900.573) (-1903.036) [-1900.679] * [-1901.077] (-1900.633) (-1900.750) (-1908.363) -- 0:00:49
832500 -- (-1910.403) (-1898.785) (-1900.313) [-1897.333] * (-1898.031) [-1901.250] (-1896.236) (-1893.880) -- 0:00:49
833000 -- (-1914.834) [-1896.915] (-1909.399) (-1901.789) * (-1896.683) (-1901.309) (-1902.098) [-1896.776] -- 0:00:49
833500 -- (-1905.857) (-1903.780) (-1902.524) [-1894.915] * (-1897.962) (-1899.660) (-1893.521) [-1900.892] -- 0:00:49
834000 -- (-1900.305) (-1901.762) (-1902.844) [-1894.903] * (-1903.826) [-1901.654] (-1889.882) (-1903.476) -- 0:00:49
834500 -- (-1901.816) (-1900.898) [-1896.832] (-1900.569) * (-1895.949) (-1892.135) (-1898.998) [-1896.838] -- 0:00:48
835000 -- (-1907.367) (-1905.892) (-1896.141) [-1889.803] * (-1901.711) (-1895.434) (-1901.828) [-1893.093] -- 0:00:48
Average standard deviation of split frequencies: 0.002819
835500 -- (-1899.785) [-1903.866] (-1902.024) (-1897.121) * (-1892.427) (-1906.968) (-1898.280) [-1897.262] -- 0:00:48
836000 -- (-1905.978) [-1892.692] (-1896.759) (-1901.340) * (-1898.537) [-1899.623] (-1901.916) (-1894.299) -- 0:00:48
836500 -- (-1902.007) (-1903.128) [-1891.546] (-1897.868) * (-1898.520) (-1905.502) (-1897.565) [-1893.970] -- 0:00:48
837000 -- [-1895.501] (-1908.752) (-1899.208) (-1897.424) * (-1900.789) (-1900.455) (-1900.328) [-1890.958] -- 0:00:48
837500 -- [-1894.697] (-1896.979) (-1907.491) (-1891.897) * (-1908.165) (-1906.478) (-1897.007) [-1895.753] -- 0:00:48
838000 -- [-1895.793] (-1895.912) (-1899.006) (-1894.263) * (-1895.371) [-1901.873] (-1889.286) (-1906.379) -- 0:00:47
838500 -- (-1889.776) (-1900.279) [-1898.407] (-1896.586) * (-1892.637) (-1898.200) [-1895.870] (-1903.440) -- 0:00:47
839000 -- (-1891.279) [-1903.243] (-1894.712) (-1905.026) * (-1901.517) (-1893.227) [-1897.219] (-1893.278) -- 0:00:47
839500 -- [-1901.451] (-1896.813) (-1900.706) (-1902.763) * (-1902.017) (-1899.178) (-1898.928) [-1890.383] -- 0:00:47
840000 -- [-1902.686] (-1899.366) (-1902.245) (-1910.999) * (-1898.132) (-1894.781) (-1901.409) [-1898.240] -- 0:00:47
Average standard deviation of split frequencies: 0.002916
840500 -- [-1893.586] (-1903.273) (-1901.126) (-1898.679) * [-1896.885] (-1892.103) (-1903.483) (-1897.218) -- 0:00:47
841000 -- (-1902.847) [-1896.201] (-1899.216) (-1897.260) * [-1899.566] (-1902.576) (-1903.805) (-1891.691) -- 0:00:47
841500 -- [-1894.418] (-1899.114) (-1901.222) (-1897.980) * [-1895.181] (-1903.382) (-1897.778) (-1892.581) -- 0:00:46
842000 -- (-1890.899) (-1895.880) (-1905.391) [-1894.303] * (-1901.910) (-1900.449) [-1895.725] (-1893.285) -- 0:00:46
842500 -- (-1896.741) (-1903.259) (-1899.405) [-1902.724] * (-1898.786) (-1896.237) (-1908.436) [-1898.275] -- 0:00:46
843000 -- (-1901.677) (-1903.640) (-1903.304) [-1893.500] * (-1905.904) [-1898.766] (-1902.254) (-1890.916) -- 0:00:46
843500 -- [-1903.672] (-1896.203) (-1906.988) (-1898.518) * (-1903.500) [-1896.194] (-1901.367) (-1894.245) -- 0:00:46
844000 -- [-1894.090] (-1895.789) (-1899.555) (-1908.871) * (-1896.722) (-1903.060) (-1906.555) [-1898.114] -- 0:00:46
844500 -- [-1895.907] (-1894.354) (-1895.921) (-1891.190) * [-1900.172] (-1899.937) (-1894.579) (-1895.591) -- 0:00:46
845000 -- [-1904.753] (-1898.372) (-1903.338) (-1898.771) * (-1897.990) (-1901.591) (-1896.724) [-1896.216] -- 0:00:45
Average standard deviation of split frequencies: 0.002675
845500 -- (-1900.494) (-1900.489) (-1896.327) [-1899.486] * (-1901.429) [-1892.495] (-1903.926) (-1899.973) -- 0:00:45
846000 -- (-1895.924) [-1891.334] (-1893.351) (-1896.999) * (-1902.819) (-1894.097) [-1896.283] (-1904.307) -- 0:00:45
846500 -- (-1898.992) [-1893.395] (-1894.093) (-1904.981) * (-1891.682) (-1901.186) (-1892.423) [-1900.787] -- 0:00:45
847000 -- (-1898.751) (-1905.668) [-1896.545] (-1896.843) * (-1899.752) (-1903.056) (-1899.154) [-1897.150] -- 0:00:45
847500 -- (-1901.644) [-1898.692] (-1897.953) (-1903.191) * (-1901.237) [-1897.582] (-1902.737) (-1897.636) -- 0:00:45
848000 -- [-1900.978] (-1900.845) (-1898.658) (-1900.613) * [-1897.904] (-1902.594) (-1900.374) (-1902.053) -- 0:00:44
848500 -- (-1902.618) [-1901.616] (-1909.304) (-1902.784) * [-1900.090] (-1901.804) (-1901.197) (-1906.365) -- 0:00:44
849000 -- (-1894.448) (-1901.368) [-1897.552] (-1894.900) * (-1895.579) (-1898.180) [-1889.649] (-1905.166) -- 0:00:44
849500 -- (-1896.181) (-1905.218) (-1895.470) [-1894.904] * (-1896.205) (-1903.428) [-1894.259] (-1897.110) -- 0:00:44
850000 -- [-1896.889] (-1902.079) (-1893.824) (-1904.433) * (-1904.796) (-1898.866) (-1906.476) [-1895.235] -- 0:00:44
Average standard deviation of split frequencies: 0.002660
850500 -- (-1900.885) (-1904.243) [-1894.727] (-1894.784) * [-1896.543] (-1898.557) (-1897.934) (-1900.971) -- 0:00:44
851000 -- (-1905.521) [-1896.954] (-1901.925) (-1903.492) * (-1898.794) (-1897.776) [-1897.329] (-1900.453) -- 0:00:44
851500 -- [-1895.656] (-1902.081) (-1903.261) (-1899.715) * [-1891.604] (-1899.602) (-1895.630) (-1891.939) -- 0:00:43
852000 -- (-1900.179) (-1907.696) [-1898.788] (-1909.222) * (-1899.011) (-1902.203) (-1903.272) [-1897.074] -- 0:00:43
852500 -- (-1909.068) (-1898.521) [-1899.232] (-1906.818) * (-1894.937) (-1904.096) [-1896.617] (-1901.740) -- 0:00:43
853000 -- (-1894.879) [-1895.973] (-1899.579) (-1897.300) * [-1897.823] (-1898.369) (-1894.913) (-1897.549) -- 0:00:43
853500 -- [-1893.701] (-1898.209) (-1900.814) (-1894.035) * (-1898.470) (-1901.699) (-1911.495) [-1901.376] -- 0:00:43
854000 -- (-1903.632) (-1897.440) (-1899.438) [-1898.352] * [-1897.767] (-1894.738) (-1907.258) (-1898.161) -- 0:00:43
854500 -- (-1902.334) (-1904.516) [-1899.666] (-1901.875) * (-1901.562) (-1906.412) (-1896.057) [-1896.028] -- 0:00:43
855000 -- (-1899.810) (-1899.086) [-1904.553] (-1894.859) * (-1898.466) (-1897.163) [-1901.512] (-1894.694) -- 0:00:42
Average standard deviation of split frequencies: 0.002533
855500 -- [-1898.210] (-1902.665) (-1894.994) (-1895.992) * (-1896.379) (-1896.165) (-1908.667) [-1894.097] -- 0:00:42
856000 -- (-1897.219) [-1897.569] (-1899.248) (-1902.508) * (-1895.873) [-1900.389] (-1902.360) (-1897.157) -- 0:00:42
856500 -- (-1894.970) [-1893.369] (-1897.183) (-1897.325) * (-1898.670) (-1897.130) [-1894.414] (-1898.205) -- 0:00:42
857000 -- (-1897.119) (-1896.705) (-1896.650) [-1898.068] * (-1891.419) (-1895.917) (-1897.658) [-1897.715] -- 0:00:42
857500 -- (-1898.055) (-1894.720) (-1895.593) [-1901.858] * [-1900.065] (-1894.702) (-1907.450) (-1904.859) -- 0:00:42
858000 -- [-1896.905] (-1902.114) (-1896.628) (-1900.755) * [-1903.292] (-1902.634) (-1893.967) (-1897.684) -- 0:00:42
858500 -- (-1892.274) [-1895.968] (-1893.697) (-1906.054) * [-1893.146] (-1893.881) (-1898.604) (-1898.630) -- 0:00:41
859000 -- [-1897.998] (-1899.464) (-1901.358) (-1905.507) * [-1901.738] (-1900.590) (-1896.932) (-1901.329) -- 0:00:41
859500 -- [-1893.223] (-1905.176) (-1893.038) (-1896.968) * (-1901.403) (-1901.207) [-1891.139] (-1904.005) -- 0:00:41
860000 -- [-1892.901] (-1900.141) (-1895.763) (-1898.002) * (-1903.286) (-1895.113) (-1900.315) [-1900.036] -- 0:00:41
Average standard deviation of split frequencies: 0.002629
860500 -- (-1896.231) [-1894.522] (-1893.017) (-1906.914) * (-1904.435) (-1904.393) [-1899.201] (-1903.570) -- 0:00:41
861000 -- (-1896.138) [-1894.461] (-1894.715) (-1898.438) * (-1896.044) [-1898.652] (-1896.205) (-1901.072) -- 0:00:41
861500 -- (-1901.915) (-1897.123) (-1896.773) [-1899.000] * [-1894.716] (-1899.745) (-1902.836) (-1905.772) -- 0:00:40
862000 -- [-1904.174] (-1905.453) (-1893.289) (-1902.013) * [-1901.003] (-1901.351) (-1898.044) (-1903.759) -- 0:00:40
862500 -- (-1904.645) [-1893.325] (-1897.138) (-1898.215) * (-1896.336) [-1898.663] (-1894.718) (-1895.289) -- 0:00:40
863000 -- (-1907.264) (-1898.956) [-1893.647] (-1901.855) * (-1897.322) (-1912.485) [-1901.003] (-1899.310) -- 0:00:40
863500 -- (-1902.075) [-1898.115] (-1892.072) (-1897.622) * (-1895.982) (-1903.575) (-1903.669) [-1894.398] -- 0:00:40
864000 -- (-1896.787) (-1893.263) [-1893.539] (-1898.786) * (-1896.718) [-1898.311] (-1894.698) (-1894.072) -- 0:00:40
864500 -- (-1894.457) (-1901.281) (-1896.947) [-1900.753] * [-1892.835] (-1902.728) (-1899.629) (-1899.177) -- 0:00:40
865000 -- [-1898.032] (-1900.505) (-1898.131) (-1900.784) * (-1896.766) [-1902.158] (-1896.219) (-1896.599) -- 0:00:39
Average standard deviation of split frequencies: 0.002939
865500 -- (-1897.348) (-1895.262) [-1897.878] (-1908.193) * [-1889.236] (-1900.807) (-1900.026) (-1897.935) -- 0:00:39
866000 -- (-1898.722) (-1907.525) [-1898.716] (-1901.980) * [-1895.575] (-1898.114) (-1908.495) (-1900.679) -- 0:00:39
866500 -- (-1905.659) (-1902.022) (-1903.896) [-1895.974] * (-1889.845) (-1898.325) (-1903.782) [-1898.761] -- 0:00:39
867000 -- (-1908.394) [-1895.719] (-1905.787) (-1901.880) * (-1903.494) (-1898.031) [-1904.790] (-1903.633) -- 0:00:39
867500 -- (-1894.427) [-1901.069] (-1905.763) (-1899.550) * [-1896.945] (-1897.448) (-1905.443) (-1903.587) -- 0:00:39
868000 -- (-1893.380) (-1897.165) (-1902.954) [-1894.675] * (-1903.547) [-1895.051] (-1905.508) (-1899.033) -- 0:00:39
868500 -- [-1892.306] (-1892.574) (-1891.297) (-1901.430) * (-1914.047) (-1903.519) [-1906.882] (-1891.182) -- 0:00:38
869000 -- (-1894.380) [-1895.867] (-1906.859) (-1899.274) * (-1898.675) [-1900.626] (-1905.969) (-1897.803) -- 0:00:38
869500 -- [-1898.332] (-1902.319) (-1898.799) (-1895.351) * (-1902.678) [-1898.272] (-1901.225) (-1899.435) -- 0:00:38
870000 -- (-1909.120) [-1893.855] (-1896.296) (-1893.413) * [-1895.878] (-1895.284) (-1910.841) (-1905.580) -- 0:00:38
Average standard deviation of split frequencies: 0.003249
870500 -- (-1897.281) [-1896.678] (-1895.434) (-1891.673) * (-1894.515) [-1902.149] (-1894.565) (-1901.961) -- 0:00:38
871000 -- (-1902.555) (-1901.882) (-1895.926) [-1893.922] * (-1892.055) [-1894.467] (-1904.531) (-1896.587) -- 0:00:38
871500 -- (-1897.439) [-1894.272] (-1895.228) (-1896.589) * (-1895.934) (-1897.358) (-1904.269) [-1889.680] -- 0:00:38
872000 -- (-1907.154) (-1901.922) (-1893.579) [-1888.825] * (-1904.732) (-1894.469) (-1899.619) [-1897.779] -- 0:00:37
872500 -- (-1901.288) [-1895.729] (-1897.522) (-1897.718) * (-1905.611) (-1895.248) [-1891.809] (-1898.451) -- 0:00:37
873000 -- (-1901.785) [-1898.524] (-1902.271) (-1904.466) * (-1903.242) (-1899.904) [-1892.546] (-1899.769) -- 0:00:37
873500 -- (-1899.398) (-1900.355) [-1898.568] (-1902.100) * [-1899.315] (-1897.144) (-1896.617) (-1907.449) -- 0:00:37
874000 -- (-1901.341) (-1899.076) [-1890.663] (-1898.476) * (-1900.976) (-1897.654) (-1894.468) [-1900.728] -- 0:00:37
874500 -- (-1894.293) (-1914.501) (-1893.831) [-1894.795] * (-1895.705) (-1894.774) [-1899.192] (-1902.343) -- 0:00:37
875000 -- (-1893.404) (-1904.601) [-1891.843] (-1898.942) * (-1897.550) (-1904.647) [-1901.469] (-1904.371) -- 0:00:37
Average standard deviation of split frequencies: 0.003229
875500 -- (-1893.705) (-1902.879) (-1903.992) [-1894.211] * (-1901.482) [-1896.617] (-1907.446) (-1899.803) -- 0:00:36
876000 -- (-1901.798) (-1899.574) (-1900.437) [-1894.080] * (-1900.603) (-1906.938) [-1894.830] (-1909.150) -- 0:00:36
876500 -- (-1894.928) (-1897.963) (-1900.115) [-1896.338] * [-1901.391] (-1900.512) (-1906.797) (-1897.690) -- 0:00:36
877000 -- [-1896.633] (-1898.359) (-1896.617) (-1897.843) * [-1896.340] (-1897.975) (-1902.315) (-1903.767) -- 0:00:36
877500 -- (-1896.893) (-1898.577) (-1907.172) [-1896.610] * (-1901.685) (-1893.385) (-1905.503) [-1895.196] -- 0:00:36
878000 -- [-1897.958] (-1897.659) (-1896.657) (-1903.103) * (-1902.566) (-1899.500) [-1892.813] (-1901.206) -- 0:00:36
878500 -- [-1898.382] (-1903.483) (-1900.629) (-1891.821) * (-1903.317) [-1893.626] (-1898.005) (-1908.134) -- 0:00:35
879000 -- (-1896.049) (-1899.655) [-1893.590] (-1897.944) * [-1894.536] (-1902.762) (-1896.805) (-1904.007) -- 0:00:35
879500 -- (-1905.403) [-1898.677] (-1900.095) (-1897.741) * (-1898.554) (-1902.062) (-1894.736) [-1892.548] -- 0:00:35
880000 -- (-1897.518) (-1901.633) [-1899.859] (-1896.487) * [-1894.223] (-1900.365) (-1905.875) (-1902.233) -- 0:00:35
Average standard deviation of split frequencies: 0.003426
880500 -- (-1897.367) (-1902.792) [-1891.146] (-1900.390) * (-1896.740) (-1897.543) (-1905.480) [-1893.693] -- 0:00:35
881000 -- (-1889.225) (-1904.593) [-1891.397] (-1901.046) * (-1896.635) (-1902.662) (-1908.392) [-1893.841] -- 0:00:35
881500 -- [-1896.391] (-1903.141) (-1900.169) (-1899.743) * (-1896.831) (-1907.997) (-1895.295) [-1894.768] -- 0:00:35
882000 -- (-1902.193) (-1894.461) [-1897.335] (-1895.163) * [-1896.666] (-1896.192) (-1903.106) (-1900.224) -- 0:00:34
882500 -- (-1899.847) [-1895.030] (-1903.092) (-1896.282) * (-1899.853) (-1896.566) [-1897.388] (-1889.678) -- 0:00:34
883000 -- [-1896.174] (-1902.770) (-1907.752) (-1894.755) * (-1906.482) [-1896.243] (-1906.488) (-1903.233) -- 0:00:34
883500 -- (-1907.636) (-1917.477) (-1894.491) [-1896.155] * (-1897.649) (-1905.932) [-1893.712] (-1909.153) -- 0:00:34
884000 -- [-1899.232] (-1902.933) (-1897.946) (-1904.021) * [-1892.153] (-1897.001) (-1897.846) (-1910.934) -- 0:00:34
884500 -- (-1905.377) (-1894.873) (-1890.154) [-1906.065] * (-1893.771) [-1895.209] (-1903.171) (-1906.987) -- 0:00:34
