--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 16 02:42:26 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/241/endos-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1034.90 -1053.40
2 -1035.07 -1058.14
--------------------------------------
TOTAL -1034.98 -1057.45
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.863136 0.021989 0.599122 1.171308 0.847059 1227.64 1273.68 1.000
r(A<->C){all} 0.058287 0.000649 0.015551 0.111912 0.054851 539.14 625.23 1.003
r(A<->G){all} 0.159413 0.002739 0.065851 0.261017 0.152574 548.35 590.34 1.000
r(A<->T){all} 0.148576 0.004208 0.029406 0.273836 0.141780 351.68 390.19 1.000
r(C<->G){all} 0.027806 0.000157 0.005802 0.052689 0.026196 885.66 886.53 1.000
r(C<->T){all} 0.563357 0.007302 0.400954 0.724100 0.563382 480.71 486.62 1.000
r(G<->T){all} 0.042561 0.000589 0.004372 0.091429 0.037802 771.67 941.43 1.002
pi(A){all} 0.264085 0.000514 0.221633 0.310340 0.263245 961.17 1032.97 1.000
pi(C){all} 0.320399 0.000584 0.272469 0.368952 0.320476 1075.12 1103.42 1.000
pi(G){all} 0.296258 0.000531 0.249833 0.340095 0.296015 1240.91 1302.34 1.000
pi(T){all} 0.119259 0.000288 0.088493 0.153409 0.118241 922.32 998.44 1.000
alpha{1,2} 0.107837 0.000753 0.061004 0.165277 0.105908 1156.75 1224.56 1.000
alpha{3} 2.155340 0.650239 0.820605 3.719296 2.017830 1007.36 1199.36 1.000
pinvar{all} 0.326241 0.007543 0.147511 0.490026 0.330972 1122.50 1175.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -947.591513
Model 2: PositiveSelection -947.591513
Model 0: one-ratio -954.840262
Model 3: discrete -944.979338
Model 7: beta -945.027418
Model 8: beta&w>1 -945.02786
Model 0 vs 1 14.497498000000178
Model 2 vs 1 0.0
Model 8 vs 7 8.840000000418513E-4
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C5
MSSAEENSNSPATTPQDEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGGH
SAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPETV
PARKTSIIQPCNKFPATSo
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQRQKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPETV
PARKTSIIQPCNKFPATSo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=120
C1 MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C2 MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C3 MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C4 MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
C5 MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
C6 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C7 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C8 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C9 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C10 MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C11 MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
C12 MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
***:****** ****** *.:*: **************************
C1 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C2 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C3 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C4 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C5 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C6 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C7 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C8 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
C9 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C10 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C11 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
C12 HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
**********: *****************.******** .**********
C1 VPARKTSIIQPCNKFPATS-
C2 VPARKTSIIQPCNKFPATS-
C3 VPARKTSIIQPCNKFPATS-
C4 VPARKTSIIQPCNKFPATS-
C5 VPARKTSIIQPCNKFPATSo
C6 VPARKTSIIQPCNKFPATS-
C7 VPARKTSIIQPCNKFPATS-
C8 VPARKTSIIQPCNKFPATS-
C9 VPARKTSIIQPCNKFPATS-
C10 VPARKTSIIQPCNKFPATS-
C11 VPARKTSIIQPCNKFPATS-
C12 VPARKTSIIQPCNKFPATSo
*******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [15990]--->[15984]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/241/endos-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.608 Mb, Max= 31.022 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C5
MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATSo
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
VPARKTSIIQPCNKFPATSo
FORMAT of file /tmp/tmp992930245825812905aln Not Supported[FATAL:T-COFFEE]
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C5
MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATSo
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
VPARKTSIIQPCNKFPATSo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:120 S:99 BS:120
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 98.32 C1 C2 98.32
TOP 1 0 98.32 C2 C1 98.32
BOT 0 2 98.32 C1 C3 98.32
TOP 2 0 98.32 C3 C1 98.32
BOT 0 3 96.64 C1 C4 96.64
TOP 3 0 96.64 C4 C1 96.64
BOT 0 4 97.46 C1 C5 97.46
TOP 4 0 97.46 C5 C1 97.46
BOT 0 5 97.48 C1 C6 97.48
TOP 5 0 97.48 C6 C1 97.48
BOT 0 6 97.48 C1 C7 97.48
TOP 6 0 97.48 C7 C1 97.48
BOT 0 7 96.64 C1 C8 96.64
TOP 7 0 96.64 C8 C1 96.64
BOT 0 8 97.48 C1 C9 97.48
TOP 8 0 97.48 C9 C1 97.48
BOT 0 9 96.64 C1 C10 96.64
TOP 9 0 96.64 C10 C1 96.64
BOT 0 10 95.80 C1 C11 95.80
TOP 10 0 95.80 C11 C1 95.80
BOT 0 11 93.22 C1 C12 93.22
TOP 11 0 93.22 C12 C1 93.22
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 97.48 C2 C4 97.48
TOP 3 1 97.48 C4 C2 97.48
BOT 1 4 97.46 C2 C5 97.46
TOP 4 1 97.46 C5 C2 97.46
BOT 1 5 98.32 C2 C6 98.32
TOP 5 1 98.32 C6 C2 98.32
BOT 1 6 98.32 C2 C7 98.32
TOP 6 1 98.32 C7 C2 98.32
BOT 1 7 97.48 C2 C8 97.48
TOP 7 1 97.48 C8 C2 97.48
BOT 1 8 98.32 C2 C9 98.32
TOP 8 1 98.32 C9 C2 98.32
BOT 1 9 97.48 C2 C10 97.48
TOP 9 1 97.48 C10 C2 97.48
BOT 1 10 96.64 C2 C11 96.64
TOP 10 1 96.64 C11 C2 96.64
BOT 1 11 93.22 C2 C12 93.22
TOP 11 1 93.22 C12 C2 93.22
BOT 2 3 97.48 C3 C4 97.48
TOP 3 2 97.48 C4 C3 97.48
BOT 2 4 97.46 C3 C5 97.46
TOP 4 2 97.46 C5 C3 97.46
BOT 2 5 98.32 C3 C6 98.32
TOP 5 2 98.32 C6 C3 98.32
BOT 2 6 98.32 C3 C7 98.32
TOP 6 2 98.32 C7 C3 98.32
BOT 2 7 97.48 C3 C8 97.48
TOP 7 2 97.48 C8 C3 97.48
BOT 2 8 98.32 C3 C9 98.32
TOP 8 2 98.32 C9 C3 98.32
BOT 2 9 97.48 C3 C10 97.48
TOP 9 2 97.48 C10 C3 97.48
BOT 2 10 96.64 C3 C11 96.64
TOP 10 2 96.64 C11 C3 96.64
BOT 2 11 93.22 C3 C12 93.22
TOP 11 2 93.22 C12 C3 93.22
BOT 3 4 99.15 C4 C5 99.15
TOP 4 3 99.15 C5 C4 99.15
BOT 3 5 99.16 C4 C6 99.16
TOP 5 3 99.16 C6 C4 99.16
BOT 3 6 99.16 C4 C7 99.16
TOP 6 3 99.16 C7 C4 99.16
BOT 3 7 98.32 C4 C8 98.32
TOP 7 3 98.32 C8 C4 98.32
BOT 3 8 99.16 C4 C9 99.16
TOP 8 3 99.16 C9 C4 99.16
BOT 3 9 98.32 C4 C10 98.32
TOP 9 3 98.32 C10 C4 98.32
BOT 3 10 98.32 C4 C11 98.32
TOP 10 3 98.32 C11 C4 98.32
BOT 3 11 94.07 C4 C12 94.07
TOP 11 3 94.07 C12 C4 94.07
BOT 4 5 99.15 C5 C6 99.15
TOP 5 4 99.15 C6 C5 99.15
BOT 4 6 99.15 C5 C7 99.15
TOP 6 4 99.15 C7 C5 99.15
BOT 4 7 98.31 C5 C8 98.31
TOP 7 4 98.31 C8 C5 98.31
BOT 4 8 99.15 C5 C9 99.15
TOP 8 4 99.15 C9 C5 99.15
BOT 4 9 98.31 C5 C10 98.31
TOP 9 4 98.31 C10 C5 98.31
BOT 4 10 99.15 C5 C11 99.15
TOP 10 4 99.15 C11 C5 99.15
BOT 4 11 94.92 C5 C12 94.92
TOP 11 4 94.92 C12 C5 94.92
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 99.16 C6 C8 99.16
TOP 7 5 99.16 C8 C6 99.16
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 99.16 C6 C10 99.16
TOP 9 5 99.16 C10 C6 99.16
BOT 5 10 98.32 C6 C11 98.32
TOP 10 5 98.32 C11 C6 98.32
BOT 5 11 94.07 C6 C12 94.07
TOP 11 5 94.07 C12 C6 94.07
BOT 6 7 99.16 C7 C8 99.16
TOP 7 6 99.16 C8 C7 99.16
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 99.16 C7 C10 99.16
TOP 9 6 99.16 C10 C7 99.16
BOT 6 10 98.32 C7 C11 98.32
TOP 10 6 98.32 C11 C7 98.32
BOT 6 11 94.07 C7 C12 94.07
TOP 11 6 94.07 C12 C7 94.07
BOT 7 8 99.16 C8 C9 99.16
TOP 8 7 99.16 C9 C8 99.16
BOT 7 9 98.32 C8 C10 98.32
TOP 9 7 98.32 C10 C8 98.32
BOT 7 10 97.48 C8 C11 97.48
TOP 10 7 97.48 C11 C8 97.48
BOT 7 11 93.22 C8 C12 93.22
TOP 11 7 93.22 C12 C8 93.22
BOT 8 9 99.16 C9 C10 99.16
TOP 9 8 99.16 C10 C9 99.16
BOT 8 10 98.32 C9 C11 98.32
TOP 10 8 98.32 C11 C9 98.32
BOT 8 11 94.07 C9 C12 94.07
TOP 11 8 94.07 C12 C9 94.07
BOT 9 10 97.48 C10 C11 97.48
TOP 10 9 97.48 C11 C10 97.48
BOT 9 11 93.22 C10 C12 93.22
TOP 11 9 93.22 C12 C10 93.22
BOT 10 11 95.76 C11 C12 95.76
TOP 11 10 95.76 C12 C11 95.76
AVG 0 C1 * 96.86
AVG 1 C2 * 97.55
AVG 2 C3 * 97.55
AVG 3 C4 * 97.93
AVG 4 C5 * 98.15
AVG 5 C6 * 98.47
AVG 6 C7 * 98.47
AVG 7 C8 * 97.70
AVG 8 C9 * 98.47
AVG 9 C10 * 97.70
AVG 10 C11 * 97.48
AVG 11 C12 * 93.91
TOT TOT * 97.52
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C2 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACTCCCCAGGA
C3 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C4 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C5 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C6 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C7 ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C8 ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C9 ATGAGCTCTGCGGAGGAAAACAGCAATAGCCCGGCTACCACGCCCCAGGA
C10 ATGAGCTCCACGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C11 ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C12 ATGAGTTCCGCGGAGGAAAACAGCAACAGCCAGGCCACCACGCCCCAGGA
***** ** .****.*********** ****.*** ***** ********
C1 CACCGAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGG
C2 CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C3 CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C4 CAACGAGGCCGCCGAACAGCCCAACCTCACGGATCTCGAGAAGATCGAGG
C5 C---GAGGCCGCCGAACAGGTCAACCTCACGGATCTGGAGAAGATCGAGG
C6 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C7 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C8 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C9 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C10 TAACGAGGCTGCAGAGCAGGCAAACCTCACGGATCTCGAGAAGATTGAGG
C11 CAACGAGGCCGCCGAGCAGGTCAACCTCACGGATCTCGAGAAGATCGAGG
C12 CAACGAGACCGCTGAGAATGTCAACCTCACGGATCTCGAGAAGATCGAGG
*** * .* **..* ************** ******** ****
C1 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C2 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C3 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C4 AGGAGAAACTCAAGTCGAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C5 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGT
C6 AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCCGGCGGA
C7 AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCTGGCGGA
C8 AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCCGGCGGG
C9 AGGAGAAGCTCAAGAGCAAGTATCCCAGCGGAATGCGTGTACCCGGTGGA
C10 AGGAGAAGCTGAAGTCCAAGTACCCTAGTGGAATGCGAGTGCCCGGCGGA
C11 AGGAGAAGCTCAAGTCCAAGTACCCCAGTGGAATGCGAGTACCCGGAGGT
C12 AGGAGAAGCTCAAGTCCAAGTATCCCAGTGGAATGCGAGTGCCGGGCGGT
*******.** ***: ***** ** ** **.***** **.** ** **
C1 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C2 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C3 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C4 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAAGGGCAAAAGTTCTTCGA
C5 CATTCGGCCTTCCTTCAGAAGAGGTTGCAGAAGGGGCAAAAGTTCTTCGA
C6 CACTCGGCTTTCCTACAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C7 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C8 CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C9 CACTCGGCCTTTCTGCAAAAAAGGCTCCAGAAGGGGCAAAAATTCTTCGA
C10 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C11 CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C12 CACTCGGCCTTCCTCCAAAAAAGGCTGCAGAGG---CAAAAGTTCTTCGA
** ***** ** ** **.**.*** * ****.. *****.********
C1 CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C2 CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C3 CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C4 CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGGGTCAAGCAGG
C5 CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
C6 CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTTAAGCAGG
C7 CTCGGGAGACTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C8 CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
C9 CTCGGGCGATTACCAAATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C10 TTCGGGCGACTATCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C11 CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
C12 CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
*****.** ** **.********.************.* ** *******
C1 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C2 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C3 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C4 TCTTTGCCAACAAGGTGACCACCGGGGAAGCCATTCCCACGCCCGAAACC
C5 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C6 TCTTTGCCAACAAGGTTACCACTGGGGAGGCCATTCCCACGCCCGAAACC
C7 TCTTTGCCAACAAGGTTACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C8 TCTTTGCCAACAAGAACACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C9 TCTTTGCCAATAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C10 TCTTTGCCAACAAGGTGACCACCGGGGAGGCTATTCCCACGCCCGAAACC
C11 TCTTTGCCAACAAGGTGACCACCGGAGAGGCCATTCCCACGCCCGAAACC
C12 TCTTTGCCAACAAGGTGCCCACCGGGGAGGCCATTCCCACGCCCGAAACC
********** ***.: .**** **.**.** ******************
C1 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C2 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C3 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C4 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C5 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C6 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C7 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
C8 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
C9 GTGCCGGCGCGCAAGACTTCGATTATCCAACCCTGTAACAAGTTCCCGGC
C10 GTGCCGGCGCGCAAGACCTCGATCATCCAACCATGCAACAAGTTCCCAGC
C11 GTGCCGGCACGAAAGACTTCGATCATCCAACCCTGCAACAAGTTCCCAGC
C12 GTGCCGGCACGCAAGACCTCGATCATCCAACCCTGCAACAAATTCCCAGC
********.**.***** ***** ********.** *****.***** **
C1 GACGAGC---
C2 GACGAGC---
C3 GACGAGC---
C4 GACGAGC---
C5 GACGAGC---
C6 GACGAGC---
C7 GACGAGC---
C8 GACGAGC---
C9 GACGAGC---
C10 GACGAGC---
C11 GACAAGC---
C12 GACGAGC---
***.***
>C1
ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CACCGAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C2
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACTCCCCAGGA
CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C3
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C4
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAACAGCCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCGAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAAGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGGGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAAGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C5
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C---GAGGCCGCCGAACAGGTCAACCTCACGGATCTGGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGT
CATTCGGCCTTCCTTCAGAAGAGGTTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C6
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCCGGCGGA
CACTCGGCTTTCCTACAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTTAAGCAGG
TCTTTGCCAACAAGGTTACCACTGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C7
ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCTGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGAGACTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTTACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
GACGAGC---
>C8
ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCCGGCGGG
CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGAACACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
GACGAGC---
>C9
ATGAGCTCTGCGGAGGAAAACAGCAATAGCCCGGCTACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGAGCAAGTATCCCAGCGGAATGCGTGTACCCGGTGGA
CACTCGGCCTTTCTGCAAAAAAGGCTCCAGAAGGGGCAAAAATTCTTCGA
CTCGGGCGATTACCAAATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAATAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATTATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C10
ATGAGCTCCACGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
TAACGAGGCTGCAGAGCAGGCAAACCTCACGGATCTCGAGAAGATTGAGG
AGGAGAAGCTGAAGTCCAAGTACCCTAGTGGAATGCGAGTGCCCGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
TTCGGGCGACTATCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCTATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACCTCGATCATCCAACCATGCAACAAGTTCCCAGC
GACGAGC---
>C11
ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGTCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTACCCCAGTGGAATGCGAGTACCCGGAGGT
CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGAGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCACGAAAGACTTCGATCATCCAACCCTGCAACAAGTTCCCAGC
GACAAGC---
>C12
ATGAGTTCCGCGGAGGAAAACAGCAACAGCCAGGCCACCACGCCCCAGGA
CAACGAGACCGCTGAGAATGTCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGTGGAATGCGAGTGCCGGGCGGT
CACTCGGCCTTCCTCCAAAAAAGGCTGCAGAGG---CAAAAGTTCTTCGA
CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
TCTTTGCCAACAAGGTGCCCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCACGCAAGACCTCGATCATCCAACCCTGCAACAAATTCCCAGC
GACGAGC---
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C5
MSSAEENSNSPATTPQDoEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQRoQKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
VPARKTSIIQPCNKFPATS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 360 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479263362
Setting output file names to "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 791228087
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2721711406
Seed = 1093295552
Swapseed = 1479263362
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 17 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 51 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1611.333423 -- -24.979900
Chain 2 -- -1629.829599 -- -24.979900
Chain 3 -- -1600.633997 -- -24.979900
Chain 4 -- -1616.005227 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1592.151679 -- -24.979900
Chain 2 -- -1627.167796 -- -24.979900
Chain 3 -- -1618.188936 -- -24.979900
Chain 4 -- -1590.145863 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1611.333] (-1629.830) (-1600.634) (-1616.005) * [-1592.152] (-1627.168) (-1618.189) (-1590.146)
500 -- (-1105.452) (-1085.632) (-1090.060) [-1083.963] * [-1090.661] (-1111.144) (-1100.109) (-1099.487) -- 0:00:00
1000 -- (-1083.827) (-1075.408) (-1076.653) [-1071.732] * (-1094.948) (-1093.688) [-1082.621] (-1085.507) -- 0:00:00
1500 -- (-1056.046) [-1059.098] (-1066.649) (-1071.012) * [-1062.448] (-1075.880) (-1059.702) (-1087.126) -- 0:00:00
2000 -- [-1046.272] (-1055.695) (-1076.552) (-1062.240) * [-1056.792] (-1067.636) (-1054.358) (-1061.629) -- 0:00:00
2500 -- [-1044.174] (-1045.087) (-1072.230) (-1046.565) * (-1072.559) [-1068.041] (-1051.805) (-1048.552) -- 0:00:00
3000 -- (-1057.403) (-1049.350) [-1056.273] (-1039.813) * (-1044.382) [-1051.104] (-1045.012) (-1048.929) -- 0:00:00
3500 -- (-1045.620) [-1042.176] (-1055.835) (-1053.663) * [-1046.091] (-1051.609) (-1046.684) (-1047.866) -- 0:04:44
4000 -- [-1041.320] (-1044.915) (-1057.589) (-1047.857) * (-1047.429) (-1047.134) (-1042.927) [-1038.155] -- 0:04:09
4500 -- (-1047.762) (-1050.370) (-1045.203) [-1041.032] * (-1042.787) (-1059.070) (-1065.804) [-1039.363] -- 0:03:41
5000 -- (-1050.648) [-1042.439] (-1055.445) (-1045.269) * (-1038.048) (-1047.906) (-1049.446) [-1047.942] -- 0:03:19
Average standard deviation of split frequencies: 0.061108
5500 -- (-1042.449) (-1056.124) (-1056.727) [-1056.009] * (-1042.626) (-1055.972) [-1047.395] (-1036.446) -- 0:03:00
6000 -- (-1060.227) (-1041.618) (-1045.758) [-1038.692] * [-1032.173] (-1052.611) (-1039.244) (-1047.976) -- 0:02:45
6500 -- (-1039.560) (-1047.276) [-1041.584] (-1042.268) * (-1048.860) (-1043.267) [-1037.755] (-1047.011) -- 0:05:05
7000 -- [-1032.910] (-1047.495) (-1046.603) (-1068.106) * [-1034.656] (-1053.467) (-1039.653) (-1050.181) -- 0:04:43
7500 -- (-1044.172) [-1041.488] (-1038.413) (-1047.389) * (-1044.484) (-1053.850) (-1046.175) [-1041.471] -- 0:04:24
8000 -- [-1042.874] (-1043.904) (-1040.291) (-1048.989) * (-1035.965) (-1046.036) [-1043.677] (-1042.834) -- 0:04:08
8500 -- (-1037.153) (-1041.240) (-1042.055) [-1039.962] * (-1051.179) (-1046.601) [-1046.702] (-1037.386) -- 0:03:53
9000 -- (-1038.019) (-1059.026) (-1044.859) [-1036.577] * [-1048.359] (-1077.733) (-1070.681) (-1047.535) -- 0:03:40
9500 -- (-1048.474) (-1042.691) (-1044.587) [-1043.920] * (-1055.004) (-1051.628) (-1048.785) [-1037.495] -- 0:05:12
10000 -- [-1037.019] (-1038.058) (-1059.497) (-1055.489) * [-1041.929] (-1041.381) (-1054.590) (-1039.678) -- 0:04:57
Average standard deviation of split frequencies: 0.059978
10500 -- [-1034.261] (-1050.245) (-1040.774) (-1051.555) * (-1038.536) (-1042.246) (-1054.956) [-1046.191] -- 0:04:42
11000 -- (-1043.476) [-1044.319] (-1040.727) (-1041.533) * [-1039.372] (-1040.010) (-1057.410) (-1037.555) -- 0:04:29
11500 -- (-1039.944) [-1038.120] (-1044.791) (-1045.797) * [-1037.957] (-1053.351) (-1051.433) (-1038.450) -- 0:04:17
12000 -- (-1042.956) (-1044.026) (-1059.046) [-1054.891] * [-1035.653] (-1042.259) (-1051.350) (-1041.626) -- 0:04:07
12500 -- (-1039.496) (-1044.409) [-1040.205] (-1053.051) * [-1036.856] (-1053.303) (-1039.746) (-1038.698) -- 0:03:57
13000 -- (-1044.933) (-1043.921) (-1048.855) [-1038.910] * (-1049.351) [-1042.209] (-1041.175) (-1041.204) -- 0:05:03
13500 -- (-1034.965) (-1044.123) (-1039.062) [-1040.714] * (-1038.329) (-1039.120) [-1037.739] (-1046.607) -- 0:04:52
14000 -- [-1036.681] (-1039.910) (-1047.835) (-1040.153) * (-1048.115) (-1045.682) (-1050.860) [-1048.137] -- 0:04:41
14500 -- (-1040.294) (-1052.618) (-1043.847) [-1040.139] * [-1050.848] (-1045.202) (-1035.344) (-1043.718) -- 0:04:31
15000 -- (-1044.615) (-1049.599) (-1043.618) [-1041.629] * [-1044.318] (-1043.742) (-1047.885) (-1044.253) -- 0:04:22
Average standard deviation of split frequencies: 0.047594
15500 -- [-1041.782] (-1045.962) (-1044.474) (-1041.895) * [-1049.683] (-1057.001) (-1047.481) (-1051.045) -- 0:04:14
16000 -- (-1043.002) (-1054.459) [-1036.779] (-1037.220) * (-1039.621) (-1046.214) [-1043.089] (-1040.154) -- 0:05:07
16500 -- [-1037.211] (-1039.698) (-1039.350) (-1041.411) * (-1049.715) [-1041.426] (-1050.111) (-1044.824) -- 0:04:58
17000 -- (-1043.848) [-1040.623] (-1048.109) (-1042.585) * (-1051.224) (-1049.191) (-1063.394) [-1043.970] -- 0:04:49
17500 -- (-1039.998) (-1045.616) [-1051.405] (-1048.285) * (-1038.479) (-1051.547) [-1035.863] (-1048.249) -- 0:04:40
18000 -- [-1043.004] (-1045.166) (-1044.158) (-1040.686) * (-1040.076) (-1054.923) (-1042.065) [-1047.139] -- 0:04:32
18500 -- (-1044.204) [-1044.586] (-1042.268) (-1044.302) * [-1038.226] (-1046.440) (-1057.177) (-1050.366) -- 0:04:25
19000 -- (-1044.015) [-1042.415] (-1053.703) (-1045.879) * [-1035.441] (-1042.361) (-1043.908) (-1034.694) -- 0:05:09
19500 -- (-1043.939) [-1055.157] (-1043.942) (-1044.801) * [-1039.925] (-1049.766) (-1043.030) (-1046.676) -- 0:05:01
20000 -- [-1038.568] (-1059.426) (-1059.054) (-1038.954) * (-1056.994) (-1038.405) (-1040.436) [-1043.491] -- 0:04:54
Average standard deviation of split frequencies: 0.059657
20500 -- [-1049.802] (-1051.875) (-1045.670) (-1049.837) * (-1059.842) (-1055.394) [-1040.057] (-1048.413) -- 0:04:46
21000 -- [-1043.473] (-1050.792) (-1060.021) (-1050.368) * (-1043.621) (-1047.322) (-1049.469) [-1048.040] -- 0:04:39
21500 -- [-1042.060] (-1060.042) (-1057.219) (-1051.738) * (-1045.226) (-1044.882) [-1042.828] (-1051.043) -- 0:04:33
22000 -- [-1041.544] (-1047.023) (-1060.484) (-1048.220) * (-1043.172) (-1042.788) (-1043.720) [-1051.888] -- 0:05:11
22500 -- [-1037.004] (-1051.439) (-1060.862) (-1049.138) * [-1030.942] (-1052.104) (-1052.205) (-1039.047) -- 0:05:04
23000 -- (-1040.205) [-1047.144] (-1054.389) (-1047.149) * [-1032.430] (-1041.155) (-1052.381) (-1041.181) -- 0:04:57
23500 -- (-1046.120) (-1042.586) (-1065.991) [-1054.560] * (-1040.759) (-1048.108) (-1057.777) [-1036.954] -- 0:04:50
24000 -- [-1043.396] (-1039.430) (-1058.609) (-1040.737) * [-1039.465] (-1043.327) (-1052.439) (-1037.166) -- 0:04:44
24500 -- (-1037.207) [-1043.798] (-1056.893) (-1045.056) * (-1044.173) [-1047.701] (-1055.079) (-1042.046) -- 0:04:38
25000 -- (-1035.888) (-1049.847) (-1044.398) [-1038.620] * (-1042.289) (-1044.891) (-1047.023) [-1046.029] -- 0:05:12
Average standard deviation of split frequencies: 0.050508
25500 -- [-1049.919] (-1042.791) (-1050.086) (-1042.516) * (-1040.679) (-1051.052) (-1053.913) [-1036.720] -- 0:05:05
26000 -- (-1049.918) (-1043.412) [-1047.355] (-1044.079) * [-1040.978] (-1046.686) (-1049.091) (-1045.848) -- 0:04:59
26500 -- (-1045.310) (-1040.962) (-1043.618) [-1043.436] * [-1033.406] (-1047.817) (-1045.841) (-1045.145) -- 0:04:53
27000 -- [-1037.047] (-1039.672) (-1039.644) (-1046.455) * (-1047.298) (-1047.140) (-1054.022) [-1037.475] -- 0:04:48
27500 -- (-1052.065) (-1048.167) (-1040.693) [-1032.233] * (-1048.049) (-1047.496) (-1048.618) [-1040.547] -- 0:04:42
28000 -- (-1041.964) (-1047.055) [-1042.080] (-1037.048) * [-1043.365] (-1040.928) (-1045.331) (-1044.139) -- 0:04:37
28500 -- [-1034.836] (-1055.969) (-1046.655) (-1046.981) * (-1046.445) [-1039.691] (-1043.628) (-1043.514) -- 0:05:06
29000 -- (-1040.876) (-1052.189) [-1036.314] (-1049.571) * (-1046.476) (-1045.318) [-1050.955] (-1058.600) -- 0:05:01
29500 -- (-1043.769) (-1041.163) [-1041.889] (-1037.594) * (-1045.793) (-1041.483) (-1057.925) [-1044.775] -- 0:04:56
30000 -- (-1042.563) (-1045.937) [-1043.076] (-1045.284) * (-1046.570) (-1052.655) (-1048.636) [-1037.336] -- 0:04:51
Average standard deviation of split frequencies: 0.037838
30500 -- (-1052.322) (-1052.762) (-1039.599) [-1034.662] * (-1047.158) (-1048.028) (-1048.072) [-1051.642] -- 0:04:46
31000 -- (-1047.984) (-1037.155) [-1042.144] (-1040.048) * (-1038.241) [-1046.130] (-1046.584) (-1060.722) -- 0:04:41
31500 -- (-1045.482) [-1037.309] (-1040.761) (-1046.855) * [-1033.107] (-1040.465) (-1045.167) (-1059.444) -- 0:05:07
32000 -- (-1059.029) (-1036.682) [-1043.158] (-1038.476) * (-1052.748) [-1045.256] (-1042.158) (-1038.370) -- 0:05:02
32500 -- (-1050.633) [-1046.339] (-1050.924) (-1037.924) * [-1049.071] (-1051.725) (-1048.114) (-1041.063) -- 0:04:57
33000 -- (-1044.465) [-1042.783] (-1040.076) (-1055.869) * (-1064.460) (-1046.161) (-1047.250) [-1037.905] -- 0:04:53
33500 -- (-1040.906) (-1062.913) (-1052.253) [-1043.146] * (-1046.356) (-1049.160) [-1039.305] (-1044.927) -- 0:04:48
34000 -- (-1034.520) (-1057.455) [-1037.410] (-1042.384) * (-1056.843) (-1044.596) [-1038.917] (-1040.286) -- 0:04:44
34500 -- (-1045.800) (-1039.886) (-1041.281) [-1033.366] * [-1052.944] (-1047.248) (-1047.183) (-1051.499) -- 0:05:07
35000 -- (-1051.225) (-1044.644) [-1045.054] (-1033.118) * [-1046.632] (-1046.703) (-1061.102) (-1046.180) -- 0:05:03
Average standard deviation of split frequencies: 0.040291
35500 -- (-1044.666) [-1042.835] (-1042.660) (-1047.151) * (-1044.344) [-1043.508] (-1053.066) (-1051.555) -- 0:04:58
36000 -- (-1042.633) [-1039.025] (-1038.360) (-1053.225) * (-1042.157) (-1051.377) [-1043.174] (-1041.195) -- 0:04:54
36500 -- [-1046.920] (-1043.340) (-1035.390) (-1055.232) * (-1039.003) [-1042.180] (-1053.514) (-1045.775) -- 0:04:50
37000 -- (-1047.036) (-1049.093) [-1040.088] (-1049.247) * (-1051.791) (-1044.725) [-1038.212] (-1046.947) -- 0:04:46
37500 -- (-1057.414) (-1042.697) (-1049.328) [-1037.822] * (-1042.932) (-1050.576) [-1038.910] (-1043.211) -- 0:05:08
38000 -- (-1048.023) (-1051.343) [-1051.267] (-1052.272) * (-1042.498) [-1043.627] (-1046.279) (-1057.101) -- 0:05:03
38500 -- (-1037.044) [-1038.380] (-1043.340) (-1045.157) * (-1048.482) (-1053.015) (-1039.659) [-1040.682] -- 0:04:59
39000 -- (-1038.282) (-1054.968) [-1041.831] (-1043.153) * (-1041.176) (-1048.239) [-1044.212] (-1050.320) -- 0:04:55
39500 -- [-1042.842] (-1052.030) (-1041.706) (-1045.735) * (-1043.177) (-1062.280) (-1048.936) [-1041.991] -- 0:04:51
40000 -- (-1046.147) [-1041.154] (-1054.833) (-1049.537) * (-1041.153) (-1066.646) [-1044.773] (-1044.539) -- 0:04:48
Average standard deviation of split frequencies: 0.042228
40500 -- (-1045.092) (-1044.073) (-1044.782) [-1053.246] * [-1044.045] (-1054.661) (-1039.878) (-1036.308) -- 0:04:44
41000 -- (-1054.223) (-1045.559) (-1052.070) [-1037.387] * (-1040.201) (-1048.328) [-1045.365] (-1041.007) -- 0:05:04
41500 -- (-1044.924) [-1036.464] (-1050.024) (-1040.843) * (-1058.100) [-1038.883] (-1045.642) (-1042.167) -- 0:05:00
42000 -- (-1051.313) [-1038.393] (-1048.219) (-1049.435) * [-1043.292] (-1050.145) (-1050.127) (-1045.957) -- 0:04:56
42500 -- (-1042.051) (-1052.707) [-1038.494] (-1055.005) * (-1038.527) (-1042.849) [-1039.139] (-1057.101) -- 0:04:52
43000 -- (-1038.173) [-1048.391] (-1048.003) (-1039.264) * (-1036.888) [-1036.920] (-1057.515) (-1052.459) -- 0:04:49
43500 -- (-1044.697) (-1052.846) [-1052.430] (-1046.627) * (-1039.480) (-1044.729) (-1040.448) [-1045.566] -- 0:04:45
44000 -- (-1045.680) (-1050.890) (-1040.146) [-1048.028] * (-1060.309) (-1051.992) (-1050.220) [-1037.466] -- 0:05:04
44500 -- (-1053.457) (-1041.630) [-1041.568] (-1053.629) * (-1046.859) (-1063.847) [-1041.316] (-1036.564) -- 0:05:00
45000 -- [-1037.940] (-1046.604) (-1051.292) (-1039.761) * [-1041.828] (-1054.901) (-1038.091) (-1048.632) -- 0:04:57
Average standard deviation of split frequencies: 0.034160
45500 -- (-1051.223) (-1040.411) [-1047.764] (-1044.413) * (-1049.964) (-1057.335) (-1042.481) [-1036.092] -- 0:04:53
46000 -- (-1045.687) (-1044.821) [-1038.276] (-1053.279) * (-1055.185) (-1048.663) (-1050.649) [-1037.482] -- 0:04:50
46500 -- [-1043.218] (-1049.397) (-1047.454) (-1042.241) * (-1044.308) (-1046.927) (-1052.954) [-1037.126] -- 0:04:47
47000 -- (-1043.132) [-1041.532] (-1044.488) (-1044.370) * (-1037.304) (-1052.401) [-1044.013] (-1065.453) -- 0:05:04
47500 -- (-1048.515) [-1036.835] (-1045.779) (-1038.262) * (-1042.058) [-1044.424] (-1042.220) (-1043.632) -- 0:05:00
48000 -- [-1033.473] (-1066.344) (-1055.367) (-1044.490) * (-1061.806) (-1042.628) [-1042.508] (-1049.123) -- 0:04:57
48500 -- (-1050.181) [-1041.876] (-1048.389) (-1050.692) * (-1056.382) (-1048.916) [-1044.830] (-1040.164) -- 0:04:54
49000 -- (-1047.723) (-1047.499) (-1047.580) [-1041.521] * (-1059.477) (-1034.124) (-1047.149) [-1050.039] -- 0:04:51
49500 -- (-1053.145) (-1049.504) (-1044.384) [-1040.509] * (-1050.215) (-1051.851) [-1038.982] (-1039.691) -- 0:04:48
50000 -- (-1046.063) (-1048.601) [-1043.967] (-1039.267) * (-1041.517) (-1047.771) [-1038.881] (-1051.051) -- 0:04:45
Average standard deviation of split frequencies: 0.031900
50500 -- [-1041.985] (-1048.810) (-1046.434) (-1048.878) * (-1042.122) (-1052.712) (-1052.338) [-1034.130] -- 0:05:00
51000 -- (-1045.263) (-1044.751) [-1039.401] (-1033.653) * (-1049.923) [-1038.923] (-1042.950) (-1034.334) -- 0:04:57
51500 -- (-1050.142) (-1043.167) (-1040.941) [-1038.839] * (-1042.945) [-1032.783] (-1061.429) (-1037.448) -- 0:04:54
52000 -- [-1048.016] (-1042.449) (-1036.837) (-1039.323) * (-1039.294) [-1036.843] (-1053.255) (-1035.931) -- 0:04:51
52500 -- (-1055.921) [-1040.306] (-1040.509) (-1041.806) * (-1046.622) (-1042.149) [-1034.176] (-1042.102) -- 0:04:48
53000 -- [-1047.127] (-1043.128) (-1038.444) (-1047.551) * (-1049.778) (-1041.246) [-1032.873] (-1050.527) -- 0:04:45