885000 -- (-1918.359) (-1903.427) [-1900.925] (-1898.916) * [-1894.675] (-1901.377) (-1899.289) (-1901.464) -- 0:00:34
Average standard deviation of split frequencies: 0.003405
885500 -- (-1897.050) (-1899.420) (-1902.647) [-1896.807] * (-1899.521) [-1897.528] (-1893.017) (-1893.794) -- 0:00:33
886000 -- (-1903.063) (-1892.437) (-1897.740) [-1892.938] * (-1897.632) (-1905.164) [-1895.339] (-1895.654) -- 0:00:33
886500 -- (-1905.562) (-1895.323) [-1899.675] (-1897.233) * (-1908.673) (-1903.279) (-1895.453) [-1894.849] -- 0:00:33
887000 -- (-1897.316) (-1906.671) (-1902.831) [-1891.733] * [-1891.757] (-1892.664) (-1895.624) (-1904.115) -- 0:00:33
887500 -- [-1891.975] (-1893.334) (-1907.871) (-1905.328) * (-1904.488) (-1891.881) (-1904.376) [-1896.750] -- 0:00:33
888000 -- [-1897.955] (-1901.857) (-1909.845) (-1903.705) * (-1896.180) (-1898.503) [-1906.328] (-1892.115) -- 0:00:33
888500 -- [-1898.448] (-1898.744) (-1902.513) (-1902.466) * (-1900.951) [-1894.512] (-1898.564) (-1900.482) -- 0:00:33
889000 -- (-1902.087) [-1895.034] (-1898.722) (-1911.591) * (-1903.175) [-1893.104] (-1905.575) (-1899.599) -- 0:00:32
889500 -- (-1895.852) (-1907.699) (-1896.631) [-1898.497] * (-1898.595) (-1910.284) (-1901.619) [-1899.353] -- 0:00:32
890000 -- [-1891.733] (-1897.320) (-1898.388) (-1900.266) * (-1897.963) [-1904.040] (-1897.785) (-1911.248) -- 0:00:32
Average standard deviation of split frequencies: 0.003599
890500 -- [-1890.347] (-1894.049) (-1900.135) (-1906.245) * (-1911.456) (-1909.168) [-1901.754] (-1901.816) -- 0:00:32
891000 -- [-1898.818] (-1897.293) (-1901.769) (-1897.115) * (-1900.185) (-1911.403) (-1899.785) [-1892.364] -- 0:00:32
891500 -- (-1897.837) [-1897.265] (-1901.743) (-1901.708) * (-1902.870) (-1898.749) [-1889.984] (-1889.910) -- 0:00:32
892000 -- [-1894.199] (-1909.732) (-1903.031) (-1896.759) * (-1909.566) (-1895.451) (-1890.542) [-1894.722] -- 0:00:31
892500 -- (-1909.132) (-1906.229) [-1897.640] (-1907.504) * (-1896.209) (-1897.189) [-1895.535] (-1902.593) -- 0:00:31
893000 -- [-1896.334] (-1894.875) (-1895.147) (-1894.734) * (-1901.862) (-1909.973) (-1899.907) [-1900.642] -- 0:00:31
893500 -- (-1897.579) (-1899.487) [-1897.464] (-1895.717) * (-1898.625) (-1902.114) [-1896.646] (-1908.143) -- 0:00:31
894000 -- (-1899.921) [-1894.228] (-1896.894) (-1900.639) * (-1899.468) (-1898.109) (-1902.267) [-1899.686] -- 0:00:31
894500 -- (-1906.762) [-1889.901] (-1900.138) (-1909.914) * [-1895.656] (-1897.221) (-1902.358) (-1902.044) -- 0:00:31
895000 -- [-1895.489] (-1897.795) (-1899.369) (-1900.479) * [-1899.524] (-1893.653) (-1899.914) (-1907.405) -- 0:00:31
Average standard deviation of split frequencies: 0.003578
895500 -- (-1895.789) (-1899.176) (-1898.823) [-1892.039] * (-1893.709) (-1891.832) (-1906.580) [-1889.124] -- 0:00:30
896000 -- (-1900.803) (-1901.879) (-1900.226) [-1894.307] * (-1899.337) [-1897.351] (-1905.358) (-1901.094) -- 0:00:30
896500 -- (-1900.498) (-1902.979) [-1893.677] (-1896.971) * (-1896.576) (-1892.712) [-1901.726] (-1893.548) -- 0:00:30
897000 -- [-1901.269] (-1899.711) (-1916.576) (-1904.064) * (-1900.388) (-1896.688) (-1898.466) [-1894.234] -- 0:00:30
897500 -- (-1896.849) (-1903.968) (-1902.901) [-1895.602] * (-1903.398) (-1897.658) (-1901.958) [-1895.305] -- 0:00:30
898000 -- [-1894.116] (-1902.875) (-1899.522) (-1898.782) * (-1906.618) [-1904.217] (-1897.679) (-1894.372) -- 0:00:30
898500 -- (-1904.679) (-1904.437) (-1900.350) [-1895.581] * [-1891.677] (-1898.961) (-1899.152) (-1892.755) -- 0:00:30
899000 -- (-1893.845) [-1896.444] (-1897.995) (-1897.295) * (-1903.629) [-1901.417] (-1896.259) (-1897.468) -- 0:00:29
899500 -- (-1893.897) (-1896.157) (-1900.345) [-1900.198] * [-1890.112] (-1897.361) (-1894.947) (-1899.734) -- 0:00:29
900000 -- [-1900.081] (-1897.121) (-1909.348) (-1904.468) * [-1895.002] (-1905.840) (-1901.847) (-1913.674) -- 0:00:29
Average standard deviation of split frequencies: 0.003768
900500 -- (-1897.400) [-1901.486] (-1898.632) (-1909.562) * (-1903.724) (-1896.743) [-1893.158] (-1902.460) -- 0:00:29
901000 -- (-1898.632) (-1901.408) (-1905.246) [-1896.250] * (-1894.891) (-1893.405) [-1899.671] (-1897.143) -- 0:00:29
901500 -- (-1906.288) (-1901.953) [-1893.331] (-1894.330) * (-1906.892) (-1902.293) (-1900.814) [-1890.329] -- 0:00:29
902000 -- (-1902.579) (-1899.091) [-1905.096] (-1901.169) * (-1900.694) [-1896.049] (-1912.524) (-1895.450) -- 0:00:29
902500 -- [-1896.247] (-1899.622) (-1907.780) (-1894.061) * (-1898.867) (-1891.908) (-1909.376) [-1899.461] -- 0:00:28
903000 -- [-1894.979] (-1894.143) (-1895.136) (-1899.204) * [-1898.433] (-1901.526) (-1911.581) (-1894.506) -- 0:00:28
903500 -- (-1889.384) [-1902.147] (-1901.723) (-1899.433) * (-1899.189) [-1895.625] (-1903.722) (-1899.616) -- 0:00:28
904000 -- (-1893.389) [-1907.543] (-1897.134) (-1902.260) * [-1895.846] (-1895.784) (-1904.463) (-1900.339) -- 0:00:28
904500 -- (-1898.607) (-1905.432) (-1899.132) [-1895.751] * (-1894.787) (-1895.030) (-1902.482) [-1899.496] -- 0:00:28
905000 -- (-1898.625) (-1902.474) [-1896.689] (-1897.668) * (-1898.843) (-1907.732) (-1907.012) [-1897.392] -- 0:00:28
Average standard deviation of split frequencies: 0.003226
905500 -- [-1890.578] (-1900.617) (-1893.828) (-1897.336) * (-1891.318) [-1893.873] (-1903.388) (-1897.497) -- 0:00:27
906000 -- (-1897.964) [-1896.815] (-1901.546) (-1891.183) * (-1895.049) (-1899.147) [-1897.928] (-1891.868) -- 0:00:27
906500 -- (-1893.384) [-1898.525] (-1911.660) (-1897.157) * (-1907.995) (-1893.636) (-1894.244) [-1900.146] -- 0:00:27
907000 -- (-1903.290) (-1895.240) (-1900.099) [-1902.397] * (-1901.604) [-1898.207] (-1906.855) (-1899.508) -- 0:00:27
907500 -- (-1908.403) [-1893.838] (-1894.981) (-1898.768) * (-1903.823) (-1905.390) [-1909.854] (-1894.422) -- 0:00:27
908000 -- [-1897.347] (-1907.829) (-1898.834) (-1904.440) * (-1896.470) (-1895.443) [-1906.489] (-1897.910) -- 0:00:27
908500 -- (-1894.082) [-1897.662] (-1905.466) (-1896.798) * (-1891.548) [-1894.976] (-1899.411) (-1895.339) -- 0:00:27
909000 -- (-1888.708) [-1895.000] (-1894.963) (-1907.875) * (-1909.088) (-1901.545) [-1899.205] (-1898.738) -- 0:00:26
909500 -- [-1898.449] (-1896.537) (-1895.585) (-1897.850) * (-1899.558) (-1902.341) (-1909.147) [-1903.788] -- 0:00:26
910000 -- (-1898.412) (-1895.563) (-1899.288) [-1893.831] * (-1905.081) (-1900.878) (-1896.275) [-1900.449] -- 0:00:26
Average standard deviation of split frequencies: 0.003002
910500 -- [-1893.670] (-1895.583) (-1911.677) (-1906.412) * (-1898.205) (-1899.766) (-1903.480) [-1900.226] -- 0:00:26
911000 -- (-1900.973) [-1894.934] (-1901.403) (-1896.873) * (-1891.658) [-1895.849] (-1897.172) (-1909.844) -- 0:00:26
911500 -- (-1907.349) (-1909.651) (-1895.735) [-1897.911] * (-1900.628) [-1899.646] (-1899.011) (-1900.737) -- 0:00:26
912000 -- (-1903.188) [-1893.381] (-1896.605) (-1900.912) * (-1897.770) [-1898.953] (-1896.560) (-1897.260) -- 0:00:26
912500 -- (-1903.375) [-1892.113] (-1898.143) (-1899.728) * (-1895.611) (-1892.684) [-1901.076] (-1901.099) -- 0:00:25
913000 -- [-1895.786] (-1894.244) (-1902.673) (-1902.229) * (-1901.120) (-1893.411) [-1899.584] (-1897.922) -- 0:00:25
913500 -- (-1898.127) [-1898.658] (-1899.148) (-1894.074) * (-1899.905) (-1899.083) (-1899.003) [-1895.888] -- 0:00:25
914000 -- [-1899.360] (-1902.589) (-1896.947) (-1897.369) * (-1897.331) (-1899.538) [-1899.274] (-1893.991) -- 0:00:25
914500 -- [-1901.226] (-1894.230) (-1901.358) (-1900.006) * (-1902.365) [-1900.587] (-1900.544) (-1901.475) -- 0:00:25
915000 -- (-1901.593) (-1898.597) (-1908.466) [-1898.718] * (-1899.189) (-1900.282) (-1899.450) [-1896.240] -- 0:00:25
Average standard deviation of split frequencies: 0.003088
915500 -- (-1903.942) (-1895.625) (-1908.729) [-1899.313] * (-1901.230) (-1900.910) [-1892.140] (-1907.478) -- 0:00:25
916000 -- [-1899.387] (-1895.584) (-1897.702) (-1913.624) * (-1901.417) (-1899.597) [-1894.143] (-1908.350) -- 0:00:24
916500 -- [-1895.484] (-1902.054) (-1901.116) (-1905.640) * [-1896.615] (-1896.299) (-1901.653) (-1904.078) -- 0:00:24
917000 -- [-1891.627] (-1903.264) (-1900.126) (-1901.507) * (-1901.915) (-1895.342) [-1899.817] (-1897.700) -- 0:00:24
917500 -- [-1898.666] (-1899.104) (-1905.339) (-1899.740) * (-1899.412) [-1896.475] (-1899.484) (-1890.326) -- 0:00:24
918000 -- (-1900.565) (-1896.026) (-1895.223) [-1900.238] * (-1897.934) (-1900.807) (-1903.500) [-1901.945] -- 0:00:24
918500 -- (-1893.330) (-1897.630) (-1901.898) [-1897.889] * (-1906.336) [-1898.496] (-1898.514) (-1906.423) -- 0:00:24
919000 -- (-1911.918) (-1894.696) (-1896.917) [-1896.835] * (-1900.611) (-1908.704) [-1898.793] (-1900.815) -- 0:00:23
919500 -- (-1893.888) (-1904.522) [-1893.983] (-1893.887) * (-1901.599) (-1893.713) (-1905.784) [-1898.037] -- 0:00:23
920000 -- [-1908.848] (-1906.311) (-1899.004) (-1894.978) * (-1899.019) [-1896.222] (-1902.053) (-1899.572) -- 0:00:23
Average standard deviation of split frequencies: 0.003175
920500 -- (-1902.045) (-1899.113) (-1893.761) [-1900.326] * (-1903.673) (-1899.850) (-1903.685) [-1897.133] -- 0:00:23
921000 -- (-1899.183) (-1897.416) [-1895.478] (-1896.110) * (-1899.494) (-1900.689) (-1899.129) [-1901.532] -- 0:00:23
921500 -- (-1899.126) (-1897.869) [-1899.114] (-1894.197) * (-1895.203) [-1899.284] (-1898.763) (-1897.577) -- 0:00:23
922000 -- (-1901.950) (-1896.692) [-1899.080] (-1908.195) * (-1909.796) (-1895.866) [-1893.028] (-1900.416) -- 0:00:23
922500 -- (-1901.629) [-1894.667] (-1896.642) (-1896.357) * (-1900.950) (-1907.698) [-1895.126] (-1907.202) -- 0:00:22
923000 -- (-1902.847) (-1899.749) (-1905.633) [-1895.043] * (-1898.702) (-1908.288) (-1899.947) [-1897.160] -- 0:00:22
923500 -- (-1901.739) [-1895.250] (-1892.704) (-1909.922) * (-1897.571) (-1903.150) [-1895.435] (-1891.847) -- 0:00:22
924000 -- (-1900.270) [-1897.446] (-1895.230) (-1899.518) * (-1898.497) [-1898.820] (-1900.690) (-1895.563) -- 0:00:22
924500 -- (-1907.330) (-1894.206) [-1902.198] (-1896.058) * (-1891.214) (-1899.700) (-1899.982) [-1893.787] -- 0:00:22
925000 -- (-1902.472) [-1896.947] (-1899.144) (-1896.663) * [-1895.879] (-1897.868) (-1905.301) (-1904.602) -- 0:00:22
Average standard deviation of split frequencies: 0.003462
925500 -- (-1903.853) (-1901.406) (-1900.015) [-1894.395] * [-1898.184] (-1899.229) (-1895.479) (-1900.782) -- 0:00:22
926000 -- (-1901.436) [-1897.300] (-1901.121) (-1895.644) * [-1894.668] (-1905.848) (-1900.092) (-1894.210) -- 0:00:21
926500 -- [-1893.396] (-1903.978) (-1895.894) (-1894.373) * (-1897.822) (-1894.471) [-1898.878] (-1896.040) -- 0:00:21
927000 -- (-1893.695) (-1894.988) [-1893.090] (-1903.719) * (-1908.504) (-1901.672) [-1896.224] (-1897.093) -- 0:00:21
927500 -- [-1893.956] (-1900.182) (-1902.475) (-1907.938) * (-1900.084) (-1903.176) [-1894.187] (-1895.372) -- 0:00:21
928000 -- [-1902.083] (-1903.917) (-1901.333) (-1904.226) * (-1910.763) (-1900.824) (-1892.442) [-1901.129] -- 0:00:21
928500 -- [-1903.797] (-1895.081) (-1900.740) (-1914.235) * [-1890.663] (-1899.060) (-1894.754) (-1902.648) -- 0:00:21
929000 -- [-1900.134] (-1897.064) (-1915.684) (-1904.122) * (-1903.013) (-1893.900) (-1905.828) [-1895.958] -- 0:00:21
929500 -- (-1898.699) (-1895.348) (-1901.192) [-1892.872] * (-1898.322) (-1901.437) (-1904.365) [-1897.293] -- 0:00:20
930000 -- [-1899.751] (-1902.415) (-1897.277) (-1898.578) * (-1893.108) (-1902.134) [-1911.644] (-1902.095) -- 0:00:20
Average standard deviation of split frequencies: 0.003242
930500 -- (-1900.805) (-1904.508) [-1893.075] (-1899.150) * [-1892.534] (-1900.654) (-1908.708) (-1910.999) -- 0:00:20
931000 -- (-1908.120) [-1901.936] (-1893.811) (-1897.072) * [-1889.752] (-1902.221) (-1902.104) (-1901.869) -- 0:00:20
931500 -- (-1906.133) (-1897.973) (-1898.473) [-1897.552] * (-1901.174) [-1904.262] (-1892.500) (-1901.845) -- 0:00:20
932000 -- (-1904.659) (-1900.985) (-1898.816) [-1892.422] * [-1902.412] (-1900.014) (-1900.644) (-1899.434) -- 0:00:20
932500 -- [-1897.804] (-1896.730) (-1902.565) (-1903.364) * [-1893.995] (-1894.820) (-1905.733) (-1899.299) -- 0:00:19
933000 -- (-1896.018) (-1893.984) [-1895.248] (-1903.147) * (-1898.617) (-1899.112) (-1900.258) [-1894.015] -- 0:00:19
933500 -- (-1897.747) (-1898.946) [-1891.924] (-1903.208) * (-1896.125) (-1902.969) (-1909.302) [-1898.655] -- 0:00:19
934000 -- (-1896.297) (-1897.666) (-1901.736) [-1894.011] * (-1892.166) [-1901.669] (-1895.675) (-1895.816) -- 0:00:19
934500 -- (-1897.655) (-1900.299) [-1897.329] (-1897.629) * [-1896.195] (-1900.098) (-1904.091) (-1902.594) -- 0:00:19
935000 -- [-1897.514] (-1903.890) (-1903.085) (-1894.024) * (-1901.611) (-1895.119) (-1905.129) [-1898.929] -- 0:00:19
Average standard deviation of split frequencies: 0.003223
935500 -- (-1899.238) (-1897.705) (-1902.428) [-1892.878] * (-1909.565) (-1896.612) (-1903.295) [-1897.901] -- 0:00:19
936000 -- [-1897.701] (-1897.570) (-1897.490) (-1899.461) * (-1897.320) (-1902.795) [-1900.717] (-1900.029) -- 0:00:18
936500 -- (-1897.141) (-1904.507) [-1893.393] (-1907.276) * (-1897.440) (-1906.211) (-1893.210) [-1902.356] -- 0:00:18
937000 -- (-1908.045) [-1895.393] (-1903.353) (-1901.555) * (-1905.455) (-1895.923) (-1893.239) [-1892.706] -- 0:00:18