53500 -- [-1045.164] (-1044.958) (-1046.270) (-1047.179) * (-1058.594) (-1045.511) [-1049.736] (-1066.386) -- 0:05:00
54000 -- (-1053.319) (-1041.183) [-1043.931] (-1051.119) * (-1040.363) [-1036.650] (-1036.169) (-1051.094) -- 0:04:57
54500 -- (-1051.925) (-1045.597) [-1039.502] (-1038.663) * (-1051.082) [-1041.362] (-1037.781) (-1047.199) -- 0:04:54
55000 -- (-1057.129) (-1039.022) (-1052.762) [-1039.390] * (-1045.574) (-1043.287) (-1037.702) [-1037.969] -- 0:04:52
Average standard deviation of split frequencies: 0.032469
55500 -- (-1044.503) [-1042.256] (-1048.956) (-1047.928) * (-1046.457) [-1039.269] (-1041.021) (-1050.808) -- 0:04:49
56000 -- (-1041.743) (-1034.161) (-1043.082) [-1047.351] * (-1047.695) (-1052.143) [-1038.495] (-1046.863) -- 0:04:46
56500 -- (-1044.267) [-1039.158] (-1052.850) (-1041.532) * (-1046.661) (-1050.679) [-1038.892] (-1050.873) -- 0:05:00
57000 -- (-1045.144) (-1047.657) [-1044.929] (-1047.517) * (-1038.476) (-1043.929) [-1040.717] (-1045.819) -- 0:04:57
57500 -- (-1042.202) (-1050.814) (-1056.834) [-1046.768] * (-1046.641) (-1041.355) (-1054.235) [-1044.740] -- 0:04:55
58000 -- (-1043.280) (-1052.029) (-1035.252) [-1039.888] * (-1045.180) (-1052.615) [-1038.092] (-1046.207) -- 0:04:52
58500 -- (-1042.636) (-1041.757) [-1047.014] (-1040.864) * (-1047.626) [-1045.183] (-1040.450) (-1040.786) -- 0:04:49
59000 -- [-1038.943] (-1046.491) (-1035.803) (-1054.456) * (-1045.046) (-1054.327) (-1047.974) [-1042.726] -- 0:04:47
59500 -- (-1048.594) (-1047.734) (-1049.163) [-1045.353] * (-1047.013) (-1048.596) [-1036.045] (-1054.370) -- 0:04:44
60000 -- (-1046.088) (-1060.205) [-1042.506] (-1048.594) * [-1038.555] (-1049.239) (-1037.571) (-1045.533) -- 0:04:57
Average standard deviation of split frequencies: 0.029417
60500 -- (-1042.155) (-1057.082) [-1045.613] (-1044.073) * [-1049.462] (-1045.127) (-1037.096) (-1049.595) -- 0:04:55
61000 -- (-1040.914) (-1041.073) (-1037.996) [-1041.117] * (-1042.601) [-1044.461] (-1052.232) (-1060.460) -- 0:04:52
61500 -- (-1041.255) (-1050.681) (-1052.765) [-1042.646] * (-1048.194) [-1050.826] (-1039.365) (-1045.610) -- 0:04:49
62000 -- (-1042.812) (-1042.042) [-1034.115] (-1051.461) * (-1052.715) (-1057.616) (-1045.411) [-1052.068] -- 0:04:47
62500 -- (-1039.639) (-1044.808) (-1046.812) [-1048.817] * [-1046.875] (-1055.433) (-1040.567) (-1057.372) -- 0:04:45
63000 -- [-1036.324] (-1041.003) (-1054.890) (-1040.246) * [-1036.880] (-1043.854) (-1046.351) (-1049.701) -- 0:04:57
63500 -- (-1041.226) (-1045.350) [-1036.199] (-1052.362) * (-1035.451) [-1043.952] (-1035.425) (-1063.943) -- 0:04:54
64000 -- [-1047.561] (-1046.282) (-1037.754) (-1044.834) * [-1042.286] (-1047.591) (-1041.032) (-1045.743) -- 0:04:52
64500 -- [-1041.848] (-1038.640) (-1047.943) (-1052.027) * [-1042.435] (-1043.680) (-1046.238) (-1039.388) -- 0:04:50
65000 -- (-1044.986) (-1047.429) [-1043.597] (-1047.795) * (-1048.064) [-1038.667] (-1048.651) (-1049.222) -- 0:04:47
Average standard deviation of split frequencies: 0.021938
65500 -- (-1046.595) (-1038.473) (-1055.942) [-1043.802] * [-1052.128] (-1042.487) (-1051.341) (-1043.697) -- 0:04:45
66000 -- (-1049.650) [-1045.144] (-1064.400) (-1054.256) * (-1053.522) (-1047.879) (-1050.532) [-1046.744] -- 0:04:57
66500 -- (-1049.546) [-1038.010] (-1059.247) (-1049.255) * (-1053.927) [-1047.727] (-1069.860) (-1050.695) -- 0:04:54
67000 -- (-1045.482) [-1042.672] (-1047.901) (-1057.348) * (-1045.901) (-1043.038) (-1045.306) [-1038.811] -- 0:04:52
67500 -- (-1051.102) [-1047.443] (-1050.236) (-1050.777) * (-1052.809) (-1050.766) [-1041.627] (-1051.456) -- 0:04:50
68000 -- (-1040.837) (-1047.652) [-1040.441] (-1054.241) * (-1059.362) [-1037.376] (-1048.898) (-1054.492) -- 0:04:47
68500 -- (-1043.882) (-1046.712) [-1044.799] (-1045.191) * (-1057.451) (-1048.320) (-1049.704) [-1033.786] -- 0:04:45
69000 -- [-1036.816] (-1058.379) (-1045.193) (-1043.335) * (-1052.439) (-1039.021) [-1040.805] (-1039.839) -- 0:04:43
69500 -- [-1039.527] (-1043.060) (-1042.100) (-1052.940) * (-1047.463) (-1037.593) (-1035.241) [-1041.773] -- 0:04:54
70000 -- [-1042.214] (-1035.807) (-1044.545) (-1055.579) * (-1055.168) [-1037.285] (-1058.435) (-1050.579) -- 0:04:52
Average standard deviation of split frequencies: 0.028113
70500 -- (-1037.435) (-1051.250) [-1043.698] (-1055.637) * (-1056.433) (-1040.286) [-1043.472] (-1050.682) -- 0:04:50
71000 -- (-1043.711) (-1037.636) [-1045.851] (-1051.887) * (-1037.958) [-1043.158] (-1047.893) (-1052.121) -- 0:04:47
71500 -- (-1046.711) (-1052.646) [-1036.771] (-1046.349) * (-1044.640) (-1038.744) (-1040.580) [-1038.781] -- 0:04:45
72000 -- (-1049.826) (-1053.872) [-1038.835] (-1045.018) * (-1044.853) (-1046.955) [-1045.008] (-1044.726) -- 0:04:43
72500 -- (-1044.806) [-1046.428] (-1042.431) (-1045.193) * [-1040.720] (-1037.860) (-1033.842) (-1038.994) -- 0:04:54
73000 -- (-1053.521) [-1037.813] (-1055.071) (-1039.739) * [-1038.234] (-1038.013) (-1041.689) (-1043.490) -- 0:04:52
73500 -- (-1042.078) (-1042.961) [-1049.332] (-1036.200) * (-1041.719) (-1047.222) [-1040.746] (-1051.980) -- 0:04:49
74000 -- (-1046.283) (-1046.363) [-1038.941] (-1039.641) * (-1052.138) [-1042.083] (-1054.437) (-1063.588) -- 0:04:47
74500 -- [-1036.506] (-1047.058) (-1055.102) (-1044.510) * [-1045.667] (-1067.279) (-1047.722) (-1057.258) -- 0:04:45
75000 -- (-1058.203) (-1046.673) (-1052.216) [-1040.931] * (-1045.328) (-1050.764) [-1042.711] (-1047.554) -- 0:04:43
Average standard deviation of split frequencies: 0.031013
75500 -- [-1038.306] (-1051.593) (-1050.681) (-1055.508) * (-1033.077) [-1035.553] (-1048.336) (-1054.143) -- 0:04:53
76000 -- [-1043.221] (-1043.333) (-1051.568) (-1053.015) * (-1041.164) (-1050.083) (-1056.973) [-1038.289] -- 0:04:51
76500 -- [-1042.278] (-1039.429) (-1052.008) (-1062.944) * (-1044.895) [-1045.980] (-1046.097) (-1036.452) -- 0:04:49
77000 -- (-1052.009) [-1046.789] (-1051.960) (-1047.347) * (-1044.032) (-1051.619) (-1055.634) [-1033.924] -- 0:04:47
77500 -- (-1060.432) [-1052.704] (-1056.705) (-1046.374) * [-1042.482] (-1055.863) (-1039.198) (-1035.948) -- 0:04:45
78000 -- (-1056.044) [-1036.688] (-1035.340) (-1055.935) * (-1048.227) (-1058.508) [-1038.891] (-1042.352) -- 0:04:43
78500 -- (-1041.539) (-1035.079) [-1037.972] (-1045.022) * (-1037.450) (-1058.654) (-1038.537) [-1038.390] -- 0:04:41
79000 -- [-1042.365] (-1034.455) (-1042.102) (-1038.566) * [-1038.400] (-1052.576) (-1040.963) (-1057.292) -- 0:04:51
79500 -- (-1045.910) [-1038.836] (-1045.115) (-1058.447) * (-1042.809) (-1044.732) [-1037.200] (-1048.301) -- 0:04:49
80000 -- (-1050.579) [-1040.445] (-1050.873) (-1049.935) * [-1040.544] (-1045.961) (-1044.708) (-1049.431) -- 0:04:47
Average standard deviation of split frequencies: 0.029669
80500 -- (-1040.583) [-1037.462] (-1050.723) (-1044.000) * [-1039.531] (-1047.680) (-1045.055) (-1048.566) -- 0:04:45
81000 -- (-1049.852) [-1042.680] (-1051.519) (-1051.117) * (-1032.872) (-1049.600) [-1046.676] (-1060.571) -- 0:04:43
81500 -- [-1045.284] (-1042.859) (-1043.168) (-1048.660) * [-1039.266] (-1057.943) (-1043.573) (-1049.880) -- 0:04:41
82000 -- (-1041.876) [-1040.224] (-1041.467) (-1045.272) * [-1039.984] (-1040.057) (-1042.807) (-1053.010) -- 0:04:51
82500 -- (-1048.298) [-1040.983] (-1047.341) (-1036.945) * (-1041.390) [-1036.155] (-1057.899) (-1046.823) -- 0:04:49
83000 -- (-1048.709) (-1045.394) [-1037.274] (-1051.416) * (-1043.733) [-1033.031] (-1053.294) (-1050.167) -- 0:04:47
83500 -- [-1044.638] (-1037.083) (-1061.771) (-1045.473) * [-1040.839] (-1053.065) (-1044.444) (-1038.285) -- 0:04:45
84000 -- (-1044.927) (-1059.608) (-1035.942) [-1047.064] * (-1045.811) (-1046.737) (-1045.162) [-1041.322] -- 0:04:43
84500 -- (-1048.856) (-1070.845) [-1034.009] (-1046.384) * (-1052.460) [-1042.697] (-1051.441) (-1048.875) -- 0:04:41
85000 -- (-1052.141) [-1045.081] (-1036.705) (-1054.334) * (-1044.188) [-1037.627] (-1040.583) (-1044.866) -- 0:04:50
Average standard deviation of split frequencies: 0.029515
85500 -- (-1046.852) [-1039.164] (-1041.381) (-1042.588) * (-1047.270) (-1046.605) [-1032.081] (-1059.874) -- 0:04:48
86000 -- (-1050.827) (-1045.785) (-1055.284) [-1038.126] * (-1051.760) (-1043.760) [-1035.549] (-1056.858) -- 0:04:46
86500 -- (-1046.058) (-1048.707) (-1038.986) [-1042.643] * (-1044.866) (-1042.289) [-1043.184] (-1057.248) -- 0:04:45
87000 -- (-1046.815) [-1040.942] (-1053.056) (-1054.471) * (-1038.676) (-1043.970) [-1043.315] (-1047.029) -- 0:04:43
87500 -- (-1048.769) (-1038.014) (-1048.720) [-1041.005] * (-1042.397) (-1044.450) [-1039.676] (-1046.651) -- 0:04:41
88000 -- [-1042.986] (-1040.380) (-1052.840) (-1048.234) * (-1041.179) (-1040.708) [-1045.840] (-1044.453) -- 0:04:50
88500 -- (-1045.383) (-1039.807) (-1038.570) [-1042.031] * (-1045.660) (-1049.814) (-1038.977) [-1037.056] -- 0:04:48
89000 -- (-1045.628) [-1038.439] (-1045.946) (-1043.599) * (-1039.248) (-1058.857) [-1035.911] (-1045.513) -- 0:04:46
89500 -- [-1044.039] (-1049.741) (-1046.860) (-1045.451) * (-1046.156) [-1047.738] (-1036.666) (-1042.001) -- 0:04:44
90000 -- (-1055.562) (-1047.347) [-1044.033] (-1038.392) * (-1046.512) [-1047.073] (-1039.750) (-1041.005) -- 0:04:43
Average standard deviation of split frequencies: 0.025597
90500 -- (-1058.930) (-1047.054) [-1042.596] (-1045.127) * (-1042.874) [-1042.185] (-1045.858) (-1051.695) -- 0:04:41
91000 -- [-1041.837] (-1037.374) (-1046.728) (-1052.098) * [-1037.663] (-1047.567) (-1057.209) (-1043.137) -- 0:04:49
91500 -- (-1038.122) [-1043.949] (-1050.285) (-1042.234) * (-1038.891) (-1049.372) (-1047.441) [-1035.394] -- 0:04:47
92000 -- [-1040.777] (-1043.966) (-1042.993) (-1041.899) * [-1042.323] (-1045.390) (-1045.184) (-1047.427) -- 0:04:46
92500 -- (-1048.157) [-1041.307] (-1051.090) (-1042.589) * (-1054.936) (-1035.928) (-1058.264) [-1034.193] -- 0:04:44
93000 -- (-1042.448) [-1039.702] (-1058.565) (-1044.890) * [-1034.785] (-1039.598) (-1058.497) (-1041.003) -- 0:04:42
93500 -- [-1045.318] (-1044.821) (-1051.545) (-1040.311) * (-1039.393) (-1052.714) (-1057.184) [-1041.467] -- 0:04:41
94000 -- [-1040.975] (-1049.707) (-1046.968) (-1044.516) * [-1045.521] (-1049.824) (-1046.146) (-1036.246) -- 0:04:39
94500 -- (-1039.637) [-1045.671] (-1048.154) (-1050.829) * (-1041.259) (-1051.388) (-1043.225) [-1036.868] -- 0:04:47
95000 -- (-1039.308) (-1038.242) [-1041.606] (-1047.889) * (-1050.873) [-1036.665] (-1049.875) (-1045.298) -- 0:04:45
Average standard deviation of split frequencies: 0.022286
95500 -- (-1033.930) (-1048.922) (-1047.314) [-1042.395] * [-1036.469] (-1038.740) (-1037.262) (-1046.629) -- 0:04:44
96000 -- (-1042.303) (-1047.758) (-1048.927) [-1037.597] * [-1033.097] (-1041.945) (-1051.689) (-1049.580) -- 0:04:42
96500 -- [-1037.122] (-1045.314) (-1047.919) (-1040.464) * (-1045.505) [-1052.279] (-1038.249) (-1047.876) -- 0:04:40
97000 -- [-1035.184] (-1053.072) (-1051.994) (-1041.126) * [-1041.726] (-1045.447) (-1049.044) (-1040.210) -- 0:04:39
97500 -- [-1037.482] (-1049.708) (-1051.164) (-1037.458) * [-1043.051] (-1045.404) (-1030.490) (-1038.698) -- 0:04:46
98000 -- (-1054.838) (-1042.913) [-1050.748] (-1048.728) * (-1042.798) [-1035.645] (-1042.254) (-1038.195) -- 0:04:45
98500 -- (-1061.889) (-1052.652) [-1045.427] (-1039.823) * (-1051.120) (-1054.106) (-1045.835) [-1036.545] -- 0:04:43
99000 -- (-1052.561) [-1042.782] (-1045.721) (-1037.402) * (-1044.331) (-1048.970) (-1043.537) [-1044.532] -- 0:04:42
99500 -- (-1039.916) (-1056.671) [-1042.823] (-1043.956) * [-1043.747] (-1054.753) (-1037.467) (-1034.784) -- 0:04:40
100000 -- [-1042.428] (-1053.129) (-1052.335) (-1064.065) * (-1050.111) [-1042.503] (-1038.728) (-1043.814) -- 0:04:39
Average standard deviation of split frequencies: 0.017651
100500 -- (-1053.108) (-1048.230) [-1048.626] (-1038.094) * (-1041.823) (-1055.801) [-1039.770] (-1052.600) -- 0:04:46
101000 -- (-1040.410) (-1051.758) [-1039.694] (-1047.429) * (-1047.450) (-1051.654) [-1042.207] (-1037.842) -- 0:04:44
101500 -- [-1043.838] (-1054.306) (-1042.658) (-1038.642) * (-1042.875) (-1042.635) (-1050.716) [-1045.632] -- 0:04:43
102000 -- (-1053.934) (-1048.750) (-1041.249) [-1048.283] * (-1044.252) [-1039.977] (-1053.945) (-1041.661) -- 0:04:41
102500 -- (-1042.848) [-1046.352] (-1040.511) (-1063.703) * (-1048.683) [-1040.692] (-1057.348) (-1046.470) -- 0:04:40
103000 -- [-1050.573] (-1047.296) (-1048.030) (-1051.906) * (-1053.581) (-1040.960) (-1047.970) [-1039.874] -- 0:04:38
103500 -- (-1046.939) (-1040.245) (-1036.789) [-1050.184] * (-1049.006) [-1049.181] (-1044.277) (-1040.925) -- 0:04:45
104000 -- (-1046.288) (-1036.535) (-1040.821) [-1036.945] * (-1049.279) [-1042.821] (-1056.238) (-1036.190) -- 0:04:44
104500 -- (-1048.758) (-1042.441) (-1051.836) [-1041.450] * (-1041.856) [-1041.953] (-1045.969) (-1040.060) -- 0:04:42
105000 -- [-1041.721] (-1044.536) (-1072.379) (-1044.909) * [-1038.720] (-1047.575) (-1045.776) (-1042.216) -- 0:04:41
Average standard deviation of split frequencies: 0.015394
105500 -- (-1046.038) [-1044.947] (-1051.091) (-1047.839) * (-1039.758) (-1038.934) (-1058.879) [-1039.944] -- 0:04:39
106000 -- (-1054.937) (-1039.857) (-1040.974) [-1043.826] * (-1061.218) (-1045.839) (-1050.831) [-1035.267] -- 0:04:38
106500 -- (-1057.969) (-1043.658) (-1049.304) [-1049.401] * (-1048.526) (-1048.298) [-1038.961] (-1039.986) -- 0:04:36
107000 -- (-1054.434) (-1044.078) (-1045.673) [-1033.055] * (-1043.123) (-1053.137) [-1038.869] (-1053.973) -- 0:04:43
107500 -- (-1040.874) (-1045.022) (-1047.691) [-1037.616] * [-1042.100] (-1047.868) (-1035.593) (-1054.668) -- 0:04:42
108000 -- (-1042.065) (-1063.599) (-1042.603) [-1048.965] * [-1035.591] (-1046.108) (-1048.312) (-1054.110) -- 0:04:40
108500 -- [-1045.573] (-1051.717) (-1047.724) (-1042.232) * (-1054.150) (-1059.463) [-1039.200] (-1047.419) -- 0:04:39
109000 -- (-1049.349) [-1052.832] (-1048.422) (-1057.265) * [-1041.917] (-1055.571) (-1056.049) (-1040.125) -- 0:04:37
109500 -- (-1049.387) (-1056.705) [-1038.578] (-1036.920) * (-1041.314) (-1048.444) [-1038.789] (-1043.028) -- 0:04:36
110000 -- (-1049.072) (-1049.662) [-1039.628] (-1039.590) * (-1049.927) (-1047.138) (-1051.094) [-1045.029] -- 0:04:43
Average standard deviation of split frequencies: 0.013762
110500 -- (-1041.067) (-1048.288) [-1035.633] (-1055.107) * (-1062.210) (-1047.731) [-1044.232] (-1041.715) -- 0:04:41
111000 -- (-1040.676) (-1050.726) (-1037.261) [-1036.971] * (-1038.406) (-1047.095) [-1032.851] (-1036.044) -- 0:04:40
111500 -- (-1053.346) (-1041.807) [-1043.224] (-1034.857) * (-1055.104) (-1053.603) (-1041.103) [-1043.958] -- 0:04:38
112000 -- (-1042.589) (-1053.792) (-1044.681) [-1042.320] * (-1040.722) [-1046.549] (-1036.905) (-1045.275) -- 0:04:37
112500 -- (-1039.267) (-1051.193) (-1054.652) [-1045.110] * [-1044.187] (-1046.989) (-1047.340) (-1047.971) -- 0:04:36
113000 -- (-1038.640) (-1038.636) (-1048.975) [-1034.962] * [-1040.789] (-1049.194) (-1046.142) (-1038.410) -- 0:04:42
113500 -- (-1048.926) (-1048.663) (-1060.135) [-1045.239] * (-1044.624) [-1037.443] (-1053.348) (-1043.604) -- 0:04:41
114000 -- (-1043.606) [-1043.211] (-1037.607) (-1041.215) * (-1049.277) [-1035.452] (-1042.265) (-1055.754) -- 0:04:39
114500 -- [-1037.699] (-1043.947) (-1042.546) (-1052.239) * (-1042.072) [-1045.425] (-1042.080) (-1043.991) -- 0:04:38
115000 -- [-1039.839] (-1045.659) (-1041.422) (-1051.960) * (-1043.623) (-1044.643) (-1045.249) [-1039.355] -- 0:04:37
Average standard deviation of split frequencies: 0.016255
115500 -- (-1052.982) (-1043.273) [-1048.055] (-1046.667) * (-1045.098) (-1042.713) (-1063.669) [-1039.484] -- 0:04:35