937500 -- (-1894.248) (-1895.567) [-1895.598] (-1896.587) * (-1899.529) (-1905.359) [-1892.755] (-1893.208) -- 0:00:18
938000 -- (-1901.917) (-1893.587) [-1892.239] (-1900.180) * (-1893.632) (-1901.716) (-1900.408) [-1894.214] -- 0:00:18
938500 -- (-1902.447) (-1895.749) [-1897.797] (-1889.564) * (-1897.509) [-1895.900] (-1901.060) (-1900.329) -- 0:00:18
939000 -- (-1894.689) (-1897.638) [-1891.100] (-1900.830) * (-1906.982) [-1892.804] (-1894.950) (-1894.171) -- 0:00:18
939500 -- [-1896.031] (-1902.064) (-1895.387) (-1903.368) * (-1894.013) (-1897.612) [-1896.288] (-1895.396) -- 0:00:17
940000 -- (-1896.889) [-1901.942] (-1894.962) (-1903.729) * [-1895.627] (-1889.380) (-1905.044) (-1899.371) -- 0:00:17
Average standard deviation of split frequencies: 0.003308
940500 -- (-1895.146) (-1900.582) (-1897.316) [-1900.268] * (-1902.844) [-1896.394] (-1904.009) (-1900.848) -- 0:00:17
941000 -- (-1895.186) [-1891.853] (-1899.290) (-1895.507) * (-1900.485) (-1903.308) [-1893.315] (-1898.305) -- 0:00:17
941500 -- (-1904.570) (-1901.417) [-1891.437] (-1903.402) * (-1899.290) (-1910.706) (-1896.820) [-1899.991] -- 0:00:17
942000 -- (-1893.359) (-1913.885) (-1897.813) [-1897.933] * (-1903.508) (-1903.998) (-1902.913) [-1894.374] -- 0:00:17
942500 -- (-1896.891) (-1899.339) [-1896.714] (-1902.030) * [-1896.756] (-1898.353) (-1898.177) (-1897.459) -- 0:00:17
943000 -- [-1893.541] (-1911.135) (-1894.790) (-1897.610) * (-1909.619) (-1894.330) (-1902.560) [-1893.990] -- 0:00:16
943500 -- (-1894.150) (-1902.929) [-1892.967] (-1910.410) * [-1898.007] (-1903.184) (-1904.058) (-1902.885) -- 0:00:16
944000 -- (-1902.552) (-1899.459) [-1897.110] (-1901.960) * [-1894.760] (-1897.422) (-1895.117) (-1893.558) -- 0:00:16
944500 -- [-1900.812] (-1900.387) (-1901.396) (-1902.455) * (-1904.765) [-1903.670] (-1893.718) (-1892.015) -- 0:00:16
945000 -- [-1897.746] (-1895.510) (-1899.596) (-1902.480) * [-1900.115] (-1902.330) (-1895.007) (-1898.499) -- 0:00:16
Average standard deviation of split frequencies: 0.003389
945500 -- [-1901.862] (-1904.214) (-1902.390) (-1897.758) * (-1907.922) (-1902.090) [-1896.133] (-1899.069) -- 0:00:16
946000 -- (-1894.671) [-1906.156] (-1895.860) (-1896.079) * (-1903.621) (-1902.056) [-1893.055] (-1902.524) -- 0:00:15
946500 -- [-1895.410] (-1899.633) (-1897.640) (-1901.949) * (-1904.768) (-1895.435) [-1896.029] (-1896.139) -- 0:00:15
947000 -- (-1900.358) (-1913.594) [-1895.045] (-1896.296) * (-1909.129) (-1899.081) [-1894.624] (-1895.015) -- 0:00:15
947500 -- [-1895.257] (-1898.117) (-1907.211) (-1897.487) * (-1905.092) (-1888.991) [-1900.129] (-1904.745) -- 0:00:15
948000 -- (-1908.948) (-1897.932) [-1895.069] (-1903.399) * (-1902.734) (-1896.454) [-1897.018] (-1897.718) -- 0:00:15
948500 -- (-1902.488) [-1900.380] (-1894.979) (-1902.107) * [-1896.904] (-1893.146) (-1897.660) (-1902.516) -- 0:00:15
949000 -- (-1893.627) (-1894.110) (-1903.118) [-1896.996] * (-1894.165) (-1903.440) [-1900.561] (-1897.408) -- 0:00:15
949500 -- (-1901.030) (-1903.345) (-1900.785) [-1891.490] * [-1893.725] (-1904.921) (-1904.061) (-1900.675) -- 0:00:14
950000 -- (-1895.978) (-1898.777) (-1899.418) [-1894.436] * (-1895.664) (-1902.479) (-1892.790) [-1894.293] -- 0:00:14
Average standard deviation of split frequencies: 0.003471
950500 -- (-1901.166) (-1909.468) (-1897.318) [-1893.459] * (-1895.135) (-1902.219) (-1898.600) [-1897.178] -- 0:00:14
951000 -- (-1896.055) (-1901.156) [-1901.376] (-1894.956) * [-1898.265] (-1900.118) (-1904.491) (-1899.430) -- 0:00:14
951500 -- (-1899.634) (-1899.871) (-1895.610) [-1893.536] * (-1888.145) (-1901.415) [-1894.126] (-1899.863) -- 0:00:14
952000 -- (-1896.232) (-1891.171) (-1896.179) [-1906.062] * (-1899.353) (-1900.429) [-1891.427] (-1906.155) -- 0:00:14
952500 -- (-1897.551) (-1899.229) (-1894.791) [-1904.728] * [-1898.926] (-1904.554) (-1894.364) (-1896.250) -- 0:00:14
953000 -- (-1898.800) (-1896.643) (-1890.686) [-1893.663] * (-1901.698) (-1893.939) [-1896.130] (-1901.377) -- 0:00:13
953500 -- (-1900.069) [-1899.979] (-1891.894) (-1895.748) * [-1893.358] (-1896.138) (-1895.039) (-1892.429) -- 0:00:13
954000 -- [-1891.756] (-1895.706) (-1902.051) (-1896.634) * (-1897.892) [-1903.617] (-1900.318) (-1900.302) -- 0:00:13
954500 -- (-1896.860) [-1896.117] (-1910.799) (-1909.145) * (-1898.480) (-1890.507) [-1898.240] (-1903.111) -- 0:00:13
955000 -- (-1909.927) [-1904.454] (-1899.840) (-1897.961) * [-1897.837] (-1895.412) (-1890.108) (-1899.760) -- 0:00:13
Average standard deviation of split frequencies: 0.003254
955500 -- (-1920.217) (-1906.147) [-1898.725] (-1900.081) * (-1899.239) (-1895.751) (-1899.979) [-1900.761] -- 0:00:13
956000 -- [-1905.859] (-1905.010) (-1906.982) (-1898.708) * (-1899.197) (-1903.780) [-1891.633] (-1905.857) -- 0:00:13
956500 -- (-1903.074) (-1902.041) (-1898.770) [-1897.115] * (-1894.351) (-1891.409) [-1899.108] (-1898.955) -- 0:00:12
957000 -- (-1903.790) [-1899.650] (-1891.639) (-1893.584) * [-1895.922] (-1900.789) (-1896.347) (-1908.185) -- 0:00:12
957500 -- (-1908.441) (-1899.484) [-1894.762] (-1896.396) * (-1899.605) (-1899.017) (-1893.511) [-1895.303] -- 0:00:12
958000 -- (-1909.579) (-1900.741) [-1900.226] (-1896.906) * [-1894.616] (-1901.055) (-1898.440) (-1895.804) -- 0:00:12
958500 -- [-1895.041] (-1901.174) (-1902.593) (-1901.417) * (-1898.687) (-1892.760) [-1894.838] (-1902.312) -- 0:00:12
959000 -- (-1904.380) (-1904.013) (-1904.723) [-1894.942] * (-1901.295) (-1908.413) [-1899.857] (-1901.120) -- 0:00:12
959500 -- (-1906.903) (-1898.489) [-1898.437] (-1900.478) * (-1906.934) [-1897.343] (-1891.607) (-1897.654) -- 0:00:11
960000 -- (-1899.689) (-1896.995) (-1900.339) [-1902.410] * [-1894.356] (-1897.972) (-1895.533) (-1896.484) -- 0:00:11
Average standard deviation of split frequencies: 0.003239
960500 -- (-1899.470) (-1900.700) [-1900.879] (-1893.626) * (-1892.697) (-1902.527) (-1899.061) [-1900.922] -- 0:00:11
961000 -- (-1897.292) (-1892.677) [-1899.953] (-1896.264) * (-1898.343) (-1903.070) (-1897.339) [-1897.643] -- 0:00:11
961500 -- (-1899.308) (-1898.891) [-1896.865] (-1903.402) * [-1898.613] (-1898.273) (-1900.933) (-1894.628) -- 0:00:11
962000 -- [-1893.056] (-1903.785) (-1892.715) (-1898.575) * (-1899.941) (-1901.741) [-1897.519] (-1900.193) -- 0:00:11
962500 -- (-1900.416) (-1901.056) [-1900.613] (-1899.219) * (-1897.586) (-1908.650) (-1904.520) [-1909.620] -- 0:00:11
963000 -- (-1902.544) (-1901.538) [-1894.060] (-1898.608) * (-1900.192) (-1898.931) [-1903.521] (-1898.658) -- 0:00:10
963500 -- [-1898.971] (-1907.352) (-1902.147) (-1895.878) * [-1893.584] (-1899.951) (-1898.993) (-1898.545) -- 0:00:10
964000 -- (-1905.057) (-1896.001) (-1898.409) [-1904.820] * (-1895.182) (-1905.485) (-1895.470) [-1896.925] -- 0:00:10
964500 -- [-1896.068] (-1895.792) (-1897.493) (-1896.237) * (-1896.839) [-1904.698] (-1895.354) (-1905.261) -- 0:00:10
965000 -- (-1896.698) (-1901.095) (-1905.114) [-1901.575] * [-1900.969] (-1900.257) (-1895.324) (-1898.910) -- 0:00:10
Average standard deviation of split frequencies: 0.003123
965500 -- (-1899.030) (-1901.413) (-1898.295) [-1897.299] * (-1902.705) (-1911.215) (-1896.985) [-1893.925] -- 0:00:10
966000 -- (-1899.112) [-1898.733] (-1907.028) (-1901.002) * (-1903.430) (-1907.998) (-1900.394) [-1895.069] -- 0:00:10
966500 -- (-1910.057) (-1890.805) (-1897.523) [-1900.170] * (-1910.307) (-1902.754) [-1899.131] (-1902.066) -- 0:00:09
967000 -- (-1900.517) (-1896.655) (-1895.945) [-1900.395] * (-1890.819) [-1895.655] (-1898.051) (-1897.083) -- 0:00:09
967500 -- [-1891.757] (-1902.989) (-1900.668) (-1902.077) * (-1895.509) (-1908.080) (-1902.203) [-1897.537] -- 0:00:09
968000 -- [-1896.623] (-1901.672) (-1908.308) (-1894.251) * (-1902.738) (-1898.158) [-1896.738] (-1908.653) -- 0:00:09
968500 -- (-1908.330) (-1894.208) [-1895.118] (-1893.103) * (-1893.629) (-1905.779) (-1904.014) [-1892.833] -- 0:00:09
969000 -- [-1892.841] (-1901.110) (-1900.755) (-1901.393) * (-1904.743) [-1897.576] (-1900.288) (-1897.874) -- 0:00:09
969500 -- (-1896.885) [-1901.540] (-1895.281) (-1904.391) * [-1897.736] (-1908.551) (-1893.458) (-1900.176) -- 0:00:09
970000 -- (-1897.294) (-1900.127) [-1895.031] (-1903.068) * (-1900.856) (-1903.836) [-1899.070] (-1902.662) -- 0:00:08
Average standard deviation of split frequencies: 0.003497
970500 -- (-1898.799) (-1896.651) (-1900.705) [-1906.551] * [-1900.111] (-1900.304) (-1892.888) (-1905.778) -- 0:00:08
971000 -- (-1895.320) (-1897.034) (-1900.447) [-1891.059] * (-1894.232) (-1903.334) [-1902.776] (-1898.119) -- 0:00:08
971500 -- (-1895.473) (-1909.095) [-1901.788] (-1909.031) * (-1892.949) [-1895.762] (-1899.874) (-1900.699) -- 0:00:08
972000 -- [-1900.910] (-1901.878) (-1906.522) (-1898.844) * (-1902.847) (-1903.301) [-1891.567] (-1900.873) -- 0:00:08
972500 -- (-1898.546) (-1891.586) [-1894.996] (-1903.797) * [-1887.778] (-1895.435) (-1892.258) (-1902.658) -- 0:00:08
973000 -- (-1905.814) (-1894.659) [-1893.973] (-1904.069) * (-1894.738) (-1895.420) [-1902.045] (-1897.779) -- 0:00:07
973500 -- (-1905.036) (-1899.192) [-1897.598] (-1900.964) * (-1901.440) (-1892.444) (-1900.820) [-1894.602] -- 0:00:07
974000 -- (-1896.651) [-1894.733] (-1898.462) (-1901.340) * (-1901.978) [-1894.936] (-1897.997) (-1899.672) -- 0:00:07
974500 -- (-1906.452) [-1896.764] (-1896.805) (-1898.653) * (-1899.172) [-1903.152] (-1896.282) (-1899.125) -- 0:00:07
975000 -- (-1899.277) (-1906.174) (-1898.052) [-1895.692] * (-1894.473) (-1890.197) [-1892.645] (-1898.828) -- 0:00:07
Average standard deviation of split frequencies: 0.003671
975500 -- (-1888.933) (-1908.770) (-1904.688) [-1893.738] * [-1894.741] (-1898.058) (-1896.315) (-1904.940) -- 0:00:07
976000 -- (-1904.489) (-1896.991) (-1901.542) [-1896.292] * [-1900.395] (-1896.580) (-1902.334) (-1902.735) -- 0:00:07
976500 -- (-1904.853) [-1899.162] (-1905.076) (-1903.189) * (-1897.068) (-1898.525) [-1895.705] (-1898.309) -- 0:00:06
977000 -- (-1896.806) (-1894.932) (-1897.946) [-1894.796] * (-1896.654) [-1897.394] (-1900.523) (-1897.692) -- 0:00:06
977500 -- (-1901.415) [-1898.543] (-1898.305) (-1899.958) * [-1896.366] (-1910.264) (-1897.817) (-1898.141) -- 0:00:06
978000 -- (-1902.847) (-1901.325) (-1900.377) [-1892.221] * (-1901.910) (-1891.025) [-1895.812] (-1896.402) -- 0:00:06
978500 -- (-1904.723) (-1896.645) [-1902.946] (-1894.137) * [-1893.028] (-1890.807) (-1896.041) (-1896.464) -- 0:00:06
979000 -- (-1902.166) (-1895.632) (-1901.944) [-1896.886] * [-1897.147] (-1900.957) (-1891.648) (-1893.684) -- 0:00:06
979500 -- [-1892.293] (-1892.704) (-1900.718) (-1908.360) * [-1893.001] (-1906.220) (-1900.501) (-1908.558) -- 0:00:06
980000 -- [-1890.714] (-1899.344) (-1903.128) (-1896.820) * (-1903.543) [-1892.782] (-1899.200) (-1899.337) -- 0:00:05
Average standard deviation of split frequencies: 0.003942
980500 -- [-1893.740] (-1903.284) (-1894.021) (-1903.468) * (-1895.647) (-1892.748) (-1900.079) [-1892.041] -- 0:00:05
981000 -- (-1904.501) (-1897.917) (-1897.411) [-1899.599] * [-1898.002] (-1901.502) (-1896.611) (-1895.120) -- 0:00:05
981500 -- (-1901.217) [-1892.838] (-1898.137) (-1896.684) * [-1897.013] (-1897.123) (-1900.205) (-1900.755) -- 0:00:05
982000 -- (-1905.524) [-1894.425] (-1900.220) (-1899.418) * [-1895.634] (-1899.099) (-1894.623) (-1901.428) -- 0:00:05
982500 -- (-1902.312) [-1891.351] (-1898.022) (-1898.930) * (-1896.072) [-1897.424] (-1898.613) (-1911.133) -- 0:00:05
983000 -- (-1906.912) [-1896.377] (-1900.011) (-1899.483) * [-1898.554] (-1899.168) (-1894.416) (-1907.579) -- 0:00:05
983500 -- (-1907.200) (-1898.711) (-1906.280) [-1897.034] * (-1896.545) [-1901.592] (-1895.934) (-1900.702) -- 0:00:04
984000 -- (-1906.627) [-1901.136] (-1907.295) (-1895.002) * [-1897.451] (-1894.367) (-1894.656) (-1897.900) -- 0:00:04
984500 -- (-1909.228) [-1905.723] (-1892.732) (-1896.140) * (-1900.771) (-1906.757) [-1899.113] (-1902.005) -- 0:00:04
985000 -- (-1905.878) (-1897.655) (-1890.245) [-1896.644] * (-1899.322) (-1896.373) (-1889.504) [-1900.141] -- 0:00:04
Average standard deviation of split frequencies: 0.003825
985500 -- (-1897.256) (-1910.120) [-1897.262] (-1899.363) * (-1899.657) [-1907.454] (-1903.819) (-1898.778) -- 0:00:04
986000 -- (-1900.770) (-1903.422) (-1903.341) [-1900.839] * (-1895.031) (-1892.118) [-1899.137] (-1902.463) -- 0:00:04
986500 -- (-1898.482) (-1903.150) (-1907.139) [-1898.808] * (-1896.362) [-1891.535] (-1896.189) (-1904.581) -- 0:00:03
987000 -- [-1894.015] (-1905.834) (-1897.412) (-1899.732) * (-1891.254) [-1893.497] (-1899.402) (-1908.006) -- 0:00:03
987500 -- [-1894.177] (-1898.714) (-1901.626) (-1905.330) * [-1893.532] (-1904.263) (-1893.800) (-1899.760) -- 0:00:03
988000 -- [-1895.953] (-1900.527) (-1896.142) (-1923.176) * [-1892.361] (-1900.930) (-1900.459) (-1897.349) -- 0:00:03
988500 -- [-1899.649] (-1902.599) (-1895.304) (-1908.337) * (-1900.313) (-1896.880) (-1893.762) [-1902.232] -- 0:00:03
989000 -- [-1890.950] (-1900.362) (-1905.342) (-1895.936) * (-1904.166) (-1899.065) [-1897.268] (-1908.264) -- 0:00:03
989500 -- (-1899.463) (-1895.484) (-1897.943) [-1892.068] * (-1910.926) (-1900.769) (-1900.314) [-1896.991] -- 0:00:03