116000 -- [-1033.009] (-1047.434) (-1046.219) (-1046.521) * [-1052.528] (-1042.049) (-1050.691) (-1037.685) -- 0:04:41
116500 -- [-1041.496] (-1057.418) (-1053.817) (-1045.919) * [-1043.584] (-1038.582) (-1050.578) (-1032.216) -- 0:04:40
117000 -- (-1053.249) [-1044.763] (-1051.047) (-1064.278) * (-1042.244) (-1043.026) (-1040.192) [-1043.750] -- 0:04:39
117500 -- (-1044.638) (-1056.159) [-1040.433] (-1048.809) * (-1044.250) [-1036.693] (-1049.059) (-1044.529) -- 0:04:37
118000 -- (-1049.997) [-1045.082] (-1050.059) (-1042.677) * (-1045.618) (-1045.789) (-1047.584) [-1048.718] -- 0:04:36
118500 -- [-1042.760] (-1042.478) (-1058.739) (-1044.991) * [-1035.382] (-1044.888) (-1049.569) (-1054.946) -- 0:04:35
119000 -- (-1041.027) (-1045.320) (-1054.875) [-1035.099] * (-1042.775) [-1043.578] (-1047.668) (-1049.308) -- 0:04:33
119500 -- [-1039.517] (-1045.674) (-1044.645) (-1054.597) * (-1050.076) [-1044.666] (-1046.950) (-1043.867) -- 0:04:39
120000 -- (-1040.273) (-1047.090) [-1037.026] (-1044.853) * (-1039.646) [-1036.345] (-1064.582) (-1035.876) -- 0:04:38
Average standard deviation of split frequencies: 0.014425
120500 -- (-1042.418) (-1045.225) [-1050.431] (-1048.478) * (-1044.400) (-1040.387) (-1043.778) [-1040.414] -- 0:04:37
121000 -- (-1041.530) (-1053.423) (-1038.567) [-1034.767] * (-1042.510) (-1052.440) [-1035.826] (-1055.737) -- 0:04:36
121500 -- [-1038.924] (-1037.483) (-1038.786) (-1044.972) * (-1045.896) (-1049.986) [-1041.680] (-1049.323) -- 0:04:34
122000 -- (-1041.174) [-1047.357] (-1039.297) (-1052.788) * (-1046.326) (-1049.859) (-1041.677) [-1037.035] -- 0:04:33
122500 -- (-1045.594) (-1050.091) (-1046.584) [-1036.887] * [-1056.153] (-1052.956) (-1038.164) (-1053.077) -- 0:04:39
123000 -- (-1045.620) (-1039.639) (-1048.301) [-1040.772] * (-1057.883) [-1039.917] (-1042.234) (-1050.309) -- 0:04:38
123500 -- (-1048.890) (-1052.697) [-1038.329] (-1037.981) * [-1037.219] (-1055.060) (-1039.821) (-1039.662) -- 0:04:36
124000 -- [-1033.025] (-1044.165) (-1043.818) (-1053.433) * (-1041.550) (-1048.977) (-1048.617) [-1047.129] -- 0:04:35
124500 -- (-1041.853) (-1044.030) [-1040.798] (-1039.816) * [-1041.698] (-1051.376) (-1056.928) (-1039.633) -- 0:04:34
125000 -- [-1041.209] (-1048.944) (-1048.157) (-1048.545) * (-1051.357) (-1052.324) (-1044.420) [-1039.907] -- 0:04:33
Average standard deviation of split frequencies: 0.013362
125500 -- (-1041.666) [-1043.509] (-1042.389) (-1037.329) * (-1053.380) [-1048.902] (-1045.861) (-1035.659) -- 0:04:38
126000 -- [-1042.829] (-1046.389) (-1044.014) (-1042.775) * (-1047.560) [-1041.568] (-1046.130) (-1048.396) -- 0:04:37
126500 -- [-1036.144] (-1053.497) (-1048.137) (-1046.286) * (-1044.673) (-1052.440) [-1038.123] (-1041.916) -- 0:04:36
127000 -- (-1033.749) (-1039.869) (-1044.109) [-1035.251] * (-1032.987) [-1036.573] (-1048.123) (-1047.227) -- 0:04:34
127500 -- (-1041.802) [-1042.779] (-1054.874) (-1044.818) * (-1049.968) [-1041.081] (-1049.883) (-1054.156) -- 0:04:33
128000 -- (-1055.351) [-1040.562] (-1051.073) (-1048.484) * (-1048.462) [-1045.941] (-1064.384) (-1052.167) -- 0:04:32
128500 -- (-1054.606) [-1043.180] (-1036.132) (-1050.240) * [-1036.987] (-1044.974) (-1059.826) (-1044.232) -- 0:04:38
129000 -- (-1052.448) (-1051.329) [-1042.893] (-1047.749) * (-1048.211) [-1042.987] (-1055.796) (-1051.421) -- 0:04:36
129500 -- (-1046.690) (-1047.905) (-1057.262) [-1047.482] * [-1044.278] (-1046.862) (-1034.710) (-1043.312) -- 0:04:35
130000 -- (-1047.477) (-1051.576) (-1045.941) [-1034.996] * [-1043.785] (-1047.965) (-1041.881) (-1034.918) -- 0:04:34
Average standard deviation of split frequencies: 0.011933
130500 -- (-1063.822) (-1049.021) [-1036.806] (-1049.475) * (-1036.828) [-1034.193] (-1045.107) (-1044.520) -- 0:04:33
131000 -- (-1059.637) (-1060.184) [-1047.423] (-1046.924) * [-1046.845] (-1043.490) (-1066.447) (-1051.346) -- 0:04:31
131500 -- (-1045.895) (-1049.980) (-1046.637) [-1043.261] * [-1042.061] (-1044.966) (-1045.544) (-1042.997) -- 0:04:37
132000 -- (-1057.130) (-1042.858) (-1048.158) [-1036.515] * (-1043.357) (-1034.923) (-1040.790) [-1045.529] -- 0:04:36
132500 -- [-1043.413] (-1042.432) (-1045.241) (-1038.037) * [-1042.580] (-1044.136) (-1042.717) (-1049.234) -- 0:04:34
133000 -- (-1048.202) [-1048.102] (-1044.566) (-1041.975) * [-1045.771] (-1047.142) (-1042.470) (-1054.516) -- 0:04:33
133500 -- (-1055.844) (-1056.541) (-1044.697) [-1044.401] * [-1035.804] (-1037.531) (-1041.783) (-1036.311) -- 0:04:32
134000 -- (-1040.302) (-1049.576) (-1044.957) [-1036.998] * [-1040.510] (-1041.146) (-1047.616) (-1047.185) -- 0:04:31
134500 -- (-1041.156) (-1051.327) [-1048.116] (-1051.825) * (-1045.858) (-1039.787) (-1059.915) [-1039.842] -- 0:04:30
135000 -- [-1044.652] (-1054.415) (-1047.379) (-1049.998) * [-1037.914] (-1053.155) (-1046.407) (-1046.995) -- 0:04:35
Average standard deviation of split frequencies: 0.011732
135500 -- [-1054.314] (-1045.310) (-1041.161) (-1038.119) * (-1042.189) (-1051.728) (-1044.244) [-1042.541] -- 0:04:34
136000 -- (-1042.958) (-1049.370) (-1036.533) [-1047.556] * (-1037.441) (-1036.920) [-1044.439] (-1046.535) -- 0:04:33
136500 -- (-1053.908) (-1045.537) [-1041.024] (-1045.895) * (-1038.501) (-1051.416) (-1041.942) [-1035.170] -- 0:04:32
137000 -- [-1049.848] (-1051.855) (-1038.470) (-1049.780) * [-1039.968] (-1047.414) (-1047.121) (-1045.430) -- 0:04:30
137500 -- (-1053.375) (-1047.566) (-1055.543) [-1038.821] * (-1040.829) (-1045.736) [-1036.912] (-1045.584) -- 0:04:29
138000 -- (-1035.092) [-1040.939] (-1040.236) (-1043.218) * (-1043.257) [-1044.726] (-1039.369) (-1040.510) -- 0:04:34
138500 -- [-1036.301] (-1043.439) (-1038.884) (-1045.848) * (-1038.010) (-1045.366) (-1043.436) [-1039.040] -- 0:04:33
139000 -- (-1036.290) (-1052.665) [-1038.905] (-1037.451) * [-1040.527] (-1044.467) (-1052.044) (-1039.295) -- 0:04:32
139500 -- (-1042.560) (-1037.764) [-1038.387] (-1050.575) * (-1052.858) (-1044.308) (-1055.821) [-1039.153] -- 0:04:31
140000 -- (-1047.592) [-1039.309] (-1042.850) (-1047.005) * (-1041.779) [-1046.611] (-1049.672) (-1037.610) -- 0:04:30
Average standard deviation of split frequencies: 0.010311
140500 -- (-1057.546) (-1045.441) [-1038.184] (-1051.112) * [-1040.315] (-1046.018) (-1047.959) (-1047.112) -- 0:04:29
141000 -- (-1038.103) (-1038.776) (-1044.843) [-1035.624] * (-1040.191) (-1051.833) (-1049.772) [-1039.893] -- 0:04:34
141500 -- (-1053.891) [-1046.550] (-1050.208) (-1046.852) * (-1046.557) (-1064.634) (-1045.500) [-1040.277] -- 0:04:33
142000 -- [-1047.234] (-1055.032) (-1046.243) (-1050.890) * (-1044.280) (-1056.971) [-1040.954] (-1050.320) -- 0:04:31
142500 -- (-1042.442) (-1049.677) (-1041.895) [-1031.133] * (-1049.262) [-1050.475] (-1043.778) (-1043.697) -- 0:04:30
143000 -- (-1046.936) (-1045.630) (-1045.572) [-1036.064] * (-1047.686) (-1056.817) [-1045.421] (-1048.566) -- 0:04:29
143500 -- (-1045.246) [-1050.934] (-1052.500) (-1050.074) * (-1044.802) [-1042.925] (-1043.805) (-1048.310) -- 0:04:28
144000 -- (-1032.461) (-1055.349) (-1057.741) [-1039.043] * (-1061.766) (-1049.481) (-1042.148) [-1047.985] -- 0:04:33
144500 -- [-1035.974] (-1043.921) (-1038.288) (-1051.088) * (-1043.444) [-1042.098] (-1039.799) (-1053.063) -- 0:04:32
145000 -- (-1067.572) [-1038.361] (-1052.782) (-1046.548) * (-1048.459) (-1042.824) [-1040.897] (-1055.902) -- 0:04:31
Average standard deviation of split frequencies: 0.011425
145500 -- (-1049.033) (-1054.752) (-1059.367) [-1051.378] * (-1044.798) [-1048.712] (-1042.328) (-1046.156) -- 0:04:30
146000 -- (-1050.392) [-1037.705] (-1050.888) (-1039.967) * (-1043.707) [-1038.042] (-1038.530) (-1053.999) -- 0:04:29
146500 -- [-1048.009] (-1047.173) (-1044.177) (-1043.749) * (-1039.749) (-1045.957) [-1036.783] (-1058.234) -- 0:04:27
147000 -- (-1055.187) (-1050.828) (-1041.930) [-1043.685] * (-1049.004) [-1035.948] (-1043.240) (-1053.428) -- 0:04:32
147500 -- (-1046.994) (-1039.694) (-1056.167) [-1046.068] * (-1042.910) [-1030.863] (-1049.994) (-1052.117) -- 0:04:31
148000 -- (-1060.234) [-1042.606] (-1041.170) (-1040.110) * (-1046.478) [-1047.028] (-1045.486) (-1050.917) -- 0:04:30
148500 -- (-1049.098) [-1039.263] (-1046.625) (-1036.531) * (-1044.377) (-1041.283) (-1036.090) [-1042.789] -- 0:04:29
149000 -- (-1032.880) (-1040.137) (-1051.966) [-1042.082] * (-1042.088) (-1051.843) [-1037.982] (-1046.637) -- 0:04:28
149500 -- (-1033.810) (-1050.614) (-1050.541) [-1033.556] * (-1060.224) (-1066.731) [-1048.682] (-1051.195) -- 0:04:27
150000 -- (-1047.059) (-1050.870) (-1050.859) [-1035.172] * (-1047.158) [-1046.971] (-1065.005) (-1043.630) -- 0:04:32
Average standard deviation of split frequencies: 0.012756
150500 -- (-1042.525) (-1047.704) (-1053.486) [-1035.846] * (-1048.326) [-1041.766] (-1046.034) (-1049.117) -- 0:04:30
151000 -- [-1035.859] (-1040.984) (-1048.201) (-1050.968) * (-1046.094) (-1041.681) [-1043.416] (-1052.447) -- 0:04:29
151500 -- (-1052.923) [-1036.807] (-1059.220) (-1045.649) * (-1051.182) [-1045.065] (-1040.219) (-1047.974) -- 0:04:28
152000 -- (-1045.992) (-1046.385) (-1047.172) [-1038.280] * (-1051.409) (-1045.862) [-1038.517] (-1052.814) -- 0:04:27
152500 -- (-1043.145) [-1039.646] (-1046.115) (-1049.935) * (-1057.255) (-1049.197) (-1039.136) [-1049.437] -- 0:04:26
153000 -- (-1046.968) [-1044.777] (-1051.206) (-1040.396) * (-1048.643) [-1042.712] (-1052.377) (-1045.367) -- 0:04:25
153500 -- (-1048.794) (-1047.772) (-1047.006) [-1045.693] * (-1038.861) [-1045.793] (-1054.024) (-1035.773) -- 0:04:30
154000 -- (-1050.915) [-1035.135] (-1042.735) (-1045.400) * (-1047.064) (-1059.932) [-1043.986] (-1046.847) -- 0:04:29
154500 -- (-1047.009) (-1043.315) (-1051.855) [-1034.464] * (-1045.444) (-1055.484) (-1047.219) [-1044.286] -- 0:04:28
155000 -- [-1036.448] (-1043.943) (-1048.366) (-1047.773) * (-1041.771) (-1041.941) [-1036.526] (-1042.220) -- 0:04:27
Average standard deviation of split frequencies: 0.014179
155500 -- (-1039.652) (-1042.770) (-1055.963) [-1035.495] * (-1054.697) (-1046.188) [-1044.717] (-1048.028) -- 0:04:26
156000 -- (-1044.997) (-1048.018) [-1037.030] (-1044.014) * (-1042.098) [-1045.213] (-1048.714) (-1043.909) -- 0:04:25
156500 -- (-1045.287) [-1043.653] (-1049.328) (-1051.251) * (-1042.308) (-1045.277) (-1048.101) [-1041.724] -- 0:04:29
157000 -- (-1047.054) (-1042.134) [-1041.605] (-1042.348) * (-1054.640) [-1046.049] (-1043.221) (-1052.503) -- 0:04:28
157500 -- [-1036.729] (-1049.189) (-1039.240) (-1049.130) * [-1052.051] (-1049.300) (-1047.465) (-1052.508) -- 0:04:27
158000 -- (-1043.530) (-1036.621) [-1040.009] (-1052.050) * (-1056.475) [-1036.890] (-1046.782) (-1048.734) -- 0:04:26
158500 -- (-1044.645) [-1043.801] (-1044.745) (-1045.974) * (-1047.857) [-1034.554] (-1044.867) (-1049.394) -- 0:04:25
159000 -- (-1034.208) (-1053.979) [-1037.858] (-1045.703) * (-1051.018) [-1033.355] (-1047.463) (-1055.947) -- 0:04:29
159500 -- [-1032.081] (-1034.981) (-1047.915) (-1049.027) * (-1040.616) (-1047.234) (-1036.494) [-1042.335] -- 0:04:28
160000 -- [-1040.784] (-1048.854) (-1044.014) (-1048.358) * (-1067.440) (-1045.322) [-1030.542] (-1044.843) -- 0:04:27
Average standard deviation of split frequencies: 0.014896
160500 -- (-1044.650) (-1041.498) (-1054.151) [-1045.407] * (-1074.335) [-1041.188] (-1036.478) (-1049.250) -- 0:04:26
161000 -- (-1047.074) [-1037.189] (-1048.597) (-1043.589) * (-1057.010) [-1040.357] (-1041.217) (-1062.426) -- 0:04:25
161500 -- (-1045.231) [-1041.379] (-1045.537) (-1049.126) * (-1056.445) (-1038.189) [-1039.851] (-1067.132) -- 0:04:24
162000 -- (-1051.487) (-1037.404) [-1035.382] (-1037.364) * (-1051.407) (-1039.283) (-1042.589) [-1052.419] -- 0:04:28
162500 -- (-1043.394) [-1037.722] (-1038.582) (-1040.086) * [-1036.357] (-1049.844) (-1045.684) (-1043.682) -- 0:04:28
163000 -- (-1050.855) (-1048.808) (-1058.991) [-1043.016] * [-1051.634] (-1062.350) (-1054.415) (-1055.223) -- 0:04:27
163500 -- (-1043.444) (-1048.211) (-1036.042) [-1050.498] * (-1037.634) (-1049.258) (-1051.899) [-1044.835] -- 0:04:26
164000 -- (-1042.304) [-1042.856] (-1050.618) (-1050.980) * (-1050.032) [-1038.903] (-1049.573) (-1048.212) -- 0:04:25
164500 -- (-1051.077) (-1050.073) [-1035.510] (-1053.032) * (-1048.683) (-1048.667) [-1037.186] (-1055.467) -- 0:04:24
165000 -- (-1049.772) (-1040.367) [-1045.122] (-1036.011) * (-1046.566) (-1050.068) [-1045.449] (-1050.638) -- 0:04:28
Average standard deviation of split frequencies: 0.014402
165500 -- (-1042.592) (-1040.256) (-1049.231) [-1041.811] * (-1043.116) (-1037.494) (-1037.639) [-1052.590] -- 0:04:27
166000 -- (-1048.259) (-1044.992) (-1053.719) [-1041.651] * (-1060.720) (-1042.129) [-1041.530] (-1063.444) -- 0:04:26
166500 -- (-1047.171) (-1033.055) (-1051.510) [-1033.574] * [-1047.674] (-1041.284) (-1060.795) (-1056.627) -- 0:04:25
167000 -- (-1050.286) [-1038.029] (-1041.351) (-1046.006) * (-1053.082) (-1042.747) [-1034.983] (-1047.272) -- 0:04:24
167500 -- (-1044.032) (-1048.352) (-1044.862) [-1048.680] * (-1039.991) (-1038.406) (-1060.958) [-1036.548] -- 0:04:23
168000 -- (-1046.369) (-1053.536) [-1039.029] (-1059.970) * (-1042.780) (-1049.272) [-1040.775] (-1035.712) -- 0:04:27
168500 -- [-1047.762] (-1045.299) (-1054.468) (-1052.882) * (-1040.085) (-1041.243) [-1048.971] (-1048.501) -- 0:04:26
169000 -- (-1044.513) (-1039.246) [-1048.411] (-1049.386) * (-1042.884) (-1038.020) [-1047.207] (-1051.096) -- 0:04:25
169500 -- [-1039.554] (-1042.025) (-1062.115) (-1050.701) * (-1052.999) (-1046.766) (-1048.276) [-1041.862] -- 0:04:24
170000 -- (-1049.331) (-1056.560) [-1031.785] (-1038.557) * (-1059.767) (-1048.552) [-1037.787] (-1055.417) -- 0:04:23
Average standard deviation of split frequencies: 0.013811
170500 -- (-1053.952) (-1055.717) [-1041.037] (-1043.195) * (-1039.077) [-1043.378] (-1054.420) (-1058.464) -- 0:04:22
171000 -- (-1038.350) (-1058.107) (-1047.724) [-1043.482] * (-1044.741) [-1041.073] (-1049.148) (-1053.389) -- 0:04:21
171500 -- [-1042.878] (-1054.967) (-1046.385) (-1050.505) * [-1034.064] (-1046.090) (-1040.126) (-1049.197) -- 0:04:25
172000 -- [-1036.871] (-1045.973) (-1036.560) (-1045.651) * (-1047.276) [-1046.240] (-1035.772) (-1036.386) -- 0:04:24
172500 -- (-1045.308) (-1053.487) (-1050.410) [-1044.294] * (-1035.921) (-1040.029) [-1037.670] (-1048.567) -- 0:04:23
173000 -- [-1049.318] (-1054.546) (-1038.692) (-1040.292) * (-1039.709) (-1035.123) [-1031.033] (-1037.058) -- 0:04:22
173500 -- [-1045.438] (-1059.340) (-1043.917) (-1042.500) * (-1054.633) (-1040.155) (-1045.306) [-1044.453] -- 0:04:22
174000 -- (-1042.290) (-1055.107) (-1045.026) [-1040.271] * (-1054.450) [-1045.903] (-1068.331) (-1049.346) -- 0:04:21
174500 -- [-1042.339] (-1043.316) (-1047.627) (-1043.949) * (-1045.543) (-1043.873) (-1045.367) [-1037.517] -- 0:04:24
175000 -- (-1052.928) (-1047.566) (-1037.733) [-1039.128] * [-1041.597] (-1054.774) (-1046.168) (-1045.119) -- 0:04:24
Average standard deviation of split frequencies: 0.014540
175500 -- (-1049.344) (-1055.074) (-1041.369) [-1039.844] * (-1048.965) (-1043.401) [-1040.875] (-1046.484) -- 0:04:23
176000 -- (-1042.011) (-1040.381) (-1048.813) [-1042.345] * (-1045.955) [-1041.284] (-1032.661) (-1047.523) -- 0:04:22
176500 -- [-1041.998] (-1056.197) (-1042.121) (-1043.973) * (-1047.570) [-1039.169] (-1051.671) (-1052.955) -- 0:04:21
177000 -- (-1050.081) (-1044.993) [-1036.856] (-1040.396) * [-1049.063] (-1044.396) (-1044.550) (-1047.431) -- 0:04:20
177500 -- (-1047.177) [-1038.826] (-1056.512) (-1042.241) * (-1047.326) [-1038.077] (-1049.765) (-1040.229) -- 0:04:24
178000 -- (-1057.518) (-1040.549) [-1037.922] (-1048.535) * (-1046.253) [-1052.298] (-1052.413) (-1035.505) -- 0:04:23