990000 -- [-1897.005] (-1896.241) (-1901.213) (-1903.593) * [-1903.067] (-1894.286) (-1912.207) (-1897.864) -- 0:00:02
Average standard deviation of split frequencies: 0.003616
990500 -- [-1895.645] (-1896.385) (-1899.270) (-1903.803) * (-1894.662) (-1890.738) [-1904.808] (-1898.454) -- 0:00:02
991000 -- [-1895.936] (-1897.307) (-1898.901) (-1905.415) * (-1892.180) (-1903.083) (-1900.339) [-1897.337] -- 0:00:02
991500 -- [-1895.404] (-1903.327) (-1902.420) (-1900.369) * (-1896.760) (-1908.367) [-1899.773] (-1892.207) -- 0:00:02
992000 -- (-1900.964) (-1907.942) (-1905.037) [-1900.275] * [-1891.714] (-1901.318) (-1900.327) (-1894.715) -- 0:00:02
992500 -- (-1897.054) [-1895.460] (-1901.362) (-1899.432) * (-1896.307) (-1903.719) [-1897.096] (-1898.454) -- 0:00:02
993000 -- (-1896.060) (-1899.229) (-1901.821) [-1898.917] * [-1900.421] (-1893.396) (-1899.702) (-1889.311) -- 0:00:02
993500 -- (-1909.300) [-1894.424] (-1899.208) (-1896.735) * (-1898.731) [-1892.748] (-1901.123) (-1906.653) -- 0:00:01
994000 -- (-1902.748) (-1900.207) (-1903.098) [-1898.403] * (-1898.035) (-1897.187) [-1902.245] (-1907.101) -- 0:00:01
994500 -- [-1897.689] (-1903.789) (-1901.635) (-1901.412) * [-1896.675] (-1903.203) (-1897.658) (-1891.863) -- 0:00:01
995000 -- [-1906.045] (-1902.463) (-1907.104) (-1900.721) * [-1902.343] (-1902.146) (-1897.252) (-1897.905) -- 0:00:01
Average standard deviation of split frequencies: 0.003786
995500 -- (-1894.147) (-1898.816) (-1901.012) [-1896.158] * (-1894.094) (-1908.784) [-1894.968] (-1903.163) -- 0:00:01
996000 -- (-1903.657) (-1895.407) (-1907.007) [-1889.696] * (-1907.579) (-1904.725) [-1898.808] (-1899.377) -- 0:00:01
996500 -- (-1897.093) (-1908.040) (-1911.374) [-1895.176] * (-1893.401) [-1906.233] (-1901.761) (-1894.668) -- 0:00:01
997000 -- (-1896.854) (-1911.335) [-1897.898] (-1891.122) * [-1901.544] (-1901.129) (-1903.638) (-1896.166) -- 0:00:00
997500 -- (-1900.577) [-1900.320] (-1908.514) (-1897.053) * [-1895.755] (-1901.548) (-1898.166) (-1896.317) -- 0:00:00
998000 -- (-1899.875) (-1900.852) (-1915.496) [-1902.185] * (-1898.565) [-1894.507] (-1899.707) (-1893.970) -- 0:00:00
998500 -- [-1899.795] (-1906.842) (-1912.905) (-1895.841) * (-1899.287) [-1896.673] (-1898.374) (-1900.762) -- 0:00:00
999000 -- (-1902.712) (-1900.865) (-1905.179) [-1890.446] * (-1900.226) (-1896.913) (-1900.173) [-1895.579] -- 0:00:00
999500 -- (-1901.019) [-1906.043] (-1909.541) (-1896.922) * (-1902.261) [-1892.957] (-1898.006) (-1898.400) -- 0:00:00
1000000 -- [-1896.562] (-1904.205) (-1913.856) (-1904.671) * (-1900.096) [-1906.448] (-1908.294) (-1900.314) -- 0:00:00
Average standard deviation of split frequencies: 0.003580
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1896.562114 -- 19.165982
Chain 1 -- -1896.562106 -- 19.165982
Chain 2 -- -1904.204789 -- 16.553639
Chain 2 -- -1904.204779 -- 16.553639
Chain 3 -- -1913.856331 -- 14.026064
Chain 3 -- -1913.856346 -- 14.026064
Chain 4 -- -1904.671375 -- 16.379878
Chain 4 -- -1904.671388 -- 16.379878
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1900.096300 -- 17.336121
Chain 1 -- -1900.096295 -- 17.336121
Chain 2 -- -1906.447989 -- 18.174076
Chain 2 -- -1906.447990 -- 18.174076
Chain 3 -- -1908.294266 -- 16.871251
Chain 3 -- -1908.294267 -- 16.871251
Chain 4 -- -1900.314130 -- 17.211372
Chain 4 -- -1900.314130 -- 17.211372
Analysis completed in 4 mins 56 seconds
Analysis used 295.95 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1885.67
Likelihood of best state for "cold" chain of run 2 was -1885.67
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
48.3 % ( 41 %) Dirichlet(Revmat{all})
63.8 % ( 53 %) Slider(Revmat{all})
26.4 % ( 22 %) Dirichlet(Pi{all})
27.5 % ( 20 %) Slider(Pi{all})
40.6 % ( 21 %) Multiplier(Alpha{1,2})
43.4 % ( 21 %) Multiplier(Alpha{3})
49.0 % ( 26 %) Slider(Pinvar{all})
2.5 % ( 4 %) ExtSPR(Tau{all},V{all})
1.1 % ( 3 %) ExtTBR(Tau{all},V{all})
4.9 % ( 8 %) NNI(Tau{all},V{all})
7.1 % ( 2 %) ParsSPR(Tau{all},V{all})
26.5 % ( 21 %) Multiplier(V{all})
38.9 % ( 49 %) Nodeslider(V{all})
25.8 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
48.2 % ( 38 %) Dirichlet(Revmat{all})
63.7 % ( 51 %) Slider(Revmat{all})
26.0 % ( 23 %) Dirichlet(Pi{all})
27.3 % ( 22 %) Slider(Pi{all})
41.0 % ( 25 %) Multiplier(Alpha{1,2})
43.6 % ( 25 %) Multiplier(Alpha{3})
49.3 % ( 25 %) Slider(Pinvar{all})
2.6 % ( 2 %) ExtSPR(Tau{all},V{all})
1.2 % ( 1 %) ExtTBR(Tau{all},V{all})
4.9 % ( 8 %) NNI(Tau{all},V{all})
7.0 % ( 4 %) ParsSPR(Tau{all},V{all})
26.3 % ( 29 %) Multiplier(V{all})
38.8 % ( 39 %) Nodeslider(V{all})
25.9 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 167003 0.81 0.64
3 | 166503 166956 0.82
4 | 167240 165837 166461
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.47
2 | 166295 0.81 0.64
3 | 167250 167014 0.82
4 | 166616 166322 166503
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1895.26
| 2 21 |
| 2 1 |
| 2 1 2 1 21 1 |
| 21 1 1 1 2 1 2 2 * 1 1 * 1 |
| 2 12 1 * 1 2 2 2* 1 11 2 1 12 2 2 |
| 1 21 12 1 2 *111 1 * 22 1 2 2 1|
|2 2 2 2 1 1 12 22 *2 12 |
| 111 * 22 1 1 12 1 |
|1 1 1 2 2 2 2 2 2 |
| 2 2 2 1 1 2 1 2|
| 22 1 |
| 1 |
| |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1900.16
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1892.86 -1913.16
2 -1892.64 -1905.22
--------------------------------------
TOTAL -1892.74 -1912.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.622640 0.007367 0.470615 0.799569 0.616661 1230.47 1250.84 1.000
r(A<->C){all} 0.061553 0.000379 0.024971 0.098904 0.059773 867.93 947.58 1.000
r(A<->G){all} 0.208318 0.002052 0.122859 0.294304 0.205246 647.81 682.98 1.000
r(A<->T){all} 0.094312 0.001205 0.029639 0.160972 0.091193 769.17 803.41 1.000
r(C<->G){all} 0.046498 0.000215 0.019669 0.076278 0.045225 779.43 925.44 1.000
r(C<->T){all} 0.552384 0.003282 0.436473 0.658348 0.552570 583.70 608.00 1.000
r(G<->T){all} 0.036934 0.000396 0.000663 0.072862 0.034422 992.12 1019.57 1.000
pi(A){all} 0.252147 0.000231 0.222449 0.281511 0.252480 976.57 1164.33 1.000
pi(C){all} 0.326028 0.000260 0.294563 0.356868 0.325771 1024.92 1151.48 1.000
pi(G){all} 0.276330 0.000244 0.246633 0.307922 0.276300 1070.74 1281.55 1.000
pi(T){all} 0.145495 0.000142 0.122941 0.169674 0.145173 798.83 955.11 1.000
alpha{1,2} 0.080926 0.000834 0.010227 0.128168 0.084505 1073.45 1178.69 1.000
alpha{3} 2.869701 0.768841 1.382711 4.675005 2.747479 1501.00 1501.00 1.000
pinvar{all} 0.480376 0.003100 0.373632 0.590202 0.484480 1184.58 1267.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .....***
10 -- ...*****
11 -- .**.....
12 -- ...**...
13 -- .....*.*
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3001 0.999667 0.000471 0.999334 1.000000 2
11 3000 0.999334 0.000000 0.999334 0.999334 2
12 2968 0.988674 0.001884 0.987342 0.990007 2
13 2519 0.839107 0.015546 0.828115 0.850100 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.016227 0.000049 0.004451 0.030511 0.015272 1.000 2
length{all}[2] 0.032416 0.000107 0.013303 0.052260 0.031118 1.000 2
length{all}[3] 0.003077 0.000009 0.000001 0.009265 0.002168 1.000 2
length{all}[4] 0.043995 0.000179 0.018641 0.069618 0.042642 1.000 2
length{all}[5] 0.028334 0.000109 0.010880 0.049896 0.027096 1.000 2
length{all}[6] 0.063336 0.000434 0.025166 0.103149 0.061116 1.000 2
length{all}[7] 0.141036 0.001353 0.073826 0.211371 0.137546 1.000 2
length{all}[8] 0.104415 0.000750 0.053897 0.158499 0.101562 1.000 2
length{all}[9] 0.099546 0.000992 0.046697 0.165278 0.096097 1.000 2
length{all}[10] 0.025752 0.000131 0.005940 0.048431 0.024047 1.001 2
length{all}[11] 0.013218 0.000045 0.002030 0.025972 0.012220 1.000 2
length{all}[12] 0.021700 0.000114 0.003471 0.042865 0.020073 1.002 2
length{all}[13] 0.032834 0.000394 0.000039 0.068177 0.030174 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003580
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------ C4 (4)
| /-----------------99----------------+
| | \------------------ C5 (5)
| |
|-------100-------+ /------------------ C6 (6)
+ | /--------84-------+
| | | \------------------ C8 (8)
| \-------100-------+
| \------------------------------------ C7 (7)
|
| /------------------ C2 (2)
\-------------------------100-------------------------+
\------------------ C3 (3)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
| /------------ C4 (4)
| /----+
| | \-------- C5 (5)
| |
|------+ /----------------- C6 (6)
+ | /-------+
| | | \---------------------------- C8 (8)
| \--------------------------+
| \-------------------------------------- C7 (7)
|
| /--------- C2 (2)
\--+
\- C3 (3)
|------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (10 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 4 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 8 ls = 765
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sites with gaps or missing data are removed.
12 ambiguity characters in seq. 1
24 ambiguity characters in seq. 2
12 ambiguity characters in seq. 3
12 ambiguity characters in seq. 4
12 ambiguity characters in seq. 5
15 ambiguity characters in seq. 6
15 ambiguity characters in seq. 7
15 ambiguity characters in seq. 8
8 sites are removed. 232 233 234 235 252 253 254 255
Sequences read..
Counting site patterns.. 0:00
146 patterns at 247 / 247 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
142496 bytes for conP
19856 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
427488 bytes for conP, adjusted
0.022150 0.039773 0.023595 0.075420 0.036421 0.093452 0.057199 0.075563 0.156615 0.125561 0.017721 0.045807 0.000000 0.300000 1.300000
ntime & nrate & np: 13 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 15
lnL0 = -2125.668344
Iterating by ming2
Initial: fx= 2125.668344
x= 0.02215 0.03977 0.02359 0.07542 0.03642 0.09345 0.05720 0.07556 0.15662 0.12556 0.01772 0.04581 0.00000 0.30000 1.30000
1 h-m-p 0.0000 0.0000 389.7039 ++ 2125.667852 m 0.0000 20 | 1/15
2 h-m-p 0.0000 0.0000 5179.1575 +YCYYYCCCCC 2097.418375 9 0.0000 53 | 1/15
3 h-m-p 0.0000 0.0000 10107.7552 ++ 2065.790300 m 0.0000 71 | 1/15
4 h-m-p 0.0000 0.0000 30091.3126 +YYYYCCC 2047.204413 6 0.0000 98 | 1/15
5 h-m-p 0.0000 0.0000 17799.0146 +CYYCCC 2004.904336 5 0.0000 125 | 1/15
6 h-m-p 0.0000 0.0001 13178.6961 +YYYYCCCCC 1933.011190 8 0.0001 156 | 1/15
7 h-m-p 0.0000 0.0001 11981.7645 +YYCYYCCC 1737.091465 7 0.0001 186 | 1/15
8 h-m-p 0.0000 0.0001 320.1215 CYCCC 1736.285323 4 0.0000 211 | 1/15
9 h-m-p 0.0003 0.0013 30.4466 YCCC 1736.168189 3 0.0002 234 | 1/15
10 h-m-p 0.0005 0.0084 10.9391 +CCCC 1734.812974 3 0.0031 259 | 1/15
11 h-m-p 0.0006 0.0051 55.7429 YYCCC 1731.708960 4 0.0009 283 | 1/15
12 h-m-p 0.0003 0.0016 48.9642 +YYCCC 1726.397175 4 0.0011 308 | 1/15
13 h-m-p 0.0003 0.0014 88.1575 YCYCCC 1724.012360 5 0.0006 334 | 1/15
14 h-m-p 0.0002 0.0011 72.8283 YYYYC 1723.622813 4 0.0002 356 | 1/15
15 h-m-p 0.0045 0.0699 3.5092 YC 1723.614844 1 0.0008 375 | 1/15
16 h-m-p 0.0764 6.8285 0.0381 ++YCCCC 1714.177794 4 2.0945 402 | 1/15
17 h-m-p 0.7452 3.7260 0.0305 YCCCC 1711.608443 4 1.5901 441 | 1/15
18 h-m-p 1.0023 5.0115 0.0174 +YCYCC 1708.143306 4 3.0926 480 | 1/15
19 h-m-p 0.5966 2.9832 0.0531 YCCCC 1703.805891 4 1.2353 519 | 1/15
20 h-m-p 0.6807 3.4037 0.0405 YCCCC 1701.226196 4 1.4715 558 | 1/15
21 h-m-p 1.6000 8.0000 0.0194 CYC 1700.726461 2 1.4425 593 | 1/15
22 h-m-p 1.6000 8.0000 0.0125 YYC 1700.331679 2 1.3793 627 | 1/15
23 h-m-p 1.6000 8.0000 0.0090 CCC 1700.099722 2 2.1943 663 | 1/15
24 h-m-p 1.6000 8.0000 0.0057 CYC 1700.029987 2 1.5153 698 | 1/15
25 h-m-p 1.6000 8.0000 0.0031 YC 1699.972528 1 2.8191 731 | 1/15
26 h-m-p 1.6000 8.0000 0.0019 YC 1699.925341 1 3.1323 764 | 1/15
27 h-m-p 1.6000 8.0000 0.0026 CC 1699.901532 1 2.1716 798 | 1/15
28 h-m-p 1.6000 8.0000 0.0025 CC 1699.877203 1 2.2877 832 | 1/15
29 h-m-p 1.6000 8.0000 0.0012 CC 1699.871806 1 2.0815 866 | 1/15
30 h-m-p 1.6000 8.0000 0.0008 +YC 1699.861760 1 4.0033 900 | 1/15
31 h-m-p 1.6000 8.0000 0.0013 YC 1699.850626 1 2.8103 933 | 1/15
32 h-m-p 1.6000 8.0000 0.0011 C 1699.846595 0 1.6986 965 | 1/15
33 h-m-p 1.6000 8.0000 0.0002 C 1699.846431 0 1.4012 997 | 1/15
34 h-m-p 1.6000 8.0000 0.0001 +YC 1699.846338 1 4.1244 1031 | 1/15
35 h-m-p 1.6000 8.0000 0.0001 +Y 1699.846130 0 5.3478 1064 | 1/15
36 h-m-p 1.6000 8.0000 0.0001 YC 1699.845883 1 3.6740 1097 | 1/15
37 h-m-p 1.6000 8.0000 0.0002 C 1699.845836 0 1.2822 1129 | 1/15
38 h-m-p 1.6000 8.0000 0.0000 ---C 1699.845836 0 0.0063 1164 | 1/15
39 h-m-p 0.0160 8.0000 0.0067 +CC 1699.845535 1 0.0912 1199 | 1/15
40 h-m-p 1.6000 8.0000 0.0002 ++ 1699.841138 m 8.0000 1231 | 1/15
41 h-m-p 0.2037 8.0000 0.0084 +CC 1699.830490 1 1.0921 1266 | 1/15
42 h-m-p 1.6000 8.0000 0.0004 ++ 1699.824210 m 8.0000 1298 | 1/15
43 h-m-p 0.0698 8.0000 0.0426 ++YC 1699.735105 1 1.9475 1333 | 1/15
44 h-m-p 1.6000 8.0000 0.0310 ++ 1699.482540 m 8.0000 1365 | 1/15
45 h-m-p 1.6000 8.0000 0.0065 YCC 1699.457004 2 1.2140 1400 | 1/15
46 h-m-p 1.5362 8.0000 0.0051 Y 1699.456851 0 1.1830 1432 | 1/15
47 h-m-p 1.6000 8.0000 0.0003 Y 1699.456849 0 1.1581 1464 | 1/15
48 h-m-p 1.6000 8.0000 0.0002 ----------------.. | 1/15
49 h-m-p 0.0044 2.1950 0.0132 ------------ | 1/15
50 h-m-p 0.0044 2.1950 0.0132 ------------
Out..