178500 -- (-1051.462) [-1048.562] (-1041.272) (-1045.806) * [-1034.721] (-1054.393) (-1061.950) (-1046.271) -- 0:04:22
179000 -- (-1051.595) (-1047.234) (-1042.992) [-1044.457] * (-1030.597) (-1049.221) (-1049.689) [-1045.765] -- 0:04:21
179500 -- (-1048.733) (-1038.348) [-1036.770] (-1050.766) * (-1040.364) (-1039.928) (-1051.344) [-1045.907] -- 0:04:20
180000 -- (-1046.314) (-1039.366) [-1043.701] (-1047.975) * (-1043.917) (-1042.035) (-1052.110) [-1034.624] -- 0:04:24
Average standard deviation of split frequencies: 0.015096
180500 -- (-1045.166) [-1043.493] (-1062.600) (-1045.825) * (-1038.772) [-1041.202] (-1040.512) (-1041.369) -- 0:04:23
181000 -- (-1043.791) (-1049.735) [-1050.417] (-1056.606) * (-1041.592) (-1045.469) (-1038.523) [-1041.701] -- 0:04:22
181500 -- (-1047.420) (-1045.981) (-1038.048) [-1046.298] * (-1045.101) (-1040.910) (-1050.977) [-1042.003] -- 0:04:21
182000 -- [-1048.677] (-1048.845) (-1055.199) (-1052.537) * (-1045.335) [-1037.457] (-1036.846) (-1048.221) -- 0:04:20
182500 -- (-1056.437) [-1039.607] (-1050.860) (-1049.033) * (-1049.830) (-1049.372) [-1037.216] (-1054.016) -- 0:04:19
183000 -- (-1043.037) (-1043.773) [-1041.105] (-1046.026) * (-1047.177) [-1044.083] (-1048.223) (-1050.795) -- 0:04:23
183500 -- [-1048.492] (-1041.573) (-1047.262) (-1054.731) * (-1047.774) (-1041.333) [-1042.055] (-1059.217) -- 0:04:22
184000 -- (-1037.979) [-1043.174] (-1048.658) (-1063.232) * (-1046.535) (-1050.060) [-1051.119] (-1044.214) -- 0:04:21
184500 -- (-1043.503) (-1049.500) [-1044.565] (-1037.669) * (-1050.259) (-1037.818) (-1045.068) [-1042.247] -- 0:04:20
185000 -- [-1045.188] (-1052.219) (-1053.203) (-1043.040) * (-1057.531) [-1041.428] (-1043.392) (-1043.194) -- 0:04:19
Average standard deviation of split frequencies: 0.015569
185500 -- [-1037.673] (-1054.399) (-1047.144) (-1049.440) * (-1037.573) [-1058.040] (-1055.351) (-1060.857) -- 0:04:19
186000 -- [-1046.732] (-1039.397) (-1045.997) (-1046.053) * (-1046.740) (-1040.222) [-1038.312] (-1050.321) -- 0:04:22
186500 -- [-1038.521] (-1040.515) (-1043.786) (-1037.201) * (-1044.432) (-1048.996) [-1038.436] (-1042.532) -- 0:04:21
187000 -- [-1037.377] (-1046.596) (-1044.766) (-1042.154) * (-1059.781) [-1037.433] (-1054.833) (-1042.390) -- 0:04:20
187500 -- [-1034.767] (-1048.549) (-1047.881) (-1058.476) * (-1044.168) [-1044.260] (-1053.560) (-1051.390) -- 0:04:20
188000 -- (-1044.510) [-1037.210] (-1053.139) (-1040.772) * (-1044.479) (-1033.593) (-1039.663) [-1041.436] -- 0:04:19
188500 -- (-1041.959) [-1039.645] (-1047.329) (-1038.650) * [-1036.399] (-1040.748) (-1045.099) (-1040.646) -- 0:04:18
189000 -- [-1050.899] (-1041.055) (-1047.980) (-1047.524) * (-1043.788) [-1036.878] (-1047.292) (-1050.634) -- 0:04:17
189500 -- [-1052.994] (-1039.574) (-1048.126) (-1050.329) * [-1036.435] (-1041.098) (-1047.080) (-1040.602) -- 0:04:20
190000 -- [-1054.525] (-1041.610) (-1060.680) (-1036.401) * (-1043.241) [-1044.816] (-1061.551) (-1047.425) -- 0:04:20
Average standard deviation of split frequencies: 0.015894
190500 -- (-1049.205) (-1036.391) (-1049.984) [-1049.949] * (-1042.272) [-1043.018] (-1060.572) (-1050.070) -- 0:04:19
191000 -- (-1043.279) (-1056.935) (-1046.393) [-1038.041] * [-1043.999] (-1056.873) (-1045.563) (-1044.198) -- 0:04:18
191500 -- [-1037.618] (-1042.859) (-1055.631) (-1050.090) * (-1041.465) [-1041.914] (-1056.737) (-1051.266) -- 0:04:17
192000 -- (-1038.356) (-1054.457) (-1048.721) [-1038.114] * [-1041.971] (-1068.057) (-1041.919) (-1048.219) -- 0:04:16
192500 -- (-1043.243) (-1048.439) (-1047.911) [-1034.901] * (-1043.892) [-1042.598] (-1047.932) (-1049.866) -- 0:04:20
193000 -- (-1039.730) [-1043.389] (-1050.441) (-1048.908) * (-1051.229) [-1047.832] (-1038.019) (-1044.476) -- 0:04:19
193500 -- (-1048.754) (-1057.819) (-1067.950) [-1041.069] * (-1046.208) (-1047.113) [-1038.016] (-1057.219) -- 0:04:18
194000 -- [-1046.313] (-1062.129) (-1041.924) (-1043.740) * (-1047.078) (-1046.727) [-1042.410] (-1052.153) -- 0:04:17
194500 -- [-1037.956] (-1041.636) (-1038.088) (-1037.113) * (-1048.458) [-1032.796] (-1047.064) (-1053.980) -- 0:04:16
195000 -- [-1042.233] (-1061.733) (-1050.436) (-1045.566) * (-1038.775) (-1044.504) [-1035.475] (-1054.153) -- 0:04:15
Average standard deviation of split frequencies: 0.016149
195500 -- (-1044.966) [-1046.496] (-1057.401) (-1042.414) * [-1037.045] (-1041.839) (-1037.492) (-1056.766) -- 0:04:19
196000 -- [-1039.983] (-1048.370) (-1049.233) (-1044.237) * (-1046.679) (-1046.363) (-1039.181) [-1036.708] -- 0:04:18
196500 -- (-1045.709) (-1054.734) (-1050.583) [-1048.220] * (-1052.542) (-1043.942) [-1039.128] (-1044.738) -- 0:04:17
197000 -- (-1047.890) [-1048.265] (-1048.217) (-1054.590) * (-1047.935) (-1053.004) [-1041.859] (-1054.903) -- 0:04:16
197500 -- (-1042.358) [-1045.207] (-1035.984) (-1038.434) * (-1049.221) [-1046.743] (-1049.319) (-1061.098) -- 0:04:15
198000 -- [-1036.703] (-1053.192) (-1045.933) (-1044.423) * (-1042.074) (-1051.027) (-1051.888) [-1041.563] -- 0:04:19
198500 -- (-1045.569) (-1040.761) [-1038.588] (-1057.550) * (-1045.594) [-1047.728] (-1043.204) (-1036.498) -- 0:04:18
199000 -- (-1048.132) (-1046.021) [-1040.774] (-1053.561) * (-1044.841) (-1045.210) [-1037.735] (-1049.220) -- 0:04:17
199500 -- (-1051.806) [-1052.088] (-1057.138) (-1057.961) * (-1041.170) (-1046.811) [-1049.976] (-1047.682) -- 0:04:16
200000 -- (-1042.656) (-1050.574) [-1042.423] (-1052.531) * (-1050.706) [-1040.898] (-1038.879) (-1056.851) -- 0:04:16
Average standard deviation of split frequencies: 0.014599
200500 -- (-1043.758) [-1038.719] (-1055.106) (-1042.948) * [-1044.325] (-1049.265) (-1042.776) (-1044.321) -- 0:04:19
201000 -- [-1039.722] (-1043.577) (-1041.955) (-1057.424) * [-1036.963] (-1062.330) (-1048.521) (-1043.484) -- 0:04:18
201500 -- (-1041.635) (-1042.617) (-1048.503) [-1039.420] * (-1042.801) (-1042.787) [-1035.422] (-1050.659) -- 0:04:17
202000 -- [-1047.400] (-1054.416) (-1060.978) (-1046.915) * [-1033.426] (-1055.875) (-1034.262) (-1046.214) -- 0:04:16
202500 -- [-1042.514] (-1050.453) (-1057.896) (-1046.424) * (-1054.757) (-1039.335) [-1040.000] (-1066.616) -- 0:04:15
203000 -- [-1046.604] (-1052.192) (-1055.948) (-1040.469) * (-1042.809) (-1043.890) (-1043.563) [-1038.985] -- 0:04:15
203500 -- (-1044.886) [-1050.443] (-1051.363) (-1051.027) * (-1045.866) [-1034.811] (-1056.631) (-1043.920) -- 0:04:18
204000 -- (-1041.201) (-1048.417) [-1039.068] (-1048.005) * (-1049.684) (-1040.699) (-1058.082) [-1047.690] -- 0:04:17
204500 -- (-1033.809) (-1053.954) (-1040.642) [-1041.175] * [-1045.593] (-1042.248) (-1053.955) (-1046.484) -- 0:04:16
205000 -- [-1035.451] (-1048.856) (-1041.992) (-1042.043) * [-1038.418] (-1046.426) (-1051.478) (-1053.278) -- 0:04:15
Average standard deviation of split frequencies: 0.016509
205500 -- (-1056.710) (-1052.437) (-1036.482) [-1038.758] * (-1051.261) (-1050.554) (-1043.871) [-1045.603] -- 0:04:15
206000 -- (-1042.794) (-1041.655) (-1053.494) [-1046.514] * [-1038.470] (-1044.138) (-1038.096) (-1044.026) -- 0:04:18
206500 -- [-1041.013] (-1042.211) (-1046.591) (-1039.484) * (-1043.915) (-1057.824) (-1033.761) [-1049.457] -- 0:04:17
207000 -- (-1037.924) (-1045.083) [-1045.166] (-1050.998) * [-1039.556] (-1059.016) (-1050.755) (-1047.439) -- 0:04:16
207500 -- (-1041.860) (-1052.060) (-1057.651) [-1041.988] * (-1042.123) (-1054.816) (-1041.580) [-1041.185] -- 0:04:15
208000 -- [-1036.057] (-1050.980) (-1061.055) (-1054.117) * (-1059.883) [-1040.746] (-1049.836) (-1049.198) -- 0:04:15
208500 -- [-1039.374] (-1059.069) (-1046.482) (-1040.363) * (-1040.993) [-1041.687] (-1049.026) (-1042.729) -- 0:04:14
209000 -- [-1045.422] (-1057.500) (-1043.767) (-1055.803) * (-1040.424) (-1038.897) (-1055.019) [-1039.809] -- 0:04:17
209500 -- (-1048.641) (-1047.074) [-1042.799] (-1042.568) * (-1048.436) (-1047.169) (-1049.123) [-1042.538] -- 0:04:16
210000 -- [-1031.663] (-1043.617) (-1040.177) (-1036.688) * (-1050.747) [-1046.876] (-1049.105) (-1048.191) -- 0:04:15
Average standard deviation of split frequencies: 0.016623
210500 -- (-1037.782) (-1052.488) (-1057.886) [-1036.975] * (-1057.175) (-1045.987) [-1041.082] (-1053.496) -- 0:04:15
211000 -- (-1045.251) (-1054.932) [-1039.775] (-1062.822) * (-1060.123) (-1038.861) [-1039.126] (-1039.284) -- 0:04:14
211500 -- [-1040.101] (-1044.860) (-1051.938) (-1065.894) * (-1043.856) (-1052.849) [-1036.350] (-1033.178) -- 0:04:13
212000 -- [-1034.110] (-1047.505) (-1059.853) (-1059.606) * (-1046.480) (-1047.630) [-1040.429] (-1037.336) -- 0:04:16
212500 -- (-1046.485) (-1050.496) (-1061.070) [-1041.253] * (-1053.110) (-1035.465) [-1048.137] (-1048.350) -- 0:04:15
213000 -- (-1046.050) [-1036.457] (-1039.915) (-1040.550) * (-1049.821) (-1040.779) (-1037.871) [-1047.914] -- 0:04:14
213500 -- (-1053.363) [-1044.853] (-1036.757) (-1060.896) * (-1053.126) (-1038.063) (-1039.334) [-1041.450] -- 0:04:14
214000 -- (-1050.545) (-1044.457) (-1054.799) [-1034.082] * [-1039.052] (-1039.913) (-1051.735) (-1042.892) -- 0:04:13
214500 -- (-1054.140) [-1035.369] (-1057.216) (-1038.602) * (-1048.961) (-1037.744) (-1044.569) [-1042.744] -- 0:04:12
215000 -- (-1046.586) (-1053.159) (-1056.550) [-1038.810] * (-1048.303) (-1039.516) (-1046.719) [-1036.859] -- 0:04:11
Average standard deviation of split frequencies: 0.018551
215500 -- (-1050.938) (-1049.142) (-1052.524) [-1035.520] * (-1048.041) (-1039.766) (-1062.635) [-1039.320] -- 0:04:14
216000 -- [-1049.452] (-1045.122) (-1063.766) (-1043.376) * [-1041.689] (-1043.578) (-1045.873) (-1033.117) -- 0:04:14
216500 -- (-1040.430) [-1051.831] (-1047.412) (-1047.974) * (-1038.383) (-1049.510) (-1037.222) [-1039.900] -- 0:04:13
217000 -- [-1042.503] (-1040.578) (-1040.953) (-1041.081) * [-1044.085] (-1041.645) (-1040.818) (-1041.711) -- 0:04:12
217500 -- [-1039.520] (-1043.195) (-1050.975) (-1051.485) * [-1042.741] (-1046.557) (-1061.697) (-1044.002) -- 0:04:11
218000 -- (-1051.457) (-1038.335) (-1042.439) [-1040.131] * [-1050.027] (-1052.241) (-1042.615) (-1047.441) -- 0:04:11
218500 -- [-1038.309] (-1040.518) (-1047.473) (-1039.031) * [-1038.299] (-1039.613) (-1049.096) (-1046.448) -- 0:04:13
219000 -- [-1037.471] (-1041.563) (-1042.598) (-1046.400) * (-1053.279) (-1039.691) (-1046.564) [-1045.095] -- 0:04:13
219500 -- [-1041.071] (-1051.818) (-1042.332) (-1039.877) * (-1044.318) (-1043.055) (-1052.206) [-1043.840] -- 0:04:12
220000 -- (-1039.812) (-1046.033) [-1048.091] (-1049.742) * (-1055.761) [-1040.603] (-1040.241) (-1048.928) -- 0:04:11
Average standard deviation of split frequencies: 0.018769
220500 -- (-1056.898) [-1035.649] (-1057.959) (-1042.788) * [-1039.683] (-1041.904) (-1059.626) (-1058.541) -- 0:04:10
221000 -- (-1045.318) [-1028.373] (-1039.212) (-1049.864) * [-1036.620] (-1039.646) (-1051.253) (-1045.058) -- 0:04:10
221500 -- [-1037.481] (-1038.723) (-1054.409) (-1049.341) * (-1040.689) (-1045.111) [-1037.523] (-1038.642) -- 0:04:13
222000 -- (-1042.522) [-1044.357] (-1046.406) (-1042.221) * [-1045.238] (-1048.952) (-1041.274) (-1049.095) -- 0:04:12
222500 -- (-1038.340) (-1046.453) [-1036.857] (-1038.027) * (-1041.276) [-1043.344] (-1046.694) (-1042.209) -- 0:04:11
223000 -- (-1036.199) (-1039.913) (-1043.022) [-1037.651] * (-1043.859) (-1054.618) (-1042.852) [-1041.201] -- 0:04:10
223500 -- (-1037.506) [-1039.366] (-1037.023) (-1045.579) * [-1046.685] (-1049.581) (-1043.809) (-1056.977) -- 0:04:10
224000 -- (-1038.645) (-1062.690) (-1043.234) [-1040.762] * [-1046.249] (-1042.863) (-1043.536) (-1037.635) -- 0:04:09
224500 -- (-1051.855) (-1049.390) [-1048.510] (-1035.691) * (-1044.596) [-1041.530] (-1043.834) (-1048.625) -- 0:04:12
225000 -- (-1045.163) (-1051.972) (-1043.286) [-1035.337] * (-1060.734) (-1053.948) (-1045.687) [-1034.104] -- 0:04:11
Average standard deviation of split frequencies: 0.018773
225500 -- (-1053.922) (-1055.583) [-1041.612] (-1035.850) * (-1046.067) (-1047.382) [-1033.286] (-1039.046) -- 0:04:10
226000 -- (-1050.927) [-1040.294] (-1048.284) (-1040.458) * (-1045.790) [-1034.815] (-1041.643) (-1042.461) -- 0:04:10
226500 -- (-1055.103) [-1041.042] (-1054.633) (-1042.205) * [-1036.530] (-1033.809) (-1034.952) (-1038.693) -- 0:04:09
227000 -- (-1051.676) (-1044.719) (-1042.685) [-1049.401] * (-1045.998) [-1034.222] (-1041.715) (-1040.035) -- 0:04:08
227500 -- (-1052.175) (-1056.204) [-1052.004] (-1050.157) * (-1050.321) (-1032.778) (-1062.206) [-1037.808] -- 0:04:11
228000 -- (-1052.774) (-1049.850) (-1048.851) [-1035.697] * [-1042.267] (-1035.188) (-1053.962) (-1069.072) -- 0:04:10
228500 -- (-1060.314) (-1050.942) (-1045.038) [-1040.331] * [-1037.170] (-1044.336) (-1052.528) (-1050.534) -- 0:04:09
229000 -- (-1057.748) (-1055.652) (-1046.616) [-1042.802] * [-1042.014] (-1040.448) (-1055.038) (-1061.056) -- 0:04:09
229500 -- (-1048.451) (-1062.133) (-1050.837) [-1039.558] * (-1036.343) [-1038.548] (-1053.062) (-1050.135) -- 0:04:08
230000 -- [-1045.185] (-1053.220) (-1051.630) (-1042.737) * (-1051.209) [-1031.843] (-1042.056) (-1049.539) -- 0:04:07
Average standard deviation of split frequencies: 0.016787
230500 -- (-1042.048) (-1044.671) (-1049.444) [-1040.899] * (-1057.846) [-1031.341] (-1048.449) (-1052.164) -- 0:04:10
231000 -- (-1058.664) (-1050.968) (-1062.512) [-1043.067] * (-1045.178) [-1041.654] (-1047.537) (-1044.257) -- 0:04:09
231500 -- (-1046.709) (-1054.450) (-1047.325) [-1038.383] * (-1047.695) (-1052.273) [-1053.249] (-1039.518) -- 0:04:08
232000 -- (-1042.567) (-1047.185) (-1040.213) [-1043.306] * (-1045.011) (-1048.975) (-1046.475) [-1039.255] -- 0:04:08
232500 -- (-1039.345) (-1048.372) [-1037.258] (-1038.377) * (-1043.345) (-1053.430) (-1051.712) [-1041.476] -- 0:04:07
233000 -- [-1044.547] (-1074.301) (-1046.653) (-1054.473) * [-1044.424] (-1047.991) (-1048.784) (-1049.877) -- 0:04:06
233500 -- (-1048.793) (-1078.610) [-1044.123] (-1045.877) * (-1049.568) (-1043.850) [-1037.893] (-1035.675) -- 0:04:09
234000 -- (-1043.426) (-1064.170) (-1054.536) [-1044.460] * (-1050.953) [-1046.686] (-1040.929) (-1042.366) -- 0:04:08
234500 -- [-1046.104] (-1044.443) (-1037.733) (-1039.958) * (-1046.205) [-1044.410] (-1060.341) (-1044.016) -- 0:04:08
235000 -- [-1040.852] (-1047.090) (-1047.543) (-1039.707) * (-1048.913) (-1045.536) (-1049.966) [-1050.261] -- 0:04:07
Average standard deviation of split frequencies: 0.017549
235500 -- (-1050.907) (-1048.851) (-1042.745) [-1044.292] * (-1043.493) [-1039.823] (-1047.660) (-1043.325) -- 0:04:06
236000 -- [-1037.142] (-1041.952) (-1037.868) (-1042.675) * [-1040.660] (-1052.189) (-1041.715) (-1045.145) -- 0:04:06
236500 -- (-1043.726) (-1047.431) [-1044.974] (-1047.064) * (-1059.477) (-1035.359) [-1044.362] (-1038.083) -- 0:04:08
237000 -- (-1051.008) [-1038.893] (-1044.025) (-1059.365) * (-1041.255) (-1053.434) [-1048.345] (-1039.129) -- 0:04:07
237500 -- (-1051.547) (-1046.974) [-1042.276] (-1064.017) * [-1042.544] (-1059.121) (-1050.207) (-1035.746) -- 0:04:07
238000 -- (-1041.507) (-1051.765) [-1039.778] (-1052.239) * (-1051.323) [-1047.778] (-1044.782) (-1047.882) -- 0:04:06
238500 -- [-1037.973] (-1041.464) (-1050.080) (-1050.397) * (-1057.943) (-1047.345) (-1044.055) [-1039.983] -- 0:04:05
239000 -- [-1043.615] (-1048.591) (-1054.773) (-1061.021) * (-1065.486) [-1039.135] (-1049.447) (-1048.533) -- 0:04:05
239500 -- (-1046.097) (-1046.924) (-1053.331) [-1043.343] * [-1044.178] (-1037.563) (-1037.671) (-1042.627) -- 0:04:07
240000 -- (-1050.669) (-1046.517) (-1060.017) [-1053.875] * (-1045.000) (-1044.014) [-1043.611] (-1040.253) -- 0:04:07
Average standard deviation of split frequencies: 0.016090
240500 -- (-1049.087) (-1055.499) [-1050.679] (-1040.395) * (-1035.143) (-1057.784) [-1040.364] (-1060.151) -- 0:04:06