lnL = -1699.456849
1595 lfun, 1595 eigenQcodon, 20735 P(t)
Time used: 0:08
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
0.022478 0.040158 0.022543 0.076708 0.034777 0.093114 0.057350 0.076287 0.157211 0.127128 0.016357 0.045752 0.000000 2.487205 0.700642 0.304419
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.117249
np = 16
lnL0 = -1872.041323
Iterating by ming2
Initial: fx= 1872.041323
x= 0.02248 0.04016 0.02254 0.07671 0.03478 0.09311 0.05735 0.07629 0.15721 0.12713 0.01636 0.04575 0.00000 2.48721 0.70064 0.30442
1 h-m-p 0.0000 0.0000 303.1748 ++ 1872.040598 m 0.0000 37 | 1/16
2 h-m-p 0.0000 0.0000 193682.5085 ++ 1715.147607 m 0.0000 72 | 1/16
3 h-m-p 0.0001 0.0004 231.6844 +YCCCC 1708.223871 4 0.0002 114 | 1/16
4 h-m-p 0.0001 0.0007 48.0441 CYCCC 1707.892931 4 0.0003 155 | 1/16
5 h-m-p 0.0001 0.0009 107.7531 +YCCC 1707.175703 3 0.0003 195 | 1/16
6 h-m-p 0.0026 0.0247 12.8246 YCCC 1706.808373 3 0.0019 234 | 1/16
7 h-m-p 0.0012 0.0100 20.2041 CCCC 1706.320720 3 0.0017 274 | 1/16
8 h-m-p 0.0011 0.0057 18.3171 CCCC 1705.958778 3 0.0014 314 | 1/16
9 h-m-p 0.0015 0.0120 16.7735 YYC 1705.772471 2 0.0013 350 | 1/16
10 h-m-p 0.0019 0.0094 11.6455 YCC 1705.711466 2 0.0010 387 | 1/16
11 h-m-p 0.0027 0.0173 4.3620 CC 1705.703957 1 0.0008 423 | 1/16
12 h-m-p 0.0026 0.1532 1.3894 YC 1705.701674 1 0.0016 458 | 1/16
13 h-m-p 0.0019 0.3456 1.1746 +YC 1705.684157 1 0.0120 494 | 1/16
14 h-m-p 0.0013 0.1448 10.8305 ++YYC 1705.426350 2 0.0177 532 | 1/16
15 h-m-p 0.0041 0.0512 46.4536 YC 1705.312265 1 0.0019 567 | 1/16
16 h-m-p 0.1851 0.9432 0.4733 CCC 1705.269213 2 0.0417 605 | 1/16
17 h-m-p 0.0014 0.0979 13.6362 ++CYC 1704.564628 2 0.0221 644 | 1/16
18 h-m-p 1.6000 8.0000 0.0314 +YCCC 1700.120882 3 5.5356 684 | 1/16
19 h-m-p 0.4197 2.0987 0.0978 +YYCCCC 1697.119081 5 1.3969 727 | 1/16
20 h-m-p 0.8087 4.0435 0.0720 YYC 1696.706965 2 0.6861 763 | 1/16
21 h-m-p 0.4145 3.5940 0.1192 CCC 1696.121544 2 0.5818 801 | 1/16
22 h-m-p 0.7938 3.9688 0.0255 YCYCCC 1694.606411 5 1.9016 843 | 1/16
23 h-m-p 0.4823 2.4117 0.0742 CCCCC 1694.191605 4 0.5843 885 | 1/16
24 h-m-p 0.5998 7.8401 0.0723 CCC 1694.047962 2 0.7797 923 | 1/16
25 h-m-p 1.6000 8.0000 0.0101 YC 1694.039758 1 0.6430 958 | 1/16
26 h-m-p 1.6000 8.0000 0.0026 CC 1694.039048 1 0.5546 994 | 1/16
27 h-m-p 0.5419 8.0000 0.0027 C 1694.038999 0 0.5419 1028 | 1/16
28 h-m-p 0.9696 8.0000 0.0015 Y 1694.038991 0 0.6449 1062 | 1/16
29 h-m-p 1.5203 8.0000 0.0006 Y 1694.038989 0 0.7248 1096 | 1/16
30 h-m-p 1.6000 8.0000 0.0002 C 1694.038989 0 0.4000 1130 | 1/16
31 h-m-p 1.6000 8.0000 0.0000 -------Y 1694.038989 0 0.0000 1171
Out..
lnL = -1694.038989
1172 lfun, 3516 eigenQcodon, 30472 P(t)
Time used: 0:20
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
initial w for M2:NSpselection reset.
0.029667 0.038561 0.022613 0.072365 0.039234 0.087043 0.058029 0.073314 0.149083 0.124940 0.022375 0.051153 0.000000 2.567586 0.878998 0.263736 0.186073 2.329016
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.998447
np = 18
lnL0 = -1912.292051
Iterating by ming2
Initial: fx= 1912.292051
x= 0.02967 0.03856 0.02261 0.07237 0.03923 0.08704 0.05803 0.07331 0.14908 0.12494 0.02238 0.05115 0.00000 2.56759 0.87900 0.26374 0.18607 2.32902
1 h-m-p 0.0000 0.0000 294.5066 ++ 1912.291198 m 0.0000 41 | 1/18
2 h-m-p 0.0000 0.0002 608.1616 +++ 1887.366606 m 0.0002 81 | 1/18
3 h-m-p 0.0000 0.0000 6869.8975
h-m-p: 4.88301438e-22 2.44150719e-21 6.86989749e+03 1887.366606
.. | 1/18
4 h-m-p 0.0000 0.0004 1017.1511 +++ 1858.079425 m 0.0004 155 | 2/18
5 h-m-p 0.0019 0.0834 210.6474 YCCCC 1799.408099 4 0.0035 200 | 1/18
6 h-m-p 0.0000 0.0002 97836.7711 -CCCCC 1796.820903 4 0.0000 246 | 1/18
7 h-m-p 0.0006 0.0056 100.4554 +YCCCCC 1770.207947 5 0.0048 295 | 1/18
8 h-m-p 0.0011 0.0057 126.3439 +YCCCC 1759.837927 4 0.0030 341 | 1/18
9 h-m-p 0.0018 0.0090 51.3667 YCCC 1756.215059 3 0.0043 384 | 1/18
10 h-m-p 0.0096 0.0479 13.8331 CYCCC 1755.672666 4 0.0066 429 | 1/18
11 h-m-p 0.0046 0.0575 20.0979 ++ 1751.489142 m 0.0575 467 | 1/18
12 h-m-p 0.0000 0.0000 134.9621
h-m-p: 1.57258140e-19 7.86290702e-19 1.34962059e+02 1751.489142
.. | 1/18
13 h-m-p 0.0000 0.0041 180.9775 CYC 1751.435881 2 0.0000 543 | 1/18
14 h-m-p 0.0000 0.0034 86.7743 ++++YYCYCCC 1739.959647 6 0.0028 594 | 1/18
15 h-m-p 0.0007 0.0034 127.3239 +YYCCCC 1732.153666 5 0.0022 641 | 1/18
16 h-m-p 0.0001 0.0006 287.9753 +YCCCC 1729.607077 4 0.0004 687 | 1/18
17 h-m-p 0.0002 0.0012 73.5646 +YYCC 1728.313263 3 0.0009 730 | 1/18
18 h-m-p 0.0012 0.0128 51.6254 +CCCC 1724.868176 3 0.0053 775 | 1/18
19 h-m-p 0.0005 0.0026 62.2738 ++ 1722.361215 m 0.0026 813 | 1/18
20 h-m-p 0.0018 0.0090 78.9117 CYCCCC 1719.497033 5 0.0032 860 | 1/18
21 h-m-p 0.0024 0.0120 24.5457 CCCCC 1719.001232 4 0.0028 906 | 1/18
22 h-m-p 0.0017 0.0223 40.7492 +YCC 1717.658232 2 0.0052 948 | 1/18
23 h-m-p 0.0012 0.0062 26.9362 ++ 1716.845022 m 0.0062 986 | 1/18
24 h-m-p 0.0077 0.1193 21.5495 +CYCCCC 1710.749424 5 0.0436 1034 | 1/18
25 h-m-p 0.0022 0.0108 70.6815 +YCCC 1708.000380 3 0.0067 1078 | 1/18
26 h-m-p 0.0033 0.0163 41.6576 CCCC 1707.175434 3 0.0039 1122 | 1/18
27 h-m-p 0.0069 0.0345 15.0424 YCCC 1706.952251 3 0.0036 1165 | 1/18
28 h-m-p 0.0089 0.5865 6.1201 ++CYCCCC 1700.625659 5 0.3030 1214 | 1/18
29 h-m-p 0.3648 1.8242 3.4261 CCC 1698.421129 2 0.2931 1256 | 1/18
30 h-m-p 0.4335 2.1673 1.0903 CC 1697.702493 1 0.3893 1296 | 1/18
31 h-m-p 0.4657 2.6503 0.9113 CCCCC 1696.725149 4 0.6313 1342 | 1/18
32 h-m-p 0.2763 1.3817 1.1617 YCCCC 1695.968734 4 0.5883 1387 | 1/18
33 h-m-p 0.2915 1.4577 1.6977 YYCC 1695.676640 3 0.1981 1429 | 1/18
34 h-m-p 0.2393 2.3895 1.4055 YC 1695.288136 1 0.4889 1468 | 1/18
35 h-m-p 0.4555 2.2777 1.4453 C 1695.029073 0 0.3766 1506 | 1/18
36 h-m-p 0.3070 3.9127 1.7729 CC 1694.812769 1 0.4356 1546 | 1/18
37 h-m-p 0.3584 4.5983 2.1547 CCCC 1694.556743 3 0.5376 1590 | 1/18
38 h-m-p 0.8488 8.0000 1.3649 YCCC 1694.412499 3 0.5863 1633 | 1/18
39 h-m-p 0.4789 4.4123 1.6707 CCC 1694.300441 2 0.6123 1675 | 1/18
40 h-m-p 0.8005 7.4415 1.2779 CC 1694.228492 1 0.8098 1715 | 1/18
41 h-m-p 0.7060 8.0000 1.4657 CCC 1694.178315 2 0.5461 1757 | 1/18
42 h-m-p 0.6457 8.0000 1.2397 CC 1694.141525 1 0.7674 1797 | 1/18
43 h-m-p 0.6350 8.0000 1.4981 CC 1694.112466 1 0.6396 1837 | 1/18
44 h-m-p 0.5538 8.0000 1.7303 YCC 1694.081473 2 1.0003 1878 | 1/18
45 h-m-p 1.5134 8.0000 1.1437 YC 1694.067667 1 0.8318 1917 | 1/18
46 h-m-p 0.6469 8.0000 1.4705 CC 1694.056227 1 0.9058 1957 | 1/18
47 h-m-p 1.1725 8.0000 1.1360 C 1694.050390 0 1.1700 1995 | 1/18
48 h-m-p 1.2519 8.0000 1.0617 CC 1694.045925 1 1.5412 2035 | 1/18
49 h-m-p 1.5034 8.0000 1.0884 C 1694.042527 0 1.5034 2073 | 1/18
50 h-m-p 0.9716 8.0000 1.6841 C 1694.041086 0 0.9368 2111 | 1/18
51 h-m-p 0.9295 8.0000 1.6974 YC 1694.040390 1 0.6930 2150 | 1/18
52 h-m-p 0.9782 8.0000 1.2026 CC 1694.039768 1 1.4668 2190 | 1/18
53 h-m-p 1.4767 8.0000 1.1945 CC 1694.039331 1 2.0196 2230 | 1/18
54 h-m-p 1.6000 8.0000 1.1853 C 1694.039164 0 1.5612 2268 | 1/18
55 h-m-p 1.6000 8.0000 1.0977 C 1694.039085 0 1.6000 2306 | 1/18
56 h-m-p 1.3175 8.0000 1.3331 C 1694.039035 0 1.8062 2344 | 1/18
57 h-m-p 1.6000 8.0000 1.0214 C 1694.039011 0 1.5662 2382 | 1/18
58 h-m-p 1.1172 8.0000 1.4318 Y 1694.038998 0 2.7623 2420 | 1/18
59 h-m-p 1.6000 8.0000 1.5326 C 1694.038992 0 1.4134 2458 | 1/18
60 h-m-p 0.0768 8.0000 28.2028 -Y 1694.038992 0 0.0083 2497 | 1/18
61 h-m-p 0.3992 8.0000 0.5838 +Y 1694.038992 0 1.0207 2536 | 1/18
62 h-m-p 1.6000 8.0000 0.2348 C 1694.038991 0 2.3336 2574 | 1/18
63 h-m-p 0.2472 8.0000 2.2170 C 1694.038991 0 0.0870 2612 | 1/18
64 h-m-p 0.9744 8.0000 0.1979 Y 1694.038991 0 2.1290 2650 | 1/18
65 h-m-p 1.6000 8.0000 0.0988 Y 1694.038991 0 1.6000 2688 | 1/18
66 h-m-p 1.6000 8.0000 0.0910 ----Y 1694.038990 0 0.0016 2730 | 1/18
67 h-m-p 0.2572 8.0000 0.0006 ---------------.. | 1/18
68 h-m-p 0.0005 0.2639 0.0218 -----------
Out..
lnL = -1694.038990
2829 lfun, 11316 eigenQcodon, 110331 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1740.990054 S = -1704.176372 -28.899690
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 146 patterns 1:01
did 20 / 146 patterns 1:01
did 30 / 146 patterns 1:01
did 40 / 146 patterns 1:01
did 50 / 146 patterns 1:01
did 60 / 146 patterns 1:01
did 70 / 146 patterns 1:01
did 80 / 146 patterns 1:01
did 90 / 146 patterns 1:02
did 100 / 146 patterns 1:02
did 110 / 146 patterns 1:02
did 120 / 146 patterns 1:02
did 130 / 146 patterns 1:02
did 140 / 146 patterns 1:02
did 146 / 146 patterns 1:02
Time used: 1:02
Model 3: discrete
TREE # 1
(1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
0.027262 0.041383 0.024906 0.077616 0.035096 0.094182 0.060334 0.077399 0.154473 0.122365 0.017204 0.046340 0.000000 2.567579 0.062503 0.014820 0.005788 0.013514 0.023189
ntime & nrate & np: 13 4 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 20.669503
np = 19
lnL0 = -1701.346240
Iterating by ming2
Initial: fx= 1701.346240
x= 0.02726 0.04138 0.02491 0.07762 0.03510 0.09418 0.06033 0.07740 0.15447 0.12236 0.01720 0.04634 0.00000 2.56758 0.06250 0.01482 0.00579 0.01351 0.02319
1 h-m-p 0.0000 0.0000 213.4289 ++ 1701.345852 m 0.0000 43 | 1/19
2 h-m-p 0.0000 0.0000 34840.8058 ++ 1700.035896 m 0.0000 84 | 2/19
3 h-m-p 0.0000 0.0001 177.0076 ++ 1697.857040 m 0.0001 124 | 3/19
4 h-m-p 0.0001 0.0005 271.6989 YCCC 1696.728663 3 0.0001 168 | 3/19
5 h-m-p 0.0005 0.0026 48.3438 YCC 1696.459642 2 0.0003 209 | 3/19
6 h-m-p 0.0005 0.0024 26.6007 YCCC 1696.380842 3 0.0003 252 | 3/19
7 h-m-p 0.0004 0.0060 16.5856 CC 1696.333914 1 0.0004 292 | 3/19
8 h-m-p 0.0015 0.0092 4.3807 CC 1696.327197 1 0.0005 332 | 3/19
9 h-m-p 0.0006 0.0643 3.9174 YC 1696.325490 1 0.0003 371 | 3/19
10 h-m-p 0.0004 0.1121 3.0489 +CC 1696.319583 1 0.0021 412 | 3/19
11 h-m-p 0.0005 0.0500 14.3309 +YC 1696.301953 1 0.0014 452 | 3/19
12 h-m-p 0.0004 0.0263 53.9493 +CCC 1696.208736 2 0.0020 495 | 3/19
13 h-m-p 0.0007 0.0194 164.1452 +YCCCC 1695.087680 4 0.0066 541 | 3/19
14 h-m-p 0.0030 0.0152 155.4363 YCC 1695.029901 2 0.0005 582 | 3/19
15 h-m-p 0.0132 0.0946 5.2915 -CC 1695.025263 1 0.0012 623 | 3/19
16 h-m-p 0.0015 0.4289 4.1535 ++CCC 1694.937151 2 0.0322 667 | 3/19
17 h-m-p 0.0014 0.0600 96.2340 +YCC 1694.671258 2 0.0043 709 | 3/19
18 h-m-p 0.5368 8.0000 0.7674 CCC 1694.238326 2 0.7075 751 | 3/19
19 h-m-p 1.6000 8.0000 0.2113 CYC 1693.956968 2 1.4888 792 | 3/19
20 h-m-p 0.9920 8.0000 0.3171 YCCC 1693.456773 3 2.2274 835 | 3/19
21 h-m-p 1.6000 8.0000 0.0833 CYCC 1693.083203 3 2.1005 878 | 3/19
22 h-m-p 0.7930 8.0000 0.2206 CCC 1692.987899 2 1.2111 920 | 2/19
23 h-m-p 0.0001 0.0052 3667.6680 YC 1692.970854 1 0.0000 959 | 2/19
24 h-m-p 0.8741 8.0000 0.1505 +YCC 1692.902897 2 2.8925 1002 | 2/19
25 h-m-p 1.6000 8.0000 0.1480 CCC 1692.862992 2 2.1209 1045 | 2/19
26 h-m-p 1.6000 8.0000 0.0427 YC 1692.857682 1 0.9219 1085 | 1/19
27 h-m-p 0.0001 0.0016 427.1414 CC 1692.852662 1 0.0001 1126 | 1/19
28 h-m-p 0.2061 8.0000 0.1926 +CC 1692.846924 1 0.8442 1169 | 1/19
29 h-m-p 1.6000 8.0000 0.0111 CC 1692.845379 1 1.3924 1211 | 1/19
30 h-m-p 1.5830 8.0000 0.0098 C 1692.845290 0 1.3521 1251 | 1/19
31 h-m-p 1.6000 8.0000 0.0021 Y 1692.845255 0 3.0144 1291 | 1/19
32 h-m-p 1.6000 8.0000 0.0010 ++ 1692.845052 m 8.0000 1331 | 1/19
33 h-m-p 1.6000 8.0000 0.0036 C 1692.844870 0 1.8658 1371 | 1/19
34 h-m-p 1.6000 8.0000 0.0020 C 1692.844853 0 1.3809 1411 | 1/19
35 h-m-p 1.6000 8.0000 0.0002 C 1692.844852 0 1.3018 1451 | 1/19
36 h-m-p 1.3966 8.0000 0.0002 Y 1692.844852 0 1.3966 1491 | 1/19
37 h-m-p 1.6000 8.0000 0.0001 -Y 1692.844852 0 0.1000 1532 | 1/19
38 h-m-p 0.0863 8.0000 0.0001 ---Y 1692.844852 0 0.0003 1575
Out..
lnL = -1692.844852
1576 lfun, 6304 eigenQcodon, 61464 P(t)
Time used: 1:25
Model 7: beta
TREE # 1
(1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
0.023473 0.040464 0.021933 0.076112 0.034863 0.093365 0.058120 0.076426 0.156881 0.127025 0.017374 0.046009 0.000000 2.512868 0.942968 1.067294
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.486559
np = 16
lnL0 = -1861.145261
Iterating by ming2
Initial: fx= 1861.145261
x= 0.02347 0.04046 0.02193 0.07611 0.03486 0.09336 0.05812 0.07643 0.15688 0.12702 0.01737 0.04601 0.00000 2.51287 0.94297 1.06729
1 h-m-p 0.0000 0.0000 182.6367 ++ 1861.144947 m 0.0000 37 | 1/16
2 h-m-p 0.0000 0.0006 263.9819 ++YCYYCCC 1853.386334 6 0.0004 84 | 1/16
3 h-m-p 0.0000 0.0001 1678.8337 ++ 1845.877561 m 0.0001 118 | 1/16
4 h-m-p 0.0000 0.0001 4277.2512 +YCYYCCC 1819.950620 6 0.0001 162 | 1/16
5 h-m-p 0.0000 0.0000 7775.0200 ++ 1791.884926 m 0.0000 196 | 1/16
6 h-m-p -0.0000 -0.0000 7629.4390
h-m-p: -5.17147323e-21 -2.58573661e-20 7.62943898e+03 1791.884926
.. | 1/16
7 h-m-p 0.0000 0.0007 12944.1236 YCYYYYCCCC 1766.120005 10 0.0000 275 | 1/16
8 h-m-p 0.0001 0.0007 352.1104 +CYCCC 1738.748251 4 0.0006 317 | 1/16
9 h-m-p 0.0001 0.0005 347.5150 +YYYYYYYYCC 1714.697666 10 0.0004 363 | 1/16
10 h-m-p 0.0000 0.0002 149.0500 +YCYCCC 1713.729157 5 0.0001 406 | 1/16
11 h-m-p 0.0001 0.0009 215.9531 +CCCCC 1710.388174 4 0.0003 449 | 1/16
12 h-m-p 0.0007 0.0033 69.5495 CCCC 1709.157821 3 0.0007 489 | 1/16
13 h-m-p 0.0014 0.0084 36.4235 YCC 1708.721759 2 0.0009 526 | 1/16
14 h-m-p 0.0014 0.0102 23.0207 YCC 1708.545855 2 0.0010 563 | 1/16
15 h-m-p 0.0012 0.0165 18.4477 +YCC 1708.221366 2 0.0031 601 | 1/16
16 h-m-p 0.0006 0.0096 87.1585 +CCC 1706.562945 2 0.0037 640 | 1/16
17 h-m-p 0.0015 0.0074 187.5804 CCCCC 1704.151363 4 0.0022 682 | 1/16
18 h-m-p 0.0008 0.0040 34.7489 YCC 1704.043007 2 0.0007 719 | 1/16
19 h-m-p 0.0047 0.0811 4.7750 YCC 1703.787105 2 0.0094 756 | 1/16
20 h-m-p 0.0011 0.0238 42.4446 ++CCCC 1698.026997 3 0.0173 798 | 1/16
21 h-m-p 0.0003 0.0017 304.3965 CYCCC 1697.012350 4 0.0005 839 | 1/16
22 h-m-p 0.2288 1.2451 0.6308 CCCCC 1694.956381 4 0.4071 881 | 1/16
23 h-m-p 0.7048 7.1344 0.3643 CCC 1694.547382 2 0.6321 919 | 1/16
24 h-m-p 0.5384 6.1846 0.4277 YYC 1694.434722 2 0.4268 955 | 1/16
25 h-m-p 1.6000 8.0000 0.0937 CCC 1694.353810 2 0.6275 993 | 1/16
26 h-m-p 1.4205 8.0000 0.0414 CC 1694.326845 1 1.3596 1029 | 1/16
27 h-m-p 0.5545 8.0000 0.1015 +YC 1694.264609 1 1.5838 1065 | 1/16
28 h-m-p 1.0425 8.0000 0.1543 +YCCC 1694.061062 3 3.2736 1105 | 1/16
29 h-m-p 0.6004 3.0020 0.7920 CYCYC 1693.684201 4 1.1735 1145 | 1/16
30 h-m-p 0.3500 1.7500 0.8214 +YYCCC 1693.410563 4 0.8306 1186 | 1/16
31 h-m-p 0.1520 0.7600 1.0082 YCYC 1693.388334 3 0.0963 1224 | 1/16
32 h-m-p 1.6000 8.0000 0.0277 YC 1693.334289 1 1.0728 1259 | 1/16
33 h-m-p 0.3885 8.0000 0.0765 YCC 1693.331565 2 0.8280 1296 | 1/16
34 h-m-p 1.6000 8.0000 0.0033 C 1693.329839 0 1.5011 1330 | 1/16
35 h-m-p 0.1518 8.0000 0.0325 ++YC 1693.325523 1 2.4327 1367 | 1/16
36 h-m-p 0.8736 6.0759 0.0906 YYYYY 1693.320831 4 0.8736 1405 | 1/16
37 h-m-p 1.6000 8.0000 0.0164 CC 1693.317814 1 0.4905 1441 | 1/16
38 h-m-p 0.1429 7.9867 0.0561 +CYC 1693.315259 2 0.8930 1479 | 1/16
39 h-m-p 1.6000 8.0000 0.0031 YC 1693.314486 1 1.0065 1514 | 1/16
40 h-m-p 0.1744 8.0000 0.0181 +C 1693.314295 0 0.7633 1549 | 1/16
41 h-m-p 1.6000 8.0000 0.0079 CC 1693.314074 1 2.3823 1585 | 1/16
42 h-m-p 1.6000 8.0000 0.0028 YC 1693.313867 1 2.9204 1620 | 1/16
43 h-m-p 0.3448 8.0000 0.0240 YC 1693.313713 1 0.7314 1655 | 1/16
44 h-m-p 1.6000 8.0000 0.0054 C 1693.313604 0 2.5468 1689 | 1/16
45 h-m-p 1.6000 8.0000 0.0040 C 1693.313542 0 1.3268 1723 | 1/16
46 h-m-p 0.9775 8.0000 0.0054 --C 1693.313542 0 0.0153 1759 | 1/16
47 h-m-p 0.0477 8.0000 0.0017 ++Y 1693.313517 0 1.5874 1795 | 1/16
48 h-m-p 1.6000 8.0000 0.0004 Y 1693.313512 0 1.1873 1829 | 1/16
49 h-m-p 0.7194 8.0000 0.0006 ++ 1693.313484 m 8.0000 1863 | 1/16
50 h-m-p 1.5402 8.0000 0.0032 -------Y 1693.313484 0 0.0000 1904 | 1/16
51 h-m-p 0.0160 8.0000 0.0015 ++Y 1693.313483 0 0.1894 1940 | 1/16
52 h-m-p 1.6000 8.0000 0.0001 -C 1693.313483 0 0.1000 1975 | 1/16
53 h-m-p 0.0400 8.0000 0.0004 -C 1693.313483 0 0.0020 2010 | 1/16
54 h-m-p 0.0277 8.0000 0.0000 ++C 1693.313482 0 0.4436 2046 | 1/16
55 h-m-p 0.6198 8.0000 0.0000 -Y 1693.313482 0 0.0387 2081 | 1/16
56 h-m-p 0.0160 8.0000 0.0001 ------Y 1693.313482 0 0.0000 2121
Out..
lnL = -1693.313482
2122 lfun, 23342 eigenQcodon, 275860 P(t)
Time used: 3:07
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
initial w for M8:NSbetaw>1 reset.
0.023876 0.039759 0.021762 0.076132 0.034910 0.093329 0.058219 0.076519 0.156260 0.126076 0.016346 0.047119 0.000000 2.499549 0.900000 1.091300 1.180709 2.396835
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.972897
np = 18
lnL0 = -1889.919276
Iterating by ming2
Initial: fx= 1889.919276
x= 0.02388 0.03976 0.02176 0.07613 0.03491 0.09333 0.05822 0.07652 0.15626 0.12608 0.01635 0.04712 0.00000 2.49955 0.90000 1.09130 1.18071 2.39683
1 h-m-p 0.0000 0.0000 336.4616 ++ 1889.918292 m 0.0000 41 | 1/18
2 h-m-p 0.0000 0.0001 862.4112 ++ 1865.847079 m 0.0001 80 | 2/18
3 h-m-p 0.0000 0.0002 195.2299 YCCCC 1864.892659 4 0.0001 125 | 2/18
4 h-m-p 0.0000 0.0002 702.0749 +YYCCC 1861.535084 4 0.0001 169 | 2/18
5 h-m-p 0.0001 0.0004 859.5065 +YCYCCC 1851.410631 5 0.0003 215 | 2/18
6 h-m-p 0.0000 0.0001 2645.7925 +YYCYCCCC 1835.953111 7 0.0001 264 | 2/18
7 h-m-p 0.0000 0.0000 46088.3646 ++ 1819.063372 m 0.0000 301 | 2/18
8 h-m-p 0.0000 0.0000 5875.3851
h-m-p: 1.47702263e-22 7.38511315e-22 5.87538506e+03 1819.063372
.. | 2/18
9 h-m-p 0.0000 0.0028 12647.3960 YCYYCYCCCC 1796.370956 9 0.0000 386 | 2/18
10 h-m-p 0.0001 0.0023 773.2236 YYCCCC 1776.528221 5 0.0001 431 | 2/18
11 h-m-p 0.0001 0.0007 218.8804 +CYCYCCC 1755.831805 6 0.0006 479 | 2/18
12 h-m-p 0.0000 0.0001 2114.8128 ++ 1724.627908 m 0.0001 516 | 2/18
13 h-m-p 0.0000 0.0001 1702.5548 +YYYYCCC 1707.960719 6 0.0001 562 | 2/18
14 h-m-p 0.0001 0.0003 66.9860 ++ 1707.021621 m 0.0003 599 | 1/18
15 h-m-p 0.0000 0.0004 680.1335 YCCC 1705.392675 3 0.0001 641 | 1/18
16 h-m-p 0.0010 0.0078 36.2559 CCC 1704.922309 2 0.0012 683 | 1/18
17 h-m-p 0.0014 0.0072 22.6842 CCC 1704.699943 2 0.0012 725 | 1/18
18 h-m-p 0.0013 0.0240 21.3852 +CCCCC 1703.551448 4 0.0091 772 | 1/18
19 h-m-p 0.0007 0.0035 117.8745 +CYC 1701.787148 2 0.0026 814 | 1/18
20 h-m-p 0.0002 0.0008 147.1267 ++ 1700.842348 m 0.0008 852 | 1/18
21 h-m-p 0.0046 0.0231 16.9169 CYC 1700.756547 2 0.0012 893 | 1/18
22 h-m-p 0.0014 0.0071 2.2740 YC 1700.730015 1 0.0034 932 | 1/18
23 h-m-p 0.0005 0.0023 3.5212 ++ 1700.637445 m 0.0023 970 | 1/18
24 h-m-p 0.0005 0.0329 15.3068 ++YCCCCC 1697.714329 5 0.0185 1019 | 1/18
25 h-m-p 0.0456 0.2279 0.6074 ++ 1697.067681 m 0.2279 1057 | 2/18
26 h-m-p 0.1886 1.6276 0.7340 +YCCC 1695.911083 3 0.5947 1101 | 2/18
27 h-m-p 0.2298 1.1492 1.0551 CCC 1695.440294 2 0.3441 1142 | 2/18
28 h-m-p 0.3326 1.6630 0.2149 YCC 1695.298926 2 0.1760 1182 | 2/18
29 h-m-p 0.2116 4.7309 0.1787 +YC 1695.160210 1 0.5669 1221 | 2/18
30 h-m-p 1.0130 8.0000 0.1000 CCC 1695.083551 2 0.8863 1262 | 2/18
31 h-m-p 1.6000 8.0000 0.0432 YC 1694.916075 1 3.8347 1300 | 2/18
32 h-m-p 1.6000 8.0000 0.0817 YCCCC 1694.112970 4 3.3489 1344 | 2/18
33 h-m-p 0.4135 2.0674 0.5211 CCCC 1693.686049 3 0.4915 1387 | 2/18
34 h-m-p 1.2541 6.2703 0.0770 YCCC 1693.534035 3 0.7148 1429 | 2/18
35 h-m-p 1.6000 8.0000 0.0335 YC 1693.522530 1 0.6810 1467 | 2/18
36 h-m-p 0.9747 8.0000 0.0234 +YC 1693.516666 1 2.4393 1506 | 2/18
37 h-m-p 1.5974 8.0000 0.0357 YC 1693.502012 1 3.2096 1544 | 2/18
38 h-m-p 1.5419 8.0000 0.0743 C 1693.489002 0 1.5997 1581 | 2/18
39 h-m-p 1.0097 8.0000 0.1177 +YCC 1693.450478 2 3.3794 1622 | 2/18
40 h-m-p 0.4927 2.4636 0.4545 YYYYYY 1693.419000 5 0.4927 1664 | 2/18
41 h-m-p 0.5496 2.7480 0.3383 YYYYCCYCCC 1693.351597 9 0.7845 1714 | 2/18
42 h-m-p 0.6345 3.1723 0.3110 CYC 1693.330426 2 0.1701 1754 | 2/18
43 h-m-p 0.5072 6.7016 0.1043 +YYC 1693.321102 2 1.6852 1794 | 2/18
44 h-m-p 1.1697 5.8484 0.0870 CYC 1693.319163 2 0.5451 1834 | 2/18
45 h-m-p 1.2908 8.0000 0.0367 YC 1693.317462 1 0.5823 1872 | 2/18
46 h-m-p 0.5567 8.0000 0.0384 C 1693.317047 0 0.5689 1909 | 2/18
47 h-m-p 0.5599 8.0000 0.0390 CYC 1693.316501 2 1.0102 1949 | 2/18
48 h-m-p 1.6000 8.0000 0.0036 YC 1693.316327 1 0.6782 1987 | 2/18
49 h-m-p 0.1269 8.0000 0.0193 ++YY 1693.315994 1 1.6672 2027 | 2/18
50 h-m-p 1.6000 8.0000 0.0004 Y 1693.315953 0 0.9987 2064 | 2/18
51 h-m-p 0.0343 8.0000 0.0128 +++Y 1693.315824 0 2.1944 2104 | 2/18
52 h-m-p 1.6000 8.0000 0.0173 C 1693.315812 0 0.3356 2141 | 2/18
53 h-m-p 1.6000 8.0000 0.0014 Y 1693.315801 0 0.9190 2178 | 2/18
54 h-m-p 1.6000 8.0000 0.0002 Y 1693.315799 0 1.1875 2215 | 2/18
55 h-m-p 1.6000 8.0000 0.0002 +C 1693.315797 0 5.5689 2253 | 2/18
56 h-m-p 1.5903 8.0000 0.0005 -Y 1693.315796 0 0.0994 2291 | 2/18
57 h-m-p 0.0160 8.0000 0.0034 -------------.. | 2/18
58 h-m-p 0.0000 0.0057 1.1598 Y 1693.315795 0 0.0000 2376 | 2/18
59 h-m-p 0.0034 1.7031 0.0351 -Y 1693.315795 0 0.0004 2414 | 2/18
60 h-m-p 0.0054 2.6841 0.0333 -Y 1693.315795 0 0.0002 2452 | 2/18
61 h-m-p 0.0030 1.5089 0.0280 -Y 1693.315795 0 0.0001 2490 | 2/18
62 h-m-p 0.0103 5.1746 0.0104 -Y 1693.315795 0 0.0004 2528 | 2/18
63 h-m-p 0.0160 8.0000 0.0056 -Y 1693.315795 0 0.0010 2566 | 2/18
64 h-m-p 0.0160 8.0000 0.0060 -------------.. | 2/18
65 h-m-p 0.0054 2.6980 0.2254 -------Y 1693.315795 0 0.0000 2658 | 2/18
66 h-m-p 0.0058 2.8901 0.0142 ------------.. | 2/18
67 h-m-p 0.0054 2.7107 0.2104 -------C 1693.315795 0 0.0000 2749 | 2/18
68 h-m-p 0.0058 2.8904 0.0141 ------------.. | 2/18
69 h-m-p 0.0054 2.7228 0.1964 ------------
Out..