241000 -- (-1049.384) (-1037.806) (-1054.600) [-1040.441] * [-1036.474] (-1035.403) (-1040.946) (-1056.859) -- 0:04:05
241500 -- (-1045.127) [-1044.271] (-1050.733) (-1048.433) * [-1034.056] (-1046.449) (-1046.310) (-1043.687) -- 0:04:08
242000 -- (-1043.615) (-1042.301) (-1053.307) [-1048.622] * (-1033.361) [-1039.473] (-1045.941) (-1053.865) -- 0:04:07
242500 -- (-1039.578) [-1038.578] (-1046.384) (-1049.712) * (-1042.432) [-1043.623] (-1034.297) (-1044.726) -- 0:04:06
243000 -- (-1038.435) [-1041.277] (-1049.243) (-1056.029) * [-1050.061] (-1041.887) (-1055.789) (-1057.092) -- 0:04:06
243500 -- [-1038.307] (-1046.784) (-1055.108) (-1048.228) * (-1062.034) (-1036.608) [-1037.746] (-1038.959) -- 0:04:05
244000 -- (-1041.461) [-1043.669] (-1051.413) (-1042.351) * [-1038.742] (-1049.120) (-1050.172) (-1047.081) -- 0:04:07
244500 -- (-1062.041) [-1036.889] (-1053.512) (-1058.053) * (-1047.335) (-1049.581) (-1059.329) [-1042.365] -- 0:04:07
245000 -- (-1041.379) [-1032.015] (-1051.302) (-1047.240) * (-1045.123) (-1051.456) (-1039.372) [-1040.937] -- 0:04:06
Average standard deviation of split frequencies: 0.013825
245500 -- (-1036.481) (-1045.686) (-1054.574) [-1039.656] * (-1042.916) (-1048.742) (-1040.688) [-1042.908] -- 0:04:05
246000 -- (-1046.507) [-1043.359] (-1049.509) (-1040.154) * (-1048.684) [-1040.089] (-1039.229) (-1049.134) -- 0:04:05
246500 -- [-1043.439] (-1043.970) (-1051.026) (-1041.387) * (-1050.885) (-1049.335) (-1047.241) [-1038.182] -- 0:04:04
247000 -- (-1049.238) (-1051.152) (-1053.905) [-1035.454] * (-1060.375) (-1052.403) [-1040.595] (-1053.019) -- 0:04:06
247500 -- (-1050.465) (-1048.359) (-1047.878) [-1042.355] * (-1052.881) (-1051.564) [-1042.792] (-1050.920) -- 0:04:06
248000 -- (-1053.800) (-1048.094) [-1041.766] (-1045.807) * (-1043.730) (-1043.237) (-1043.024) [-1042.694] -- 0:04:05
248500 -- [-1042.388] (-1048.376) (-1035.966) (-1053.696) * [-1045.138] (-1039.790) (-1036.595) (-1049.999) -- 0:04:04
249000 -- (-1052.044) (-1037.798) [-1039.474] (-1045.207) * [-1035.786] (-1041.084) (-1043.350) (-1056.917) -- 0:04:04
249500 -- (-1051.572) (-1047.095) [-1038.418] (-1047.507) * [-1044.221] (-1036.560) (-1049.262) (-1040.968) -- 0:04:03
250000 -- (-1039.891) (-1052.503) (-1051.310) [-1035.307] * [-1034.161] (-1053.233) (-1042.398) (-1067.035) -- 0:04:06
Average standard deviation of split frequencies: 0.013970
250500 -- (-1052.399) [-1048.228] (-1054.683) (-1034.864) * [-1044.051] (-1040.820) (-1042.378) (-1044.190) -- 0:04:05
251000 -- (-1057.711) [-1044.275] (-1048.845) (-1065.423) * [-1042.195] (-1058.876) (-1037.769) (-1048.283) -- 0:04:04
251500 -- [-1038.761] (-1038.211) (-1045.023) (-1042.382) * (-1055.163) (-1048.083) [-1043.165] (-1058.677) -- 0:04:04
252000 -- (-1056.444) (-1040.580) (-1050.766) [-1037.682] * (-1047.145) [-1044.432] (-1045.738) (-1051.407) -- 0:04:03
252500 -- [-1037.980] (-1040.729) (-1045.462) (-1036.748) * (-1050.886) (-1040.208) [-1044.171] (-1052.239) -- 0:04:05
253000 -- (-1051.113) [-1045.633] (-1049.855) (-1045.578) * (-1043.967) [-1036.328] (-1055.713) (-1046.263) -- 0:04:05
253500 -- (-1042.303) (-1044.872) (-1049.234) [-1047.681] * (-1045.248) [-1038.640] (-1043.718) (-1035.587) -- 0:04:04
254000 -- [-1035.701] (-1044.130) (-1050.215) (-1042.950) * (-1063.458) [-1040.105] (-1044.648) (-1046.083) -- 0:04:03
254500 -- (-1059.907) (-1048.194) (-1050.472) [-1043.527] * (-1043.539) (-1050.876) (-1050.846) [-1044.102] -- 0:04:03
255000 -- [-1037.877] (-1046.248) (-1066.736) (-1037.300) * [-1037.822] (-1053.237) (-1048.865) (-1046.188) -- 0:04:02
Average standard deviation of split frequencies: 0.014306
255500 -- (-1049.639) [-1038.665] (-1056.201) (-1040.662) * [-1040.117] (-1053.830) (-1036.409) (-1061.904) -- 0:04:04
256000 -- [-1060.237] (-1048.734) (-1042.861) (-1045.012) * (-1057.300) (-1042.730) [-1042.051] (-1047.677) -- 0:04:04
256500 -- (-1054.408) (-1053.227) (-1045.166) [-1041.921] * [-1041.793] (-1058.237) (-1048.485) (-1040.908) -- 0:04:03
257000 -- (-1044.067) (-1047.053) [-1037.944] (-1044.275) * (-1046.983) (-1037.841) [-1032.198] (-1047.758) -- 0:04:02
257500 -- (-1042.009) (-1038.841) [-1042.200] (-1058.636) * [-1043.752] (-1037.549) (-1054.651) (-1040.543) -- 0:04:02
258000 -- [-1044.723] (-1041.592) (-1051.598) (-1048.385) * [-1040.053] (-1045.436) (-1050.608) (-1040.777) -- 0:04:01
258500 -- (-1050.983) (-1052.271) (-1043.110) [-1042.892] * (-1049.582) (-1038.584) [-1042.744] (-1042.210) -- 0:04:03
259000 -- (-1040.706) (-1033.746) (-1047.572) [-1047.318] * (-1062.667) [-1035.855] (-1054.338) (-1041.684) -- 0:04:03
259500 -- (-1051.714) [-1036.688] (-1043.195) (-1053.155) * (-1050.757) (-1039.307) [-1043.376] (-1069.144) -- 0:04:02
260000 -- [-1044.870] (-1043.100) (-1037.171) (-1054.135) * [-1036.995] (-1037.407) (-1049.655) (-1048.032) -- 0:04:01
Average standard deviation of split frequencies: 0.015441
260500 -- (-1046.074) (-1050.674) (-1036.254) [-1047.773] * [-1041.973] (-1037.431) (-1046.435) (-1045.968) -- 0:04:01
261000 -- (-1052.063) (-1040.858) (-1040.193) [-1040.730] * [-1047.901] (-1041.820) (-1036.637) (-1059.358) -- 0:04:00
261500 -- (-1046.431) (-1043.392) (-1048.232) [-1039.793] * [-1046.555] (-1041.531) (-1041.510) (-1059.053) -- 0:04:00
262000 -- (-1051.590) (-1047.809) [-1042.768] (-1043.998) * (-1044.202) (-1046.745) [-1038.163] (-1049.870) -- 0:04:02
262500 -- (-1044.298) (-1042.259) (-1060.691) [-1034.183] * [-1042.743] (-1037.398) (-1040.538) (-1056.295) -- 0:04:01
263000 -- (-1055.809) [-1047.891] (-1052.852) (-1037.067) * (-1039.861) (-1050.186) [-1038.601] (-1052.126) -- 0:04:00
263500 -- (-1047.455) [-1035.891] (-1043.111) (-1045.922) * (-1050.914) (-1048.384) [-1038.215] (-1040.623) -- 0:04:00
264000 -- (-1044.833) (-1041.058) [-1049.329] (-1047.554) * [-1035.794] (-1048.779) (-1046.775) (-1058.702) -- 0:03:59
264500 -- (-1040.476) [-1039.573] (-1047.394) (-1045.575) * (-1063.400) (-1039.177) [-1038.577] (-1039.806) -- 0:03:59
265000 -- (-1045.363) (-1041.808) [-1044.380] (-1053.325) * (-1046.411) (-1037.236) (-1039.336) [-1045.425] -- 0:04:01
Average standard deviation of split frequencies: 0.015268
265500 -- (-1055.019) (-1055.932) (-1041.585) [-1045.356] * [-1049.731] (-1047.122) (-1045.143) (-1043.772) -- 0:04:00
266000 -- (-1051.308) [-1032.293] (-1050.638) (-1040.430) * (-1042.087) (-1049.847) [-1038.587] (-1050.596) -- 0:04:00
266500 -- (-1046.307) [-1041.559] (-1055.707) (-1051.301) * [-1032.931] (-1049.907) (-1043.791) (-1037.496) -- 0:03:59
267000 -- [-1054.043] (-1039.045) (-1050.789) (-1053.604) * (-1040.795) (-1054.108) [-1045.163] (-1046.535) -- 0:03:58
267500 -- (-1052.385) [-1038.034] (-1038.319) (-1057.529) * [-1039.798] (-1046.055) (-1040.616) (-1050.541) -- 0:03:58
268000 -- (-1040.775) (-1034.356) [-1051.787] (-1047.060) * (-1045.347) (-1039.547) [-1038.661] (-1054.101) -- 0:04:00
268500 -- (-1050.678) [-1034.874] (-1056.443) (-1056.018) * [-1038.134] (-1046.582) (-1033.355) (-1045.505) -- 0:03:59
269000 -- (-1056.786) (-1045.746) (-1058.606) [-1048.252] * (-1039.054) (-1042.143) [-1039.207] (-1067.292) -- 0:03:59
269500 -- (-1056.100) [-1041.294] (-1047.152) (-1049.217) * (-1043.231) [-1048.913] (-1038.735) (-1046.335) -- 0:03:58
270000 -- (-1042.369) [-1044.260] (-1039.160) (-1055.687) * [-1039.811] (-1039.201) (-1043.481) (-1051.965) -- 0:03:57
Average standard deviation of split frequencies: 0.016077
270500 -- [-1035.612] (-1046.748) (-1049.029) (-1047.609) * (-1041.752) (-1047.990) [-1043.689] (-1043.907) -- 0:03:57
271000 -- (-1046.583) (-1060.366) [-1037.210] (-1044.270) * (-1048.508) [-1044.134] (-1048.150) (-1055.612) -- 0:03:59
271500 -- (-1051.478) [-1036.879] (-1039.945) (-1058.500) * (-1048.503) [-1033.947] (-1039.838) (-1049.244) -- 0:03:58
272000 -- (-1040.383) (-1045.633) [-1043.923] (-1039.243) * (-1050.760) (-1043.445) [-1040.838] (-1043.659) -- 0:03:58
272500 -- (-1039.152) (-1047.719) [-1037.921] (-1050.334) * (-1041.665) [-1041.420] (-1049.346) (-1061.454) -- 0:03:57
273000 -- [-1036.397] (-1048.115) (-1042.843) (-1042.705) * (-1042.923) (-1049.410) [-1041.767] (-1046.299) -- 0:03:57
273500 -- (-1038.024) [-1044.055] (-1042.873) (-1050.561) * (-1034.576) (-1044.325) (-1051.160) [-1044.496] -- 0:03:56
274000 -- [-1036.665] (-1048.647) (-1036.965) (-1039.019) * (-1045.290) (-1051.514) [-1037.025] (-1048.423) -- 0:03:58
274500 -- (-1036.318) (-1059.167) (-1059.734) [-1047.136] * (-1045.057) [-1038.395] (-1040.182) (-1045.861) -- 0:03:57
275000 -- [-1044.322] (-1053.040) (-1046.744) (-1057.304) * (-1045.408) (-1043.214) [-1038.086] (-1046.326) -- 0:03:57
Average standard deviation of split frequencies: 0.015897
275500 -- [-1034.373] (-1035.542) (-1041.991) (-1047.962) * (-1054.656) [-1043.251] (-1040.695) (-1060.324) -- 0:03:56
276000 -- (-1042.432) (-1045.804) (-1048.302) [-1040.964] * [-1047.778] (-1042.585) (-1049.678) (-1043.301) -- 0:03:56
276500 -- (-1044.945) (-1059.120) (-1041.191) [-1046.859] * [-1044.265] (-1036.459) (-1057.775) (-1046.264) -- 0:03:55
277000 -- (-1065.252) (-1044.833) (-1041.186) [-1052.481] * [-1044.130] (-1047.035) (-1044.344) (-1050.288) -- 0:03:57
277500 -- (-1057.837) [-1040.415] (-1050.649) (-1043.018) * (-1050.871) (-1037.459) [-1051.694] (-1042.978) -- 0:03:56
278000 -- (-1046.776) [-1041.339] (-1042.115) (-1036.085) * (-1045.910) [-1038.738] (-1051.882) (-1050.404) -- 0:03:56
278500 -- (-1050.856) (-1057.543) (-1057.920) [-1044.895] * (-1041.153) [-1042.106] (-1043.892) (-1044.279) -- 0:03:55
279000 -- [-1045.571] (-1039.291) (-1048.005) (-1049.876) * [-1039.738] (-1050.755) (-1040.602) (-1049.225) -- 0:03:55
279500 -- (-1047.141) [-1037.794] (-1044.256) (-1045.969) * (-1041.432) (-1063.672) [-1034.867] (-1047.489) -- 0:03:54
280000 -- (-1040.980) (-1039.831) (-1056.182) [-1045.476] * (-1043.000) (-1044.808) [-1050.523] (-1060.469) -- 0:03:56
Average standard deviation of split frequencies: 0.015633
280500 -- (-1036.327) [-1051.936] (-1047.561) (-1037.546) * (-1042.299) (-1043.978) (-1044.126) [-1045.902] -- 0:03:55
281000 -- [-1045.704] (-1052.045) (-1046.478) (-1046.881) * (-1045.125) (-1054.423) (-1054.428) [-1050.696] -- 0:03:55
281500 -- (-1042.207) (-1038.869) (-1053.191) [-1042.957] * [-1041.265] (-1046.076) (-1046.907) (-1038.712) -- 0:03:54
282000 -- (-1050.948) [-1036.171] (-1055.956) (-1047.487) * [-1041.283] (-1046.933) (-1054.629) (-1033.573) -- 0:03:54
282500 -- (-1042.101) [-1042.982] (-1057.302) (-1042.862) * (-1057.440) [-1042.469] (-1053.961) (-1036.055) -- 0:03:53
283000 -- (-1048.607) [-1040.943] (-1050.883) (-1037.719) * (-1042.268) [-1045.291] (-1057.954) (-1039.935) -- 0:03:53
283500 -- (-1047.426) (-1039.390) (-1051.609) [-1039.321] * [-1043.423] (-1054.075) (-1047.207) (-1037.553) -- 0:03:55
284000 -- [-1050.363] (-1049.936) (-1042.747) (-1045.343) * (-1047.505) (-1044.801) [-1047.632] (-1044.754) -- 0:03:54
284500 -- (-1039.547) (-1040.158) [-1042.585] (-1041.360) * (-1051.969) (-1041.771) (-1045.131) [-1045.637] -- 0:03:53
285000 -- (-1041.880) (-1039.756) (-1036.816) [-1039.587] * [-1045.354] (-1040.491) (-1047.422) (-1044.400) -- 0:03:53
Average standard deviation of split frequencies: 0.016609
285500 -- (-1037.786) (-1043.529) (-1045.023) [-1046.541] * (-1044.248) (-1041.913) (-1051.966) [-1031.710] -- 0:03:52
286000 -- (-1038.314) (-1037.589) [-1039.135] (-1047.555) * [-1035.495] (-1038.066) (-1049.449) (-1043.126) -- 0:03:52
286500 -- (-1042.969) (-1042.462) (-1043.430) [-1044.175] * (-1047.739) (-1054.030) [-1030.707] (-1047.220) -- 0:03:54
287000 -- [-1043.673] (-1039.733) (-1040.398) (-1050.368) * (-1052.549) (-1043.992) [-1042.051] (-1049.393) -- 0:03:53
287500 -- [-1041.185] (-1048.060) (-1042.360) (-1037.890) * (-1061.447) (-1042.597) [-1041.112] (-1044.309) -- 0:03:52
288000 -- (-1054.304) [-1041.053] (-1035.268) (-1037.192) * (-1043.727) [-1059.070] (-1045.955) (-1049.470) -- 0:03:52
288500 -- (-1052.541) (-1036.013) (-1035.407) [-1042.908] * (-1047.721) (-1047.598) [-1035.960] (-1044.715) -- 0:03:51
289000 -- (-1052.596) [-1043.981] (-1046.444) (-1043.314) * [-1048.991] (-1046.168) (-1044.754) (-1040.909) -- 0:03:51
289500 -- (-1042.872) [-1041.885] (-1050.308) (-1048.044) * (-1048.556) [-1038.483] (-1050.423) (-1038.215) -- 0:03:53
290000 -- (-1051.958) [-1038.340] (-1039.588) (-1041.007) * (-1056.415) [-1044.880] (-1042.399) (-1036.319) -- 0:03:52
Average standard deviation of split frequencies: 0.016093
290500 -- (-1044.662) (-1040.262) (-1041.044) [-1046.803] * (-1042.894) (-1037.681) [-1041.293] (-1037.818) -- 0:03:52
291000 -- [-1038.801] (-1039.177) (-1042.352) (-1040.270) * (-1047.398) (-1041.055) (-1062.151) [-1038.541] -- 0:03:51
291500 -- [-1036.378] (-1056.820) (-1042.658) (-1044.405) * [-1042.369] (-1048.638) (-1042.999) (-1042.666) -- 0:03:50
292000 -- (-1043.105) [-1044.966] (-1047.153) (-1041.015) * (-1048.377) [-1044.452] (-1052.903) (-1041.201) -- 0:03:50
292500 -- (-1039.655) [-1035.991] (-1049.526) (-1041.856) * [-1043.639] (-1041.860) (-1041.238) (-1045.656) -- 0:03:52
293000 -- (-1046.902) (-1051.302) (-1046.507) [-1035.355] * (-1047.348) [-1042.425] (-1048.440) (-1045.472) -- 0:03:51
293500 -- (-1050.074) [-1057.425] (-1051.408) (-1042.513) * (-1055.326) (-1051.071) (-1044.305) [-1042.609] -- 0:03:51
294000 -- (-1038.084) (-1055.934) (-1047.121) [-1038.839] * [-1044.419] (-1040.995) (-1052.409) (-1042.198) -- 0:03:50
294500 -- (-1046.727) (-1047.658) (-1045.634) [-1046.183] * (-1041.087) (-1043.234) [-1043.051] (-1048.925) -- 0:03:49
295000 -- [-1042.524] (-1049.158) (-1036.358) (-1047.924) * (-1048.940) (-1046.107) [-1038.253] (-1046.406) -- 0:03:49
Average standard deviation of split frequencies: 0.017396
295500 -- (-1042.918) [-1045.021] (-1048.151) (-1043.501) * (-1049.485) (-1041.993) (-1052.914) [-1039.583] -- 0:03:51
296000 -- [-1041.010] (-1058.810) (-1046.671) (-1057.147) * (-1046.035) (-1049.762) [-1040.720] (-1054.880) -- 0:03:50
296500 -- (-1051.000) (-1052.643) [-1037.807] (-1045.816) * [-1042.391] (-1037.267) (-1062.170) (-1046.634) -- 0:03:50
297000 -- (-1052.303) [-1048.444] (-1046.018) (-1038.442) * [-1039.928] (-1046.789) (-1041.589) (-1057.661) -- 0:03:49
297500 -- (-1041.346) [-1043.877] (-1039.885) (-1044.498) * (-1047.621) (-1040.968) (-1040.082) [-1041.516] -- 0:03:49
298000 -- (-1042.165) (-1053.959) [-1045.570] (-1036.022) * (-1062.854) (-1037.822) [-1041.926] (-1053.418) -- 0:03:48
298500 -- (-1051.716) [-1043.930] (-1047.290) (-1045.809) * (-1060.971) (-1036.182) (-1037.746) [-1047.347] -- 0:03:50
299000 -- (-1041.595) (-1050.395) (-1046.171) [-1038.296] * (-1040.604) (-1050.818) [-1034.985] (-1051.564) -- 0:03:49
299500 -- (-1043.481) (-1047.777) [-1040.346] (-1046.582) * (-1044.046) (-1036.047) (-1042.220) [-1043.403] -- 0:03:49
300000 -- (-1056.943) [-1038.500] (-1052.361) (-1043.979) * [-1040.039] (-1047.661) (-1039.723) (-1045.303) -- 0:03:48
Average standard deviation of split frequencies: 0.018211
300500 -- (-1042.059) (-1038.209) (-1047.137) [-1039.220] * [-1039.207] (-1061.079) (-1045.067) (-1032.916) -- 0:03:48
301000 -- (-1056.672) [-1035.720] (-1043.225) (-1038.038) * (-1057.171) (-1049.031) [-1038.459] (-1043.275) -- 0:03:47
301500 -- (-1048.182) (-1060.736) [-1056.348] (-1052.087) * (-1041.516) [-1038.977] (-1046.307) (-1035.328) -- 0:03:49
302000 -- (-1056.063) (-1038.561) (-1051.906) [-1041.211] * [-1031.983] (-1035.256) (-1052.864) (-1038.258) -- 0:03:48
302500 -- (-1045.487) (-1044.070) [-1039.214] (-1047.949) * (-1041.595) [-1038.410] (-1041.316) (-1043.481) -- 0:03:48
303000 -- (-1057.957) (-1044.864) [-1040.164] (-1048.343) * (-1051.132) [-1035.327] (-1041.384) (-1057.338) -- 0:03:47
303500 -- [-1037.598] (-1044.002) (-1042.769) (-1044.694) * [-1038.128] (-1046.835) (-1040.081) (-1045.367) -- 0:03:47
304000 -- (-1041.570) [-1044.812] (-1053.983) (-1039.341) * [-1042.443] (-1050.644) (-1054.282) (-1039.609) -- 0:03:46
304500 -- [-1031.237] (-1041.539) (-1046.970) (-1054.584) * (-1045.705) (-1049.146) (-1045.702) [-1042.274] -- 0:03:46
305000 -- (-1039.742) (-1056.347) [-1036.581] (-1050.212) * (-1049.556) (-1037.178) (-1045.282) [-1040.339] -- 0:03:47
Average standard deviation of split frequencies: 0.017301
305500 -- (-1043.267) (-1041.306) (-1062.476) [-1037.818] * (-1046.167) [-1042.554] (-1043.775) (-1045.528) -- 0:03:47
306000 -- [-1037.640] (-1040.281) (-1041.015) (-1052.601) * (-1054.717) (-1043.085) (-1055.948) [-1046.883] -- 0:03:46
306500 -- (-1045.403) (-1037.364) [-1045.870] (-1043.607) * (-1048.291) [-1042.199] (-1049.542) (-1043.719) -- 0:03:46
307000 -- (-1048.231) (-1043.511) (-1048.412) [-1038.959] * (-1058.711) (-1041.692) (-1044.925) [-1037.240] -- 0:03:45
307500 -- (-1043.604) (-1044.361) [-1040.613] (-1045.060) * (-1053.044) [-1037.425] (-1040.540) (-1041.196) -- 0:03:45
308000 -- (-1046.425) (-1054.901) [-1036.682] (-1041.633) * (-1043.718) [-1038.407] (-1042.608) (-1041.323) -- 0:03:46
308500 -- (-1041.599) (-1048.833) (-1047.087) [-1042.057] * (-1050.508) (-1046.562) [-1044.198] (-1037.901) -- 0:03:46
309000 -- [-1041.396] (-1055.097) (-1040.763) (-1045.645) * [-1048.408] (-1037.269) (-1040.089) (-1048.085) -- 0:03:45
309500 -- (-1048.072) (-1043.940) [-1048.760] (-1041.031) * [-1040.618] (-1043.574) (-1053.316) (-1041.783) -- 0:03:45
310000 -- (-1050.226) (-1046.136) [-1045.175] (-1050.998) * (-1044.729) [-1045.728] (-1046.926) (-1039.803) -- 0:03:44
Average standard deviation of split frequencies: 0.016808
310500 -- (-1041.033) [-1045.168] (-1052.821) (-1044.848) * [-1047.778] (-1056.257) (-1039.443) (-1038.997) -- 0:03:44
311000 -- (-1044.987) (-1045.286) [-1041.790] (-1061.410) * [-1047.263] (-1043.157) (-1042.283) (-1050.259) -- 0:03:45
311500 -- (-1042.931) [-1040.512] (-1038.661) (-1056.228) * (-1044.966) (-1044.973) [-1051.816] (-1043.516) -- 0:03:45
312000 -- (-1044.261) (-1052.210) [-1042.554] (-1053.042) * (-1052.682) (-1048.378) (-1044.859) [-1040.557] -- 0:03:44
312500 -- (-1048.781) (-1059.172) [-1038.803] (-1056.976) * [-1039.659] (-1044.911) (-1055.569) (-1057.726) -- 0:03:44
313000 -- (-1048.775) [-1047.643] (-1038.657) (-1048.612) * (-1047.130) [-1039.296] (-1053.582) (-1058.347) -- 0:03:43
313500 -- (-1057.842) [-1037.988] (-1042.533) (-1052.209) * (-1054.234) (-1038.530) (-1061.272) [-1047.586] -- 0:03:43
314000 -- [-1040.578] (-1050.621) (-1056.465) (-1039.801) * (-1040.929) [-1042.615] (-1055.133) (-1046.821) -- 0:03:45
314500 -- [-1038.327] (-1056.833) (-1042.801) (-1050.361) * (-1046.655) [-1042.242] (-1051.037) (-1054.090) -- 0:03:44
315000 -- [-1047.223] (-1047.872) (-1041.500) (-1039.196) * (-1045.933) [-1041.037] (-1057.446) (-1042.659) -- 0:03:43
Average standard deviation of split frequencies: 0.016065
315500 -- [-1034.515] (-1048.967) (-1042.960) (-1045.585) * (-1046.497) [-1041.412] (-1052.671) (-1041.965) -- 0:03:43
316000 -- (-1045.152) [-1047.826] (-1048.745) (-1039.667) * [-1035.959] (-1040.178) (-1044.411) (-1043.940) -- 0:03:42
316500 -- (-1038.797) (-1043.353) [-1043.020] (-1049.940) * (-1048.330) (-1047.966) [-1040.184] (-1049.979) -- 0:03:42
317000 -- (-1051.278) (-1039.987) (-1045.931) [-1044.541] * (-1058.156) (-1038.399) [-1039.384] (-1039.160) -- 0:03:44
317500 -- [-1051.251] (-1048.398) (-1050.877) (-1046.321) * (-1046.370) [-1042.144] (-1049.023) (-1046.280) -- 0:03:43
318000 -- (-1054.194) [-1042.774] (-1045.766) (-1041.173) * (-1054.873) [-1042.665] (-1042.944) (-1036.367) -- 0:03:43
318500 -- [-1041.684] (-1047.833) (-1045.630) (-1032.185) * (-1045.705) (-1044.975) [-1033.277] (-1049.563) -- 0:03:42
319000 -- (-1035.146) [-1046.221] (-1048.844) (-1040.221) * (-1045.287) [-1042.219] (-1031.903) (-1047.197) -- 0:03:42
319500 -- (-1040.304) (-1047.582) (-1050.306) [-1036.721] * (-1055.634) (-1046.675) [-1045.318] (-1052.743) -- 0:03:41
320000 -- (-1038.968) (-1039.443) (-1046.671) [-1053.575] * (-1048.185) [-1039.029] (-1036.289) (-1038.724) -- 0:03:41
Average standard deviation of split frequencies: 0.015153
320500 -- (-1040.821) [-1042.218] (-1049.236) (-1051.651) * (-1041.301) (-1047.490) (-1041.003) [-1036.705] -- 0:03:42
321000 -- [-1037.902] (-1048.713) (-1037.954) (-1048.766) * (-1043.411) [-1052.874] (-1050.655) (-1040.394) -- 0:03:42
321500 -- (-1048.592) (-1041.163) [-1035.312] (-1053.975) * (-1045.256) [-1041.302] (-1051.114) (-1054.819) -- 0:03:41
322000 -- (-1042.067) [-1036.399] (-1042.745) (-1039.449) * (-1044.118) [-1047.202] (-1041.839) (-1046.409) -- 0:03:41
322500 -- (-1054.434) (-1046.684) (-1040.099) [-1044.474] * (-1047.428) (-1038.833) [-1035.593] (-1042.788) -- 0:03:40
323000 -- (-1056.677) (-1041.116) (-1057.870) [-1042.410] * [-1036.002] (-1043.575) (-1049.498) (-1044.084) -- 0:03:40
323500 -- (-1054.282) [-1038.368] (-1046.998) (-1036.998) * [-1035.467] (-1046.595) (-1057.527) (-1039.708) -- 0:03:41
324000 -- [-1049.507] (-1039.388) (-1050.195) (-1037.870) * (-1044.768) (-1044.433) [-1042.095] (-1051.225) -- 0:03:41
324500 -- [-1042.715] (-1044.668) (-1049.002) (-1035.723) * (-1044.806) (-1053.863) [-1039.039] (-1050.151) -- 0:03:40
325000 -- (-1042.668) [-1040.763] (-1048.290) (-1051.322) * (-1050.693) (-1048.223) (-1044.969) [-1038.276] -- 0:03:40
Average standard deviation of split frequencies: 0.015906
325500 -- (-1041.774) (-1045.886) (-1055.988) [-1034.468] * [-1040.569] (-1045.649) (-1048.774) (-1041.879) -- 0:03:39
326000 -- (-1039.276) [-1047.646] (-1052.410) (-1038.337) * (-1046.142) (-1034.900) (-1043.928) [-1035.941] -- 0:03:39
326500 -- (-1043.140) [-1032.186] (-1059.922) (-1050.607) * [-1037.434] (-1061.082) (-1054.238) (-1057.894) -- 0:03:40
327000 -- (-1035.832) [-1041.738] (-1057.844) (-1047.497) * (-1044.612) (-1041.314) (-1051.595) [-1040.837] -- 0:03:40
327500 -- (-1043.358) (-1053.081) (-1041.085) [-1044.666] * (-1043.524) [-1039.264] (-1044.832) (-1045.697) -- 0:03:39
328000 -- [-1035.420] (-1031.615) (-1034.071) (-1061.059) * [-1039.300] (-1054.401) (-1055.692) (-1038.880) -- 0:03:39
328500 -- (-1038.253) (-1058.730) [-1041.276] (-1037.466) * (-1042.990) [-1034.779] (-1040.393) (-1043.108) -- 0:03:38
329000 -- [-1034.180] (-1045.752) (-1039.323) (-1049.289) * [-1040.836] (-1052.177) (-1047.132) (-1050.140) -- 0:03:38
329500 -- (-1040.231) (-1048.352) (-1046.146) [-1038.083] * (-1043.769) (-1048.611) (-1050.664) [-1045.897] -- 0:03:39
330000 -- (-1048.661) [-1045.372] (-1050.484) (-1041.117) * [-1034.380] (-1037.817) (-1051.773) (-1057.021) -- 0:03:39
Average standard deviation of split frequencies: 0.014037
330500 -- (-1038.949) (-1041.942) [-1038.066] (-1035.480) * [-1043.309] (-1041.789) (-1040.790) (-1044.575) -- 0:03:38
331000 -- [-1040.834] (-1057.091) (-1041.406) (-1053.698) * (-1046.003) [-1041.764] (-1040.657) (-1048.954) -- 0:03:38
331500 -- (-1041.411) (-1044.906) (-1049.525) [-1039.931] * (-1051.098) [-1045.135] (-1047.397) (-1049.348) -- 0:03:37
332000 -- (-1056.429) (-1036.570) [-1043.172] (-1057.310) * (-1054.313) (-1045.633) (-1046.980) [-1039.194] -- 0:03:37
332500 -- (-1041.009) (-1065.952) [-1040.120] (-1040.698) * (-1053.169) (-1042.298) [-1046.834] (-1040.220) -- 0:03:38
333000 -- (-1045.450) (-1050.285) [-1039.778] (-1044.016) * (-1062.485) (-1042.396) (-1044.972) [-1043.322] -- 0:03:38
333500 -- (-1046.580) (-1050.714) [-1040.074] (-1047.242) * (-1044.644) [-1051.389] (-1045.374) (-1052.433) -- 0:03:37
334000 -- (-1041.932) (-1048.396) [-1040.038] (-1048.238) * [-1046.095] (-1057.963) (-1035.918) (-1056.237) -- 0:03:37
334500 -- (-1050.585) (-1050.480) [-1043.653] (-1050.584) * [-1042.395] (-1041.269) (-1053.421) (-1053.005) -- 0:03:36
335000 -- (-1041.882) (-1042.040) [-1038.346] (-1047.745) * [-1032.968] (-1043.668) (-1035.115) (-1064.640) -- 0:03:36
Average standard deviation of split frequencies: 0.013922
335500 -- [-1043.922] (-1046.926) (-1036.966) (-1039.968) * [-1046.161] (-1048.028) (-1032.269) (-1041.122) -- 0:03:37
336000 -- (-1047.986) (-1046.406) [-1045.897] (-1048.766) * [-1039.468] (-1046.399) (-1053.643) (-1050.385) -- 0:03:37
336500 -- (-1052.140) [-1039.436] (-1060.063) (-1048.374) * (-1042.755) (-1043.293) (-1044.758) [-1036.742] -- 0:03:36
337000 -- [-1034.568] (-1044.254) (-1060.536) (-1057.176) * (-1045.923) [-1043.166] (-1037.822) (-1045.437) -- 0:03:36
337500 -- (-1046.101) (-1043.144) [-1040.678] (-1054.095) * [-1041.196] (-1044.218) (-1036.545) (-1043.970) -- 0:03:35
338000 -- (-1043.740) (-1042.386) (-1051.559) [-1038.691] * [-1036.938] (-1044.836) (-1041.710) (-1047.629) -- 0:03:35
338500 -- (-1055.829) [-1036.917] (-1037.703) (-1048.120) * (-1045.463) [-1040.530] (-1039.202) (-1039.845) -- 0:03:34
339000 -- (-1045.887) [-1031.977] (-1040.618) (-1046.721) * (-1044.550) [-1036.984] (-1038.601) (-1044.112) -- 0:03:36
339500 -- (-1055.033) [-1051.925] (-1043.846) (-1049.574) * (-1042.587) (-1042.930) (-1031.743) [-1042.468] -- 0:03:35
340000 -- [-1040.383] (-1043.268) (-1040.856) (-1033.985) * (-1040.026) [-1038.269] (-1046.845) (-1041.624) -- 0:03:35
Average standard deviation of split frequencies: 0.013518
340500 -- (-1045.865) (-1050.936) (-1048.174) [-1040.396] * [-1038.283] (-1045.093) (-1040.401) (-1053.165) -- 0:03:34
341000 -- (-1041.387) (-1049.415) (-1046.847) [-1041.114] * (-1035.737) (-1049.202) [-1044.204] (-1048.862) -- 0:03:34
341500 -- (-1053.858) [-1045.053] (-1045.572) (-1046.681) * (-1040.012) (-1041.776) (-1043.855) [-1037.864] -- 0:03:34
342000 -- (-1061.981) (-1045.043) (-1040.916) [-1033.617] * (-1045.123) (-1043.331) (-1044.988) [-1047.349] -- 0:03:35
342500 -- (-1068.546) (-1046.004) (-1042.111) [-1036.670] * [-1048.598] (-1056.993) (-1050.201) (-1039.134) -- 0:03:35
343000 -- (-1046.031) (-1042.590) (-1049.926) [-1037.035] * [-1041.474] (-1037.201) (-1052.784) (-1042.797) -- 0:03:34
343500 -- (-1051.469) [-1037.578] (-1040.812) (-1043.011) * (-1037.896) [-1038.808] (-1046.416) (-1043.232) -- 0:03:34
344000 -- (-1041.911) (-1051.829) [-1041.259] (-1044.127) * (-1054.584) (-1048.018) (-1051.756) [-1042.902] -- 0:03:33
344500 -- (-1044.920) (-1041.667) (-1042.376) [-1042.790] * (-1046.038) (-1058.092) (-1043.629) [-1039.242] -- 0:03:33
345000 -- [-1036.289] (-1055.393) (-1040.367) (-1041.423) * [-1042.842] (-1042.055) (-1052.430) (-1047.634) -- 0:03:34
Average standard deviation of split frequencies: 0.013939
345500 -- [-1042.043] (-1064.104) (-1055.655) (-1044.373) * (-1049.037) [-1047.070] (-1051.341) (-1050.785) -- 0:03:34
346000 -- (-1045.613) (-1055.125) [-1049.114] (-1053.305) * (-1043.455) [-1045.224] (-1051.482) (-1050.414) -- 0:03:33
346500 -- (-1042.449) (-1058.353) [-1036.297] (-1046.667) * (-1033.646) [-1043.525] (-1050.316) (-1044.104) -- 0:03:33
347000 -- (-1055.617) (-1055.248) [-1039.195] (-1039.504) * (-1042.053) (-1049.202) (-1066.688) [-1052.522] -- 0:03:32
347500 -- (-1048.576) (-1054.329) (-1042.436) [-1034.036] * (-1039.566) [-1032.178] (-1053.327) (-1046.309) -- 0:03:32
348000 -- (-1043.502) (-1054.466) (-1041.073) [-1031.957] * (-1047.382) (-1066.424) [-1050.424] (-1045.902) -- 0:03:33
348500 -- [-1031.454] (-1061.127) (-1046.498) (-1039.958) * [-1041.319] (-1047.149) (-1049.103) (-1042.556) -- 0:03:33
349000 -- [-1039.898] (-1042.873) (-1053.416) (-1049.638) * [-1048.276] (-1040.397) (-1049.069) (-1056.749) -- 0:03:32
349500 -- (-1045.665) [-1039.514] (-1042.362) (-1051.766) * [-1045.943] (-1043.803) (-1045.211) (-1042.283) -- 0:03:32
350000 -- [-1039.618] (-1050.214) (-1043.766) (-1042.876) * (-1045.057) [-1046.639] (-1040.868) (-1041.152) -- 0:03:31
Average standard deviation of split frequencies: 0.012616
350500 -- (-1046.319) [-1049.143] (-1050.334) (-1042.565) * (-1051.731) (-1048.484) [-1048.536] (-1039.902) -- 0:03:31
351000 -- (-1043.771) (-1061.221) (-1043.418) [-1034.670] * (-1040.872) (-1040.252) (-1044.737) [-1034.939] -- 0:03:32
351500 -- (-1051.784) (-1054.051) (-1045.964) [-1035.976] * (-1037.354) (-1050.887) [-1043.757] (-1044.969) -- 0:03:32
352000 -- (-1046.262) [-1045.715] (-1059.824) (-1051.464) * [-1035.312] (-1045.952) (-1049.361) (-1047.574) -- 0:03:31
352500 -- (-1055.977) [-1043.705] (-1051.361) (-1034.391) * [-1040.655] (-1036.826) (-1041.715) (-1054.572) -- 0:03:31
353000 -- (-1039.346) (-1051.912) (-1045.985) [-1044.508] * (-1046.856) [-1041.665] (-1047.278) (-1038.203) -- 0:03:30
353500 -- (-1047.026) (-1045.560) [-1043.167] (-1045.380) * (-1044.110) (-1050.472) (-1053.042) [-1044.624] -- 0:03:30
354000 -- (-1038.415) (-1047.041) [-1050.422] (-1047.602) * (-1054.165) [-1038.549] (-1039.767) (-1039.453) -- 0:03:29
354500 -- (-1038.076) (-1045.565) [-1045.182] (-1039.736) * (-1047.711) (-1039.533) (-1040.687) [-1040.341] -- 0:03:31
355000 -- (-1042.632) [-1040.359] (-1060.932) (-1038.715) * (-1046.560) (-1058.034) [-1048.683] (-1044.674) -- 0:03:30
Average standard deviation of split frequencies: 0.013140
355500 -- (-1049.108) (-1043.631) (-1068.976) [-1033.149] * [-1036.730] (-1040.245) (-1059.373) (-1038.857) -- 0:03:30
356000 -- (-1045.933) (-1048.108) (-1051.799) [-1045.937] * [-1039.816] (-1048.556) (-1046.347) (-1043.590) -- 0:03:29
356500 -- [-1040.747] (-1042.309) (-1047.793) (-1037.408) * [-1044.551] (-1053.552) (-1033.530) (-1045.986) -- 0:03:29
357000 -- (-1043.079) (-1054.374) (-1046.333) [-1033.633] * [-1039.053] (-1052.759) (-1047.589) (-1051.846) -- 0:03:28
357500 -- (-1044.959) (-1046.782) [-1052.461] (-1048.336) * (-1046.567) (-1038.140) [-1038.235] (-1050.005) -- 0:03:30
358000 -- (-1057.630) (-1057.541) (-1044.170) [-1047.936] * (-1044.206) (-1045.724) [-1048.255] (-1052.970) -- 0:03:29
358500 -- (-1045.448) [-1041.803] (-1046.769) (-1046.673) * (-1062.328) (-1053.582) (-1054.317) [-1045.675] -- 0:03:29
359000 -- (-1043.705) (-1048.366) (-1046.882) [-1037.683] * (-1061.057) (-1051.017) (-1038.241) [-1039.985] -- 0:03:28
359500 -- (-1044.463) (-1053.330) [-1037.345] (-1054.958) * [-1045.764] (-1047.376) (-1048.198) (-1053.064) -- 0:03:28
360000 -- [-1037.801] (-1048.077) (-1052.201) (-1044.885) * (-1040.700) [-1039.572] (-1042.742) (-1057.619) -- 0:03:28
Average standard deviation of split frequencies: 0.012769
360500 -- (-1052.711) [-1037.323] (-1054.692) (-1044.161) * [-1043.712] (-1053.854) (-1048.505) (-1040.100) -- 0:03:29
361000 -- (-1055.300) (-1040.956) (-1043.091) [-1039.264] * (-1048.958) [-1045.505] (-1040.271) (-1045.529) -- 0:03:28
361500 -- (-1044.709) (-1043.195) (-1038.946) [-1045.082] * (-1045.401) [-1040.201] (-1045.289) (-1058.322) -- 0:03:28
362000 -- (-1043.941) (-1055.212) [-1036.782] (-1052.327) * [-1042.611] (-1043.216) (-1047.034) (-1047.336) -- 0:03:27
362500 -- (-1051.576) (-1049.448) [-1037.223] (-1043.619) * (-1045.838) (-1047.724) [-1033.936] (-1040.487) -- 0:03:27
363000 -- (-1048.771) (-1055.384) [-1032.623] (-1043.153) * (-1051.805) (-1045.932) (-1037.897) [-1039.996] -- 0:03:27
363500 -- (-1051.879) [-1044.003] (-1051.754) (-1050.032) * [-1037.929] (-1045.002) (-1045.790) (-1043.391) -- 0:03:28
364000 -- (-1048.355) (-1050.751) (-1044.149) [-1043.773] * (-1047.971) [-1041.276] (-1044.949) (-1051.796) -- 0:03:27
364500 -- (-1035.658) [-1046.823] (-1046.213) (-1050.217) * (-1046.404) (-1046.897) [-1042.852] (-1041.966) -- 0:03:27
365000 -- (-1042.264) (-1062.804) [-1036.490] (-1042.720) * [-1041.546] (-1045.572) (-1040.855) (-1052.962) -- 0:03:27