lnL = -1693.315795
2844 lfun, 34128 eigenQcodon, 406692 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1755.265124 S = -1705.443962 -41.995006
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 146 patterns 5:40
did 20 / 146 patterns 5:40
did 30 / 146 patterns 5:40
did 40 / 146 patterns 5:41
did 50 / 146 patterns 5:41
did 60 / 146 patterns 5:41
did 70 / 146 patterns 5:41
did 80 / 146 patterns 5:41
did 90 / 146 patterns 5:42
did 100 / 146 patterns 5:42
did 110 / 146 patterns 5:42
did 120 / 146 patterns 5:42
did 130 / 146 patterns 5:42
did 140 / 146 patterns 5:43
did 146 / 146 patterns 5:43
Time used: 5:43
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=255
D_melanogaster_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_sechellia_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_simulans_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_yakuba_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_erecta_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_biarmipes_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_ficusphila_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
D_takahashii_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY
**************************************************
D_melanogaster_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_sechellia_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_simulans_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_yakuba_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_erecta_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_biarmipes_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_ficusphila_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
D_takahashii_Fer1-PA SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA
**************************************************
D_melanogaster_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_sechellia_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_simulans_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_yakuba_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_erecta_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_biarmipes_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_ficusphila_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
D_takahashii_Fer1-PA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL
**************************************************
D_melanogaster_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_sechellia_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_simulans_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_yakuba_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_erecta_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_biarmipes_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_ficusphila_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
D_takahashii_Fer1-PA QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR
**************************************************
D_melanogaster_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
D_sechellia_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGA----EAAGAAASIFSSGSG
D_simulans_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
D_yakuba_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG
D_erecta_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG
D_biarmipes_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
D_ficusphila_Fer1-PA GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGS-ADMSDPGATASIFSSGSG
D_takahashii_Fer1-PA GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG
****** ***.**************:****: . .**:*****:***
D_melanogaster_Fer1-PA M----
D_sechellia_Fer1-PA Moooo
D_simulans_Fer1-PA M----
D_yakuba_Fer1-PA M----
D_erecta_Fer1-PA M----
D_biarmipes_Fer1-PA Mo---
D_ficusphila_Fer1-PA Mo---
D_takahashii_Fer1-PA Mo---
*
>D_melanogaster_Fer1-PA ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTATT TTTTTGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT AGCAGTGGCTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGCGGAG CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT AAGCAAGGTGGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTCA GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG CAGCGTAACTACCAAAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACGG GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA GAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGTGGTGCGG ATATGTCGGATCCTGGAGCTGCGGCCAGTATTTTCAGCAGCGGCAGTGGC ATG------------ >D_sechellia_Fer1-PA ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT AGCAGTGGGTTCAATAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG TTCGAGGGTTTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT AAGCAAGGTGGACACCCTCAAGCTGGCCATAAGCTACATAACCTTCCTCA GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG CAGCGTAACTACCAGAAGGAGCCGCCGAAGAAAATTATCCTCAAGGATCG CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCTCGG GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAGCT------- -----GAAGCTGCTGGAGCTGCGGCCAGCATCTTCAGCAGCGGCAGTGGC ATG------------ >D_simulans_Fer1-PA ATGTTTTCCATGGACAATTTCGACTTGGAGGCCACGATGGCGCGCCACTT CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT AGCAGTGGGTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG CCACAAGCCCCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGGC AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT AAGCAAGGTGGACACCCTCAAGCTGGCCATAAGCTACATAACCTTCCTCA GCGAGATGGTCAAGAAGGACAAGAACGGCAACGAGCCGGGCCTAAGTCTG CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG CACTGGCGGCGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGTGACCGAT ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGATCCACGG GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGAGCGG ATATGTCGGATCCTGGAGCTGCGGCCAGCATCTTCAGCAGCGGCAGTGGC ATG------------ >D_yakuba_Fer1-PA ATGTTTTCCATGGATAATTTCGACTTGGAAGCCACGATGGCGCGCCATTT CTTTGAGGGATCACAGGCCACCAACGCCTCTACCTCCAGCTCCGATTACT TTTTCGGGGACGAGCACAGCTCGGAGAGTGATGACGAGGACGATGCCTAT AGCAGTGGGTTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGAAG CCACAAGCCCCGACGCTTAAAGTGCGCCTCCCAAATGGCCCAGCAACGAC AGGCGGCCAATCTCCGAGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG TTCGAGGGTCTGCGCACCCACATTCCCACGTTGCCCTACGAGAAGCGACT GAGCAAGGTCGACACACTCAAGCTGGCCATAAGCTACATAACCTTCCTCA GCGAGATGGTCAAGAAGGATAAGAACGGGAACGAGCCGGGCTTAAGTCTG CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG CACTGGCGGTGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGGGACCGAT ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGACCCACGG GGTCCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA AAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGTGCGG ATATGTCGGATCCTGGAGCAACGGCCAGTATTTTCAGCACCGGCAGTGGA ATG------------ >D_erecta_Fer1-PA ATGTTTTCCATGGACAACTTCGACTTGGAGGCCACGATGGCGCGCCATTT CTTCGAGGGATCACAGGCCACCAACGCCTCCACCTCCAGCTCCGACTACT TCTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGACGATGCCTAT AGCAGTGGATTCAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGAAG CCACAAGCCCCGTCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGAC AGGCGGCCAATCTCCGCGAGCGCCGCCGGATGCAGAGCATCAACGAGGCG TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGGCT GAGCAAGGTCGACACACTCAAACTGGCCATAAGCTACATCACCTTCCTCA GCGAGATGGTCAAGAAGGATAAGAACGGGAATGAGCCGGGCCTAAGTCTG CAGCGTAACTACCAGAAGGAGCCGCCCAAGAAAATTATCCTCAAGGATCG CACTGGCGGAGTGGCGCACTCGTTGTCCTGGTACCGCAAGGGGGACCGAT ATCCGGGCAGTAAGCTCTACGCCAGGACCTGGACACCGGAGGACCCGCGG GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAATCA GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGAAGTGGTGCGG ATATGTCGGATCCTGGAGCAGCGGCCAGTATTTTCAGCAGCGGCAGTGGA ATG------------ >D_biarmipes_Fer1-PA ATGTTTTCCATGGACAACTTTGACCTGGAGGCCACGATGGCGCGCCATTT CTTCGAGGGATCGCAGGCCACCAACGCTTCCACCTCTAGCTCCGACTATT TTTTCGGGGACGAGCACAGCTCGGAGAGCGATGACGAGGATGACGCCTAC AGCAGCGGTTTTAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG CCACAAGCCTCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAACGGC AGGCAGCCAATCTCCGCGAGCGTCGGCGGATGCAGAGCATCAACGAGGCG TTCGAGGGTCTGCGCACCCACATTCCCACGCTGCCCTACGAGAAGCGACT GAGCAAGGTCGACACACTCAAGCTGGCGATCAGCTACATAACCTTTCTGA GCGAGATGGTCAAGAAGGATAAGAACGGCAACGAGCCCGGACTGAGCTTG CAGCGCAATTACCAGAAGGAACCGCCCAAGAAAATCATCCTCAAGGATCG CACAGGCGGAGTGGCGCACTCGTTGTCCTGGTACCGAAAGGGCGACCGAT ACCCGGGCAGTAAGCTCTACGCCCGCACCTGGACCCCAGAGGATCCCCGG GGACCCCACTCGCAGCCCCTGCCGCTGTACAACAACAGCAACTCGAACCA GAATCAAAACAGCAACCAGAGCAGCGACGACTTCAGCGGCAGT---GCCG ATATGTCCGATCCGGGAGCAACGGCCAGTATTTTCAGCAGCGGCAGTGGA ATG------------ >D_ficusphila_Fer1-PA ATGTTTTCCATGGACAACTTCGACCTGGAGGCCACGATGGCGCGCCACTT CTTCGAGGGATCGCAGGCCACCAACGCCTCCACCTCCAGCTCCGATTACT TTTTCGGGGACGAGCATAGCTCGGAAAGCGATGACGAGGACGACGCCTAC AGCAGTGGATTCAACAGCGACCAGGAGAACACCGAGAAAACCCGGCGGAG CCACAAGCCGCGCCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAGCGAC AGGCCGCCAATCTCCGCGAGCGCCGGCGGATGCAGAGCATCAACGAGGCC TTCGAGGGTCTGCGCACCCATATCCCCACGCTGCCCTACGAGAAGCGACT GAGCAAGGTCGACACACTCAAGCTGGCCATCAGCTACATAACCTTCCTCA GCGAGATGGTCAAAAAGGACAAGAACGGCAACGAACCCGGCCTGAGCTTG CAGCGCAACTACCAGAAGGAGCCGCCCAAGAAAATCATCCTCAAGGATCG CACTGGCGGCGTGGCGCATTCGTTATCCTGGTACCGCAAGGGCGACCGAT ACCCGGGCAGCAAGCTCTACGCCCGCACCTGGACACCCGAGGACCCCCGG GGACCCCACTCGCAGCCCCAGCCGCTGTACACGAACAGCAACTCGAACCA GAACCAAAACAGCAACCAGAGCAGCGAGGACTTCAGCGGAAGT---GCCG ACATGTCCGATCCGGGGGCAACGGCCAGCATCTTCAGCAGCGGCAGTGGA ATG------------ >D_takahashii_Fer1-PA ATGTTTTCCATGGACAACTTTGACTTGGAGGCCACGATGGCGCGCCATTT CTTCGAGGGATCACAGGCCACCAACGCCTCCACCTCCAGCTCCGATTACT TTTTCGGTGATGAGCACAGCTCGGAGAGCGACGACGAGGATGATGCCTAC AGCAGCGGATTTAACAGCGACCAGGAGAACACCGAGAAGACCCGGAGGAG CCACAAGCCTCGGCGCTTGAAGTGCGCCTCCCAAATGGCCCAGCAACGGC AGGCCGCTAATCTCCGAGAGCGTCGACGGATGCAGAGCATCAACGAGGCG TTCGAGGGTCTACGCACCCACATTCCCACGCTGCCCTACGAAAAGCGACT GAGCAAGGTCGACACACTCAAGTTGGCGATCAGCTACATAACCTTCCTTA GCGAGATGGTAAAGAAGGATAAGAATGGCAATGAACCCGGTCTAAGCTTG CAGCGCAATTACCAAAAGGAACCACCCAAGAAAATCATTCTCAAGGATCG CACTGGCGGTGTGGCGCACTCATTGTCCTGGTACCGCAAGGGCGACCGAT ATCCGGGCAGCAAGCTCTACGCCCGCACCTGGACACCCGAGGATCCCCGG GGGCCCCATTCCCAGCCCCTGCCGCTGTACAATAACAGCAACTCGAATCA AAATCAAAACAGCAACCAGAGCAGCGACGATTTCAGCGGAAGT---GCCG ATATGTCCGATCCGGGAGCAACGGCCAGTATTTTTAGCAGCGGCAGTGGA ATG------------
>D_melanogaster_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG M >D_sechellia_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGA----EAAGAAASIFSSGSG M >D_simulans_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG M >D_yakuba_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGATASIFSTGSG M >D_erecta_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSGSG M >D_biarmipes_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG M >D_ficusphila_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPQPLYTNSNSNQNQNSNQSSEDFSGS-ADMSDPGATASIFSSGSG M >D_takahashii_Fer1-PA MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAY SSGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEA FEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSL QRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPR GPHSQPLPLYNNSNSNQNQNSNQSSDDFSGS-ADMSDPGATASIFSSGSG M
#NEXUS
[ID: 8068752076]
begin taxa;
dimensions ntax=8;
taxlabels
D_melanogaster_Fer1-PA
D_sechellia_Fer1-PA
D_simulans_Fer1-PA
D_yakuba_Fer1-PA
D_erecta_Fer1-PA
D_biarmipes_Fer1-PA
D_ficusphila_Fer1-PA
D_takahashii_Fer1-PA
;
end;
begin trees;
translate
1 D_melanogaster_Fer1-PA,
2 D_sechellia_Fer1-PA,
3 D_simulans_Fer1-PA,
4 D_yakuba_Fer1-PA,
5 D_erecta_Fer1-PA,
6 D_biarmipes_Fer1-PA,
7 D_ficusphila_Fer1-PA,
8 D_takahashii_Fer1-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01527212,((4:0.04264168,5:0.02709636)0.989:0.02007321,((6:0.06111568,8:0.1015621)0.839:0.03017417,7:0.1375464)1.000:0.09609662)1.000:0.02404709,(2:0.03111752,3:0.002167851)0.999:0.01221956);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01527212,((4:0.04264168,5:0.02709636):0.02007321,((6:0.06111568,8:0.1015621):0.03017417,7:0.1375464):0.09609662):0.02404709,(2:0.03111752,3:0.002167851):0.01221956);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1892.86 -1913.16
2 -1892.64 -1905.22
--------------------------------------
TOTAL -1892.74 -1912.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/247/Fer1-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.622640 0.007367 0.470615 0.799569 0.616661 1230.47 1250.84 1.000
r(A<->C){all} 0.061553 0.000379 0.024971 0.098904 0.059773 867.93 947.58 1.000
r(A<->G){all} 0.208318 0.002052 0.122859 0.294304 0.205246 647.81 682.98 1.000
r(A<->T){all} 0.094312 0.001205 0.029639 0.160972 0.091193 769.17 803.41 1.000
r(C<->G){all} 0.046498 0.000215 0.019669 0.076278 0.045225 779.43 925.44 1.000
r(C<->T){all} 0.552384 0.003282 0.436473 0.658348 0.552570 583.70 608.00 1.000
r(G<->T){all} 0.036934 0.000396 0.000663 0.072862 0.034422 992.12 1019.57 1.000
pi(A){all} 0.252147 0.000231 0.222449 0.281511 0.252480 976.57 1164.33 1.000
pi(C){all} 0.326028 0.000260 0.294563 0.356868 0.325771 1024.92 1151.48 1.000
pi(G){all} 0.276330 0.000244 0.246633 0.307922 0.276300 1070.74 1281.55 1.000
pi(T){all} 0.145495 0.000142 0.122941 0.169674 0.145173 798.83 955.11 1.000
alpha{1,2} 0.080926 0.000834 0.010227 0.128168 0.084505 1073.45 1178.69 1.000
alpha{3} 2.869701 0.768841 1.382711 4.675005 2.747479 1501.00 1501.00 1.000
pinvar{all} 0.480376 0.003100 0.373632 0.590202 0.484480 1184.58 1267.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/247/Fer1-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 247
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 2 3 1 5 | Ser TCT 0 0 0 1 0 1 | Tyr TAT 3 2 2 2 2 1 | Cys TGT 0 0 0 0 0 0
TTC 8 9 9 8 10 6 | TCC 6 6 6 5 6 6 | TAC 6 7 7 7 7 8 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 2 0 0 | TCA 0 0 0 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 4 3 3 3 3 | TCG 6 5 6 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 1 1 1 | Arg CGT 1 1 1 1 2 1
CTC 5 5 5 5 5 4 | CCC 6 5 6 6 6 7 | CAC 6 6 6 5 5 5 | CGC 8 8 8 7 8 7
CTA 2 2 2 0 1 0 | CCA 1 0 1 1 0 1 | Gln CAA 3 2 2 4 2 3 | CGA 2 2 2 5 2 3
CTG 6 5 6 6 7 9 | CCG 5 6 5 5 6 4 | CAG 10 11 11 9 11 10 | CGG 6 5 5 3 4 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 3 3 2 | Thr ACT 1 1 1 1 1 0 | Asn AAT 4 5 4 4 4 3 | Ser AGT 6 4 5 7 6 4
ATC 2 3 3 2 3 4 | ACC 7 8 8 8 7 8 | AAC 12 11 12 12 12 13 | AGC 17 18 18 15 17 19
ATA 2 2 2 2 1 1 | ACA 2 1 1 2 2 2 | Lys AAA 1 1 1 1 2 1 | Arg AGA 0 0 0 1 1 0
Met ATG 7 7 7 7 7 7 | ACG 2 2 2 3 2 3 | AAG 14 14 14 14 13 14 | AGG 1 2 2 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 4 1 0 0 1 | Asp GAT 6 4 5 7 5 6 | Gly GGT 2 2 2 3 1 2
GTC 1 1 1 2 2 2 | GCC 10 10 10 10 10 8 | GAC 11 12 12 10 12 11 | GGC 8 7 7 4 4 6
GTA 0 0 0 0 0 0 | GCA 0 0 0 1 1 2 | Glu GAA 0 1 0 1 0 1 | GGA 4 4 4 4 7 6
GTG 2 2 2 1 1 1 | GCG 5 5 5 4 5 4 | GAG 15 15 15 14 15 14 | GGG 1 2 2 4 3 1
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 2 5 | Ser TCT 0 0 | Tyr TAT 0 1 | Cys TGT 0 0
TTC 9 6 | TCC 7 8 | TAC 9 8 | TGC 1 1
Leu TTA 1 0 | TCA 0 2 | *** TAA 0 0 | *** TGA 0 0
TTG 2 5 | TCG 5 2 | TAG 0 0 | Trp TGG 2 2
----------------------------------------------------------------------
Leu CTT 0 1 | Pro CCT 0 1 | His CAT 3 2 | Arg CGT 0 1
CTC 5 4 | CCC 8 8 | CAC 3 4 | CGC 10 7
CTA 0 2 | CCA 0 1 | Gln CAA 2 5 | CGA 3 4
CTG 7 4 | CCG 5 3 | CAG 12 8 | CGG 5 5
----------------------------------------------------------------------
Ile ATT 0 3 | Thr ACT 1 1 | Asn AAT 1 7 | Ser AGT 3 3
ATC 6 3 | ACC 7 7 | AAC 14 9 | AGC 20 20
ATA 1 1 | ACA 2 2 | Lys AAA 3 1 | Arg AGA 0 0
Met ATG 7 7 | ACG 4 3 | AAG 12 14 | AGG 0 1
----------------------------------------------------------------------
Val GTT 0 0 | Ala GCT 0 1 | Asp GAT 4 9 | Gly GGT 1 4
GTC 2 1 | GCC 12 9 | GAC 12 8 | GGC 7 5
GTA 0 1 | GCA 1 1 | Glu GAA 2 3 | GGA 5 5
GTG 1 1 | GCG 2 4 | GAG 14 12 | GGG 2 1
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Fer1-PA
position 1: T:0.15385 C:0.25101 A:0.32794 G:0.26721
position 2: T:0.17814 C:0.21457 A:0.36842 G:0.23887
position 3: T:0.12551 C:0.46154 A:0.06883 G:0.34413
Average T:0.15250 C:0.30904 A:0.25506 G:0.28340
#2: D_sechellia_Fer1-PA
position 1: T:0.15385 C:0.23887 A:0.32794 G:0.27935
position 2: T:0.17814 C:0.21862 A:0.36842 G:0.23482
position 3: T:0.11336 C:0.47368 A:0.06073 G:0.35223
Average T:0.14845 C:0.31039 A:0.25236 G:0.28880
#3: D_simulans_Fer1-PA
position 1: T:0.15385 C:0.24696 A:0.33198 G:0.26721
position 2: T:0.17814 C:0.21457 A:0.36842 G:0.23887
position 3: T:0.10526 C:0.48178 A:0.06073 G:0.35223
Average T:0.14575 C:0.31444 A:0.25371 G:0.28610
#4: D_yakuba_Fer1-PA
position 1: T:0.16194 C:0.23887 A:0.33603 G:0.26316
position 2: T:0.17814 C:0.21862 A:0.36842 G:0.23482
position 3: T:0.13765 C:0.43320 A:0.10121 G:0.32794
Average T:0.15924 C:0.29690 A:0.26856 G:0.27530
#5: D_erecta_Fer1-PA
position 1: T:0.15385 C:0.24696 A:0.33198 G:0.26721
position 2: T:0.17814 C:0.21457 A:0.36842 G:0.23887
position 3: T:0.10931 C:0.46559 A:0.08097 G:0.34413
Average T:0.14710 C:0.30904 A:0.26046 G:0.28340
#6: D_biarmipes_Fer1-PA
position 1: T:0.15385 C:0.25101 A:0.33198 G:0.26316
position 2: T:0.17814 C:0.21457 A:0.36842 G:0.23887
position 3: T:0.11336 C:0.46559 A:0.08097 G:0.34008
Average T:0.14845 C:0.31039 A:0.26046 G:0.28070
#7: D_ficusphila_Fer1-PA
position 1: T:0.15385 C:0.25506 A:0.32794 G:0.26316
position 2: T:0.17409 C:0.21862 A:0.36842 G:0.23887
position 3: T:0.06073 C:0.53441 A:0.08097 G:0.32389
Average T:0.12955 C:0.33603 A:0.25911 G:0.27530
#8: D_takahashii_Fer1-PA
position 1: T:0.16194 C:0.24291 A:0.33198 G:0.26316
position 2: T:0.17814 C:0.21457 A:0.36842 G:0.23887
position 3: T:0.15789 C:0.43725 A:0.11336 G:0.29150
Average T:0.16599 C:0.29825 A:0.27126 G:0.26451
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 23 | Ser S TCT 2 | Tyr Y TAT 13 | Cys C TGT 0
TTC 65 | TCC 50 | TAC 59 | TGC 8
Leu L TTA 3 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 26 | TCG 39 | TAG 0 | Trp W TGG 16
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 7 | His H CAT 8 | Arg R CGT 8
CTC 38 | CCC 52 | CAC 40 | CGC 63
CTA 9 | CCA 5 | Gln Q CAA 23 | CGA 23
CTG 50 | CCG 39 | CAG 82 | CGG 39
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 7 | Asn N AAT 32 | Ser S AGT 38
ATC 26 | ACC 60 | AAC 95 | AGC 144
ATA 12 | ACA 14 | Lys K AAA 11 | Arg R AGA 2
Met M ATG 56 | ACG 21 | AAG 109 | AGG 9
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 8 | Asp D GAT 46 | Gly G GGT 17
GTC 12 | GCC 79 | GAC 88 | GGC 48
GTA 1 | GCA 6 | Glu E GAA 8 | GGA 39
GTG 11 | GCG 34 | GAG 114 | GGG 16
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15587 C:0.24646 A:0.33097 G:0.26670
position 2: T:0.17763 C:0.21609 A:0.36842 G:0.23785
position 3: T:0.11538 C:0.46913 A:0.08097 G:0.33451
Average T:0.14963 C:0.31056 A:0.26012 G:0.27969
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Fer1-PA
D_sechellia_Fer1-PA 0.1129 (0.0104 0.0923)
D_simulans_Fer1-PA -1.0000 (0.0000 0.0580) 0.3282 (0.0104 0.0317)
D_yakuba_Fer1-PA 0.0145 (0.0035 0.2388) 0.0543 (0.0139 0.2566) 0.0161 (0.0035 0.2142)
D_erecta_Fer1-PA -1.0000 (0.0000 0.1895) 0.0505 (0.0104 0.2061)-1.0000 (0.0000 0.1741) 0.0218 (0.0035 0.1584)
D_biarmipes_Fer1-PA 0.0083 (0.0035 0.4190) 0.0331 (0.0148 0.4477) 0.0082 (0.0035 0.4202) 0.0068 (0.0035 0.5116) 0.0082 (0.0035 0.4202)
D_ficusphila_Fer1-PA 0.0237 (0.0096 0.4039) 0.0540 (0.0210 0.3891) 0.0263 (0.0095 0.3637) 0.0193 (0.0096 0.4946) 0.0236 (0.0095 0.4050) 0.0168 (0.0061 0.3615)
D_takahashii_Fer1-PA 0.0063 (0.0035 0.5521) 0.0241 (0.0148 0.6146) 0.0060 (0.0035 0.5803) 0.0063 (0.0035 0.5530) 0.0065 (0.0035 0.5282)-1.0000 (0.0000 0.3578) 0.0117 (0.0061 0.5197)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
check convergence..
lnL(ntime: 13 np: 15): -1699.456849 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..8 12..7 9..14 14..2 14..3
0.024825 0.050971 0.017842 0.076351 0.040856 0.116515 0.045596 0.100029 0.135160 0.178231 0.015362 0.049665 0.000004 2.487205 0.011576
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.85141
(1: 0.024825, ((4: 0.076351, 5: 0.040856): 0.017842, ((6: 0.100029, 8: 0.135160): 0.045596, 7: 0.178231): 0.116515): 0.050971, (2: 0.049665, 3: 0.000004): 0.015362);
(D_melanogaster_Fer1-PA: 0.024825, ((D_yakuba_Fer1-PA: 0.076351, D_erecta_Fer1-PA: 0.040856): 0.017842, ((D_biarmipes_Fer1-PA: 0.100029, D_takahashii_Fer1-PA: 0.135160): 0.045596, D_ficusphila_Fer1-PA: 0.178231): 0.116515): 0.050971, (D_sechellia_Fer1-PA: 0.049665, D_simulans_Fer1-PA: 0.000004): 0.015362);
Detailed output identifying parameters
kappa (ts/tv) = 2.48721
omega (dN/dS) = 0.01158
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.025 623.0 118.0 0.0116 0.0006 0.0490 0.4 5.8
9..10 0.051 623.0 118.0 0.0116 0.0012 0.1006 0.7 11.9
10..11 0.018 623.0 118.0 0.0116 0.0004 0.0352 0.3 4.2
11..4 0.076 623.0 118.0 0.0116 0.0017 0.1507 1.1 17.8
11..5 0.041 623.0 118.0 0.0116 0.0009 0.0806 0.6 9.5
10..12 0.117 623.0 118.0 0.0116 0.0027 0.2299 1.7 27.1
12..13 0.046 623.0 118.0 0.0116 0.0010 0.0900 0.6 10.6
13..6 0.100 623.0 118.0 0.0116 0.0023 0.1974 1.4 23.3
13..8 0.135 623.0 118.0 0.0116 0.0031 0.2667 1.9 31.5
12..7 0.178 623.0 118.0 0.0116 0.0041 0.3517 2.5 41.5
9..14 0.015 623.0 118.0 0.0116 0.0004 0.0303 0.2 3.6
14..2 0.050 623.0 118.0 0.0116 0.0011 0.0980 0.7 11.6
14..3 0.000 623.0 118.0 0.0116 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0194
tree length for dS: 1.6800
Time used: 0:08
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
lnL(ntime: 13 np: 16): -1694.038989 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..8 12..7 9..14 14..2 14..3
0.025636 0.052028 0.018847 0.078692 0.042103 0.118526 0.047412 0.102018 0.137979 0.182213 0.015820 0.052049 0.000004 2.567586 0.983588 0.005263
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87333
(1: 0.025636, ((4: 0.078692, 5: 0.042103): 0.018847, ((6: 0.102018, 8: 0.137979): 0.047412, 7: 0.182213): 0.118526): 0.052028, (2: 0.052049, 3: 0.000004): 0.015820);
(D_melanogaster_Fer1-PA: 0.025636, ((D_yakuba_Fer1-PA: 0.078692, D_erecta_Fer1-PA: 0.042103): 0.018847, ((D_biarmipes_Fer1-PA: 0.102018, D_takahashii_Fer1-PA: 0.137979): 0.047412, D_ficusphila_Fer1-PA: 0.182213): 0.118526): 0.052028, (D_sechellia_Fer1-PA: 0.052049, D_simulans_Fer1-PA: 0.000004): 0.015820);
Detailed output identifying parameters
kappa (ts/tv) = 2.56759
dN/dS (w) for site classes (K=2)
p: 0.98359 0.01641
w: 0.00526 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.026 622.5 118.5 0.0216 0.0010 0.0480 0.6 5.7
9..10 0.052 622.5 118.5 0.0216 0.0021 0.0974 1.3 11.5
10..11 0.019 622.5 118.5 0.0216 0.0008 0.0353 0.5 4.2
11..4 0.079 622.5 118.5 0.0216 0.0032 0.1473 2.0 17.5
11..5 0.042 622.5 118.5 0.0216 0.0017 0.0788 1.1 9.3
10..12 0.119 622.5 118.5 0.0216 0.0048 0.2219 3.0 26.3
12..13 0.047 622.5 118.5 0.0216 0.0019 0.0888 1.2 10.5
13..6 0.102 622.5 118.5 0.0216 0.0041 0.1910 2.6 22.6
13..8 0.138 622.5 118.5 0.0216 0.0056 0.2583 3.5 30.6
12..7 0.182 622.5 118.5 0.0216 0.0074 0.3411 4.6 40.4
9..14 0.016 622.5 118.5 0.0216 0.0006 0.0296 0.4 3.5
14..2 0.052 622.5 118.5 0.0216 0.0021 0.0974 1.3 11.5
14..3 0.000 622.5 118.5 0.0216 0.0000 0.0000 0.0 0.0
Time used: 0:20
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
check convergence..
lnL(ntime: 13 np: 18): -1694.038990 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..8 12..7 9..14 14..2 14..3
0.025637 0.052026 0.018848 0.078692 0.042102 0.118528 0.047410 0.102021 0.137975 0.182209 0.015820 0.052050 0.000004 2.567579 0.983588 0.016412 0.005263 43.577372
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87332
(1: 0.025637, ((4: 0.078692, 5: 0.042102): 0.018848, ((6: 0.102021, 8: 0.137975): 0.047410, 7: 0.182209): 0.118528): 0.052026, (2: 0.052050, 3: 0.000004): 0.015820);
(D_melanogaster_Fer1-PA: 0.025637, ((D_yakuba_Fer1-PA: 0.078692, D_erecta_Fer1-PA: 0.042102): 0.018848, ((D_biarmipes_Fer1-PA: 0.102021, D_takahashii_Fer1-PA: 0.137975): 0.047410, D_ficusphila_Fer1-PA: 0.182209): 0.118528): 0.052026, (D_sechellia_Fer1-PA: 0.052050, D_simulans_Fer1-PA: 0.000004): 0.015820);
Detailed output identifying parameters
kappa (ts/tv) = 2.56758
dN/dS (w) for site classes (K=3)
p: 0.98359 0.01641 0.00000
w: 0.00526 1.00000 43.57737
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.026 622.5 118.5 0.0216 0.0010 0.0480 0.6 5.7
9..10 0.052 622.5 118.5 0.0216 0.0021 0.0974 1.3 11.5
10..11 0.019 622.5 118.5 0.0216 0.0008 0.0353 0.5 4.2
11..4 0.079 622.5 118.5 0.0216 0.0032 0.1473 2.0 17.5
11..5 0.042 622.5 118.5 0.0216 0.0017 0.0788 1.1 9.3
10..12 0.119 622.5 118.5 0.0216 0.0048 0.2219 3.0 26.3
12..13 0.047 622.5 118.5 0.0216 0.0019 0.0888 1.2 10.5
13..6 0.102 622.5 118.5 0.0216 0.0041 0.1910 2.6 22.6
13..8 0.138 622.5 118.5 0.0216 0.0056 0.2583 3.5 30.6
12..7 0.182 622.5 118.5 0.0216 0.0074 0.3411 4.6 40.4
9..14 0.016 622.5 118.5 0.0216 0.0006 0.0296 0.4 3.5
14..2 0.052 622.5 118.5 0.0216 0.0021 0.0974 1.3 11.5
14..3 0.000 622.5 118.5 0.0216 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.274 0.117 0.086 0.078 0.075 0.074 0.074 0.074 0.074 0.074
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:02
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
lnL(ntime: 13 np: 19): -1692.844852 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..8 12..7 9..14 14..2 14..3
0.025183 0.051598 0.018193 0.077589 0.041419 0.118174 0.046482 0.101203 0.136485 0.181096 0.015576 0.050732 0.000004 2.512868 0.338125 0.628723 0.002997 0.003016 0.355581
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86374
(1: 0.025183, ((4: 0.077589, 5: 0.041419): 0.018193, ((6: 0.101203, 8: 0.136485): 0.046482, 7: 0.181096): 0.118174): 0.051598, (2: 0.050732, 3: 0.000004): 0.015576);
(D_melanogaster_Fer1-PA: 0.025183, ((D_yakuba_Fer1-PA: 0.077589, D_erecta_Fer1-PA: 0.041419): 0.018193, ((D_biarmipes_Fer1-PA: 0.101203, D_takahashii_Fer1-PA: 0.136485): 0.046482, D_ficusphila_Fer1-PA: 0.181096): 0.118174): 0.051598, (D_sechellia_Fer1-PA: 0.050732, D_simulans_Fer1-PA: 0.000004): 0.015576);
Detailed output identifying parameters
kappa (ts/tv) = 2.51287
dN/dS (w) for site classes (K=3)
p: 0.33812 0.62872 0.03315
w: 0.00300 0.00302 0.35558
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.025 622.9 118.1 0.0147 0.0007 0.0489 0.4 5.8
9..10 0.052 622.9 118.1 0.0147 0.0015 0.1001 0.9 11.8
10..11 0.018 622.9 118.1 0.0147 0.0005 0.0353 0.3 4.2
11..4 0.078 622.9 118.1 0.0147 0.0022 0.1506 1.4 17.8
11..5 0.041 622.9 118.1 0.0147 0.0012 0.0804 0.7 9.5
10..12 0.118 622.9 118.1 0.0147 0.0034 0.2293 2.1 27.1
12..13 0.046 622.9 118.1 0.0147 0.0013 0.0902 0.8 10.7
13..6 0.101 622.9 118.1 0.0147 0.0029 0.1964 1.8 23.2
13..8 0.136 622.9 118.1 0.0147 0.0039 0.2648 2.4 31.3
12..7 0.181 622.9 118.1 0.0147 0.0052 0.3514 3.2 41.5
9..14 0.016 622.9 118.1 0.0147 0.0004 0.0302 0.3 3.6
14..2 0.051 622.9 118.1 0.0147 0.0014 0.0984 0.9 11.6
14..3 0.000 622.9 118.1 0.0147 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 1:25
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
lnL(ntime: 13 np: 16): -1693.313482 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..8 12..7 9..14 14..2 14..3
0.025061 0.051403 0.018052 0.077242 0.041230 0.117728 0.046134 0.100895 0.136171 0.180446 0.015503 0.050281 0.000004 2.499549 0.011599 0.329939
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86015
(1: 0.025061, ((4: 0.077242, 5: 0.041230): 0.018052, ((6: 0.100895, 8: 0.136171): 0.046134, 7: 0.180446): 0.117728): 0.051403, (2: 0.050281, 3: 0.000004): 0.015503);
(D_melanogaster_Fer1-PA: 0.025061, ((D_yakuba_Fer1-PA: 0.077242, D_erecta_Fer1-PA: 0.041230): 0.018052, ((D_biarmipes_Fer1-PA: 0.100895, D_takahashii_Fer1-PA: 0.136171): 0.046134, D_ficusphila_Fer1-PA: 0.180446): 0.117728): 0.051403, (D_sechellia_Fer1-PA: 0.050281, D_simulans_Fer1-PA: 0.000004): 0.015503);
Detailed output identifying parameters
kappa (ts/tv) = 2.49955
Parameters in M7 (beta):
p = 0.01160 q = 0.32994
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.13821
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.025 623.0 118.0 0.0138 0.0007 0.0489 0.4 5.8
9..10 0.051 623.0 118.0 0.0138 0.0014 0.1002 0.9 11.8
10..11 0.018 623.0 118.0 0.0138 0.0005 0.0352 0.3 4.2
11..4 0.077 623.0 118.0 0.0138 0.0021 0.1506 1.3 17.8
11..5 0.041 623.0 118.0 0.0138 0.0011 0.0804 0.7 9.5
10..12 0.118 623.0 118.0 0.0138 0.0032 0.2296 2.0 27.1
12..13 0.046 623.0 118.0 0.0138 0.0012 0.0900 0.8 10.6
13..6 0.101 623.0 118.0 0.0138 0.0027 0.1968 1.7 23.2
13..8 0.136 623.0 118.0 0.0138 0.0037 0.2656 2.3 31.3
12..7 0.180 623.0 118.0 0.0138 0.0049 0.3519 3.0 41.5
9..14 0.016 623.0 118.0 0.0138 0.0004 0.0302 0.3 3.6
14..2 0.050 623.0 118.0 0.0138 0.0014 0.0981 0.8 11.6
14..3 0.000 623.0 118.0 0.0138 0.0000 0.0000 0.0 0.0
Time used: 3:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7)), (2, 3)); MP score: 164
check convergence..
lnL(ntime: 13 np: 18): -1693.315795 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..8 12..7 9..14 14..2 14..3
0.025067 0.051412 0.018053 0.077256 0.041235 0.117748 0.046142 0.100911 0.136193 0.180475 0.015505 0.050288 0.000004 2.499583 0.999990 0.011660 0.332289 3.397691
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86029
(1: 0.025067, ((4: 0.077256, 5: 0.041235): 0.018053, ((6: 0.100911, 8: 0.136193): 0.046142, 7: 0.180475): 0.117748): 0.051412, (2: 0.050288, 3: 0.000004): 0.015505);
(D_melanogaster_Fer1-PA: 0.025067, ((D_yakuba_Fer1-PA: 0.077256, D_erecta_Fer1-PA: 0.041235): 0.018053, ((D_biarmipes_Fer1-PA: 0.100911, D_takahashii_Fer1-PA: 0.136193): 0.046142, D_ficusphila_Fer1-PA: 0.180475): 0.117748): 0.051412, (D_sechellia_Fer1-PA: 0.050288, D_simulans_Fer1-PA: 0.000004): 0.015505);
Detailed output identifying parameters
kappa (ts/tv) = 2.49958
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.01166 q = 0.33229
(p1 = 0.00001) w = 3.39769
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.13821 3.39769
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.025 623.0 118.0 0.0139 0.0007 0.0489 0.4 5.8
9..10 0.051 623.0 118.0 0.0139 0.0014 0.1002 0.9 11.8
10..11 0.018 623.0 118.0 0.0139 0.0005 0.0352 0.3 4.2
11..4 0.077 623.0 118.0 0.0139 0.0021 0.1506 1.3 17.8
11..5 0.041 623.0 118.0 0.0139 0.0011 0.0804 0.7 9.5
10..12 0.118 623.0 118.0 0.0139 0.0032 0.2296 2.0 27.1
12..13 0.046 623.0 118.0 0.0139 0.0012 0.0900 0.8 10.6
13..6 0.101 623.0 118.0 0.0139 0.0027 0.1968 1.7 23.2
13..8 0.136 623.0 118.0 0.0139 0.0037 0.2656 2.3 31.3
12..7 0.180 623.0 118.0 0.0139 0.0049 0.3519 3.0 41.5
9..14 0.016 623.0 118.0 0.0139 0.0004 0.0302 0.3 3.6
14..2 0.050 623.0 118.0 0.0139 0.0014 0.0981 0.8 11.6
14..3 0.000 623.0 118.0 0.0139 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Fer1-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.015 0.140 0.843
ws: 0.295 0.116 0.084 0.075 0.073 0.072 0.072 0.071 0.071 0.071
Time used: 5:43
Model 1: NearlyNeutral -1694.038989 Model 2: PositiveSelection -1694.03899 Model 0: one-ratio -1699.456849 Model 3: discrete -1692.844852 Model 7: beta -1693.313482 Model 8: beta&w>1 -1693.315795 Model 0 vs 1 10.835720000000038 Model 2 vs 1 2.000000222324161E-6 Model 8 vs 7 0.00462599999991653
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