Average standard deviation of split frequencies: 0.012682
365500 -- (-1041.254) (-1049.432) (-1039.905) [-1044.803] * (-1041.121) [-1035.331] (-1061.244) (-1054.103) -- 0:03:26
366000 -- [-1043.383] (-1057.158) (-1039.890) (-1047.376) * (-1036.943) [-1031.972] (-1049.568) (-1071.872) -- 0:03:26
366500 -- [-1040.583] (-1052.064) (-1043.494) (-1050.591) * [-1040.129] (-1053.681) (-1042.078) (-1051.191) -- 0:03:27
367000 -- (-1055.744) (-1054.052) (-1044.681) [-1049.644] * (-1046.482) (-1049.589) [-1044.238] (-1055.755) -- 0:03:26
367500 -- (-1045.316) (-1044.373) (-1040.658) [-1041.457] * (-1061.511) (-1040.022) (-1042.864) [-1046.798] -- 0:03:26
368000 -- (-1042.988) (-1048.710) [-1044.354] (-1046.653) * (-1061.299) (-1056.223) [-1044.801] (-1046.217) -- 0:03:26
368500 -- [-1050.238] (-1043.851) (-1048.035) (-1058.431) * (-1058.587) (-1049.519) [-1039.583] (-1044.772) -- 0:03:25
369000 -- (-1048.016) (-1049.457) (-1046.371) [-1042.568] * (-1073.670) [-1040.192] (-1037.154) (-1040.894) -- 0:03:25
369500 -- [-1042.627] (-1044.790) (-1047.696) (-1036.662) * (-1071.763) (-1046.827) (-1044.283) [-1043.108] -- 0:03:26
370000 -- (-1053.592) (-1039.730) [-1040.788] (-1040.266) * (-1052.046) (-1059.717) [-1037.098] (-1043.903) -- 0:03:26
Average standard deviation of split frequencies: 0.011935
370500 -- (-1046.873) (-1039.922) (-1042.602) [-1039.440] * [-1042.813] (-1038.904) (-1038.385) (-1050.409) -- 0:03:25
371000 -- (-1049.849) (-1033.713) [-1047.503] (-1040.443) * (-1040.818) [-1041.055] (-1040.853) (-1063.817) -- 0:03:25
371500 -- [-1042.841] (-1031.450) (-1041.900) (-1036.840) * (-1040.664) (-1042.730) [-1036.098] (-1055.459) -- 0:03:24
372000 -- (-1046.566) (-1043.927) [-1045.571] (-1045.726) * [-1036.897] (-1058.623) (-1038.577) (-1061.471) -- 0:03:24
372500 -- (-1050.502) [-1032.280] (-1045.893) (-1054.511) * [-1040.335] (-1051.836) (-1042.841) (-1051.630) -- 0:03:25
373000 -- (-1057.348) (-1045.105) [-1044.785] (-1053.743) * [-1042.446] (-1048.602) (-1039.054) (-1056.754) -- 0:03:25
373500 -- (-1043.828) [-1051.301] (-1042.969) (-1045.784) * (-1039.006) (-1067.773) [-1038.125] (-1053.402) -- 0:03:24
374000 -- [-1043.344] (-1050.219) (-1037.310) (-1048.545) * (-1047.566) [-1041.529] (-1044.580) (-1054.007) -- 0:03:24
374500 -- (-1059.480) (-1063.239) [-1040.730] (-1047.634) * [-1046.722] (-1052.948) (-1038.530) (-1054.037) -- 0:03:23
375000 -- [-1041.488] (-1053.231) (-1042.054) (-1041.902) * (-1055.027) [-1048.151] (-1039.804) (-1064.118) -- 0:03:23
Average standard deviation of split frequencies: 0.012441
375500 -- [-1037.133] (-1040.936) (-1052.588) (-1052.112) * (-1052.147) (-1046.441) [-1036.939] (-1053.114) -- 0:03:24
376000 -- [-1036.401] (-1045.267) (-1037.000) (-1037.381) * (-1038.878) (-1047.756) (-1040.915) [-1043.515] -- 0:03:24
376500 -- (-1042.045) (-1049.633) [-1040.449] (-1035.463) * (-1038.186) (-1050.119) [-1038.207] (-1044.915) -- 0:03:23
377000 -- (-1041.073) (-1045.937) (-1044.250) [-1035.410] * (-1050.911) [-1043.892] (-1043.918) (-1043.684) -- 0:03:23
377500 -- (-1037.552) [-1043.329] (-1046.990) (-1041.898) * (-1054.599) (-1049.534) [-1048.281] (-1048.306) -- 0:03:22
378000 -- [-1043.096] (-1050.849) (-1042.122) (-1046.346) * (-1063.937) (-1045.124) (-1047.124) [-1044.359] -- 0:03:22
378500 -- (-1055.226) [-1044.649] (-1042.652) (-1049.448) * (-1042.670) [-1045.233] (-1047.081) (-1045.660) -- 0:03:21
379000 -- [-1040.154] (-1039.183) (-1052.243) (-1046.018) * (-1053.404) (-1045.539) (-1044.654) [-1049.979] -- 0:03:23
379500 -- (-1054.392) (-1045.327) [-1041.897] (-1051.367) * (-1042.528) [-1041.469] (-1034.480) (-1037.681) -- 0:03:22
380000 -- (-1054.610) (-1040.727) [-1037.602] (-1038.898) * [-1038.898] (-1056.865) (-1037.742) (-1044.356) -- 0:03:22
Average standard deviation of split frequencies: 0.012098
380500 -- (-1056.553) [-1048.949] (-1047.226) (-1042.832) * [-1038.824] (-1057.118) (-1041.852) (-1047.025) -- 0:03:21
381000 -- (-1053.429) [-1041.004] (-1042.021) (-1036.686) * [-1036.286] (-1041.274) (-1045.193) (-1047.149) -- 0:03:21
381500 -- (-1044.623) (-1047.854) (-1040.358) [-1054.974] * (-1058.740) (-1048.229) (-1045.146) [-1039.789] -- 0:03:21
382000 -- (-1045.422) [-1046.595] (-1048.178) (-1049.910) * [-1054.687] (-1060.682) (-1043.373) (-1043.032) -- 0:03:22
382500 -- (-1048.698) (-1042.670) (-1042.904) [-1046.683] * (-1044.675) [-1041.873] (-1042.981) (-1050.156) -- 0:03:21
383000 -- [-1042.495] (-1050.535) (-1052.986) (-1044.398) * [-1040.255] (-1044.500) (-1049.657) (-1053.831) -- 0:03:21
383500 -- (-1067.602) (-1060.166) (-1044.624) [-1042.130] * (-1049.231) (-1035.266) [-1038.750] (-1054.474) -- 0:03:20
384000 -- (-1045.677) (-1046.864) (-1048.189) [-1037.096] * (-1041.258) (-1047.235) [-1050.199] (-1062.168) -- 0:03:20
384500 -- (-1038.622) (-1041.221) [-1041.233] (-1047.938) * [-1044.063] (-1045.846) (-1041.412) (-1049.348) -- 0:03:20
385000 -- [-1045.416] (-1044.486) (-1049.815) (-1038.976) * (-1048.193) (-1041.145) [-1036.261] (-1040.632) -- 0:03:21
Average standard deviation of split frequencies: 0.010991
385500 -- (-1039.451) (-1044.456) (-1047.871) [-1048.838] * (-1040.686) (-1044.008) [-1044.117] (-1055.571) -- 0:03:20
386000 -- (-1037.245) (-1050.756) (-1042.184) [-1050.072] * (-1048.066) [-1042.219] (-1041.807) (-1064.205) -- 0:03:20
386500 -- [-1037.127] (-1047.963) (-1049.591) (-1054.002) * [-1044.475] (-1043.479) (-1049.250) (-1063.692) -- 0:03:20
387000 -- [-1037.626] (-1061.155) (-1050.699) (-1051.353) * (-1046.080) [-1046.157] (-1037.688) (-1053.859) -- 0:03:19
387500 -- [-1039.940] (-1058.201) (-1057.594) (-1047.193) * (-1043.171) (-1043.474) [-1038.814] (-1057.205) -- 0:03:19
388000 -- (-1054.713) (-1042.395) (-1049.569) [-1037.206] * [-1036.170] (-1047.457) (-1050.100) (-1057.402) -- 0:03:20
388500 -- (-1038.515) [-1040.421] (-1052.229) (-1049.446) * (-1053.448) (-1050.976) (-1050.976) [-1044.414] -- 0:03:19
389000 -- (-1043.499) [-1038.103] (-1047.521) (-1044.332) * (-1061.016) (-1047.006) (-1041.877) [-1046.977] -- 0:03:19
389500 -- (-1047.768) [-1040.236] (-1051.788) (-1046.575) * (-1050.612) (-1043.913) [-1045.450] (-1049.989) -- 0:03:19
390000 -- (-1044.334) [-1042.965] (-1053.792) (-1052.930) * (-1047.392) [-1041.511] (-1049.153) (-1041.330) -- 0:03:18
Average standard deviation of split frequencies: 0.010025
390500 -- (-1049.074) [-1038.048] (-1039.613) (-1052.663) * (-1054.389) (-1053.775) [-1046.874] (-1046.657) -- 0:03:19
391000 -- (-1058.310) (-1043.432) [-1048.496] (-1040.793) * (-1035.937) (-1055.064) (-1064.562) [-1036.766] -- 0:03:19
391500 -- (-1052.237) (-1049.021) (-1046.798) [-1036.466] * [-1039.068] (-1039.781) (-1055.279) (-1039.309) -- 0:03:18
392000 -- [-1037.362] (-1049.494) (-1052.782) (-1042.635) * (-1043.765) (-1051.060) [-1041.739] (-1044.803) -- 0:03:18
392500 -- (-1043.739) (-1064.525) [-1040.943] (-1047.722) * (-1039.637) (-1039.125) (-1044.014) [-1038.009] -- 0:03:18
393000 -- (-1048.456) [-1038.653] (-1034.024) (-1044.776) * (-1046.956) (-1044.723) (-1046.784) [-1040.427] -- 0:03:19
393500 -- (-1044.248) (-1047.379) (-1040.654) [-1038.356] * (-1050.750) (-1043.349) [-1041.659] (-1045.677) -- 0:03:18
394000 -- [-1047.069] (-1047.268) (-1053.779) (-1050.460) * (-1045.980) [-1039.489] (-1043.468) (-1047.135) -- 0:03:18
394500 -- (-1038.494) (-1043.057) [-1043.242] (-1047.309) * (-1034.820) [-1044.096] (-1049.770) (-1041.679) -- 0:03:17
395000 -- [-1046.895] (-1052.211) (-1058.475) (-1042.079) * (-1053.773) [-1046.118] (-1037.609) (-1059.579) -- 0:03:17
Average standard deviation of split frequencies: 0.009706
395500 -- (-1048.409) [-1056.228] (-1060.939) (-1054.580) * (-1046.909) (-1041.576) (-1047.639) [-1053.905] -- 0:03:17
396000 -- (-1048.312) (-1045.771) (-1051.948) [-1039.878] * (-1042.662) [-1043.690] (-1044.082) (-1051.930) -- 0:03:18
396500 -- (-1044.692) [-1042.204] (-1050.256) (-1042.506) * [-1050.015] (-1043.224) (-1048.994) (-1054.556) -- 0:03:17
397000 -- (-1043.475) (-1048.909) [-1048.325] (-1045.587) * [-1040.051] (-1050.898) (-1054.998) (-1045.478) -- 0:03:17
397500 -- (-1044.538) [-1050.177] (-1045.804) (-1048.288) * [-1030.636] (-1052.785) (-1060.580) (-1046.643) -- 0:03:17
398000 -- [-1043.415] (-1040.951) (-1036.651) (-1034.910) * (-1037.783) (-1042.336) (-1053.388) [-1033.728] -- 0:03:16
398500 -- (-1039.716) [-1041.450] (-1045.468) (-1047.257) * [-1039.119] (-1049.107) (-1037.261) (-1040.967) -- 0:03:16
399000 -- [-1044.063] (-1051.062) (-1043.830) (-1044.959) * (-1039.723) [-1038.947] (-1049.565) (-1052.574) -- 0:03:17
399500 -- (-1042.020) (-1046.866) (-1044.391) [-1044.856] * (-1039.250) [-1036.608] (-1048.702) (-1043.492) -- 0:03:16
400000 -- (-1039.890) (-1045.196) (-1056.101) [-1038.519] * [-1039.792] (-1045.415) (-1059.954) (-1045.279) -- 0:03:16
Average standard deviation of split frequencies: 0.008960
400500 -- [-1040.676] (-1055.280) (-1036.932) (-1030.062) * (-1055.069) [-1037.723] (-1046.567) (-1054.706) -- 0:03:16
401000 -- [-1031.354] (-1046.452) (-1038.612) (-1037.662) * (-1056.064) (-1048.056) [-1038.324] (-1040.124) -- 0:03:15
401500 -- (-1042.098) [-1031.714] (-1056.115) (-1026.996) * (-1053.158) [-1042.076] (-1046.421) (-1042.320) -- 0:03:15
402000 -- [-1038.237] (-1049.283) (-1070.053) (-1035.130) * (-1041.737) (-1039.064) [-1052.968] (-1043.193) -- 0:03:16
402500 -- [-1031.632] (-1045.905) (-1046.952) (-1037.187) * (-1044.377) [-1042.409] (-1048.776) (-1056.781) -- 0:03:15
403000 -- [-1039.131] (-1045.659) (-1043.625) (-1041.163) * (-1038.061) (-1044.499) [-1044.114] (-1039.559) -- 0:03:15
403500 -- [-1047.118] (-1054.714) (-1052.173) (-1038.897) * (-1050.744) (-1055.343) (-1038.874) [-1049.841] -- 0:03:15
404000 -- (-1039.994) [-1042.093] (-1057.292) (-1043.782) * (-1044.906) [-1040.652] (-1038.291) (-1042.562) -- 0:03:14
404500 -- (-1046.014) (-1038.484) (-1043.159) [-1037.777] * (-1039.581) (-1044.296) [-1041.227] (-1055.048) -- 0:03:15
405000 -- [-1045.121] (-1034.812) (-1050.801) (-1049.877) * [-1048.443] (-1043.328) (-1049.338) (-1041.283) -- 0:03:15
Average standard deviation of split frequencies: 0.009467
405500 -- (-1063.592) [-1046.193] (-1050.873) (-1053.689) * (-1045.996) [-1046.038] (-1055.191) (-1056.419) -- 0:03:14
406000 -- [-1039.242] (-1054.532) (-1055.370) (-1048.665) * [-1041.729] (-1037.643) (-1051.043) (-1049.668) -- 0:03:14
406500 -- [-1045.725] (-1046.448) (-1054.858) (-1057.564) * (-1044.293) (-1047.316) (-1048.599) [-1034.731] -- 0:03:14
407000 -- (-1059.865) (-1040.480) [-1041.894] (-1044.926) * (-1049.087) (-1040.058) (-1044.836) [-1034.058] -- 0:03:13
407500 -- (-1058.853) (-1042.158) [-1048.950] (-1049.200) * [-1045.314] (-1044.733) (-1042.650) (-1039.447) -- 0:03:14
408000 -- (-1066.496) (-1043.208) [-1036.428] (-1056.410) * (-1046.521) (-1053.200) (-1052.057) [-1032.724] -- 0:03:14
408500 -- (-1057.657) (-1040.997) [-1038.048] (-1044.958) * (-1031.545) [-1037.109] (-1051.019) (-1039.940) -- 0:03:14
409000 -- (-1052.810) [-1035.757] (-1053.147) (-1047.402) * (-1049.910) [-1039.133] (-1044.509) (-1050.247) -- 0:03:13
409500 -- (-1044.002) (-1044.312) (-1051.320) [-1037.697] * (-1045.244) [-1038.944] (-1046.369) (-1042.928) -- 0:03:13
410000 -- [-1040.654] (-1055.469) (-1044.812) (-1038.252) * [-1037.098] (-1046.909) (-1049.901) (-1036.862) -- 0:03:12
Average standard deviation of split frequencies: 0.009890
410500 -- [-1047.166] (-1058.309) (-1049.458) (-1053.803) * (-1044.727) (-1038.233) [-1040.166] (-1046.541) -- 0:03:13
411000 -- (-1037.296) (-1047.645) (-1049.955) [-1042.942] * (-1047.322) (-1039.251) (-1042.629) [-1041.726] -- 0:03:13
411500 -- (-1050.348) (-1044.242) (-1044.151) [-1040.760] * (-1046.137) (-1049.792) [-1039.067] (-1047.543) -- 0:03:13
412000 -- (-1049.232) (-1037.307) (-1051.421) [-1035.480] * (-1038.497) [-1036.459] (-1047.204) (-1050.905) -- 0:03:12
412500 -- (-1053.384) (-1049.012) (-1052.446) [-1043.848] * (-1045.126) (-1058.215) (-1049.204) [-1044.985] -- 0:03:12
413000 -- (-1044.993) (-1040.661) (-1042.242) [-1039.813] * [-1039.475] (-1048.030) (-1064.628) (-1055.414) -- 0:03:11
413500 -- (-1051.881) (-1042.734) (-1043.122) [-1036.945] * [-1042.832] (-1048.531) (-1042.045) (-1040.461) -- 0:03:12
414000 -- [-1050.722] (-1049.011) (-1046.507) (-1057.309) * (-1042.761) (-1052.088) [-1047.425] (-1035.421) -- 0:03:12
414500 -- (-1061.416) [-1038.030] (-1046.076) (-1045.101) * (-1040.248) (-1040.060) [-1041.134] (-1050.910) -- 0:03:12
415000 -- (-1063.007) (-1055.544) (-1048.860) [-1044.375] * (-1047.029) [-1040.325] (-1046.860) (-1053.589) -- 0:03:11
Average standard deviation of split frequencies: 0.010634
415500 -- (-1071.084) (-1044.305) [-1042.498] (-1045.335) * (-1041.861) [-1048.578] (-1044.962) (-1036.960) -- 0:03:11
416000 -- (-1059.405) (-1044.172) (-1045.072) [-1040.609] * (-1057.155) [-1039.214] (-1042.551) (-1053.577) -- 0:03:10
416500 -- (-1039.366) (-1050.722) [-1039.479] (-1046.153) * (-1043.749) [-1036.467] (-1042.541) (-1057.733) -- 0:03:11
417000 -- (-1038.480) (-1047.749) [-1040.374] (-1057.056) * [-1034.127] (-1042.797) (-1051.758) (-1049.011) -- 0:03:11
417500 -- [-1033.914] (-1048.144) (-1056.186) (-1039.339) * (-1046.444) (-1051.092) [-1048.132] (-1042.089) -- 0:03:11
418000 -- (-1047.896) (-1047.596) (-1047.687) [-1040.404] * [-1044.310] (-1055.218) (-1059.066) (-1036.083) -- 0:03:10
418500 -- (-1060.265) [-1041.199] (-1043.429) (-1053.260) * (-1039.527) (-1053.977) (-1056.566) [-1043.886] -- 0:03:10
419000 -- (-1051.481) [-1048.656] (-1043.618) (-1047.084) * (-1055.144) (-1036.740) [-1037.061] (-1042.566) -- 0:03:09
419500 -- (-1032.838) (-1048.002) [-1046.960] (-1044.955) * (-1053.364) (-1049.099) (-1043.299) [-1038.362] -- 0:03:09
420000 -- (-1045.113) (-1045.479) [-1038.404] (-1047.900) * (-1051.947) [-1041.435] (-1047.557) (-1054.771) -- 0:03:10
Average standard deviation of split frequencies: 0.010172
420500 -- [-1038.548] (-1045.729) (-1045.012) (-1050.804) * (-1052.206) (-1052.320) (-1053.982) [-1044.601] -- 0:03:10
421000 -- [-1048.171] (-1046.478) (-1043.833) (-1032.575) * (-1050.049) (-1055.796) (-1048.061) [-1040.265] -- 0:03:09
421500 -- (-1052.709) (-1053.498) (-1051.397) [-1036.504] * (-1061.493) [-1038.304] (-1052.229) (-1036.943) -- 0:03:09
422000 -- (-1037.739) (-1032.559) [-1046.261] (-1039.131) * (-1048.714) (-1062.622) (-1051.000) [-1038.824] -- 0:03:09
422500 -- (-1034.691) (-1044.015) (-1050.244) [-1048.903] * (-1046.877) (-1041.665) (-1048.562) [-1038.731] -- 0:03:08
423000 -- [-1037.117] (-1052.753) (-1047.259) (-1036.584) * [-1039.972] (-1058.558) (-1052.879) (-1049.906) -- 0:03:09
423500 -- (-1044.563) (-1043.187) (-1056.621) [-1051.209] * [-1037.043] (-1053.110) (-1051.658) (-1055.859) -- 0:03:09
424000 -- (-1047.634) (-1048.504) (-1055.851) [-1042.245] * (-1046.701) [-1040.338] (-1043.034) (-1058.215) -- 0:03:08
424500 -- (-1041.939) (-1058.627) [-1050.887] (-1044.715) * (-1046.208) (-1048.290) [-1039.818] (-1043.058) -- 0:03:08
425000 -- [-1045.121] (-1047.447) (-1043.476) (-1036.292) * (-1041.541) (-1041.399) [-1036.807] (-1046.108) -- 0:03:08
Average standard deviation of split frequencies: 0.009789
425500 -- (-1042.152) [-1036.638] (-1046.504) (-1042.219) * [-1044.572] (-1046.302) (-1039.378) (-1052.101) -- 0:03:07
426000 -- [-1039.551] (-1043.808) (-1056.168) (-1042.271) * (-1040.407) [-1050.525] (-1046.470) (-1056.249) -- 0:03:08
426500 -- (-1039.688) (-1050.231) (-1068.874) [-1030.843] * [-1037.790] (-1043.589) (-1039.920) (-1050.212) -- 0:03:08
427000 -- (-1049.191) (-1045.760) (-1048.104) [-1038.768] * [-1053.017] (-1034.026) (-1051.615) (-1049.358) -- 0:03:07
427500 -- (-1037.850) (-1039.346) [-1046.410] (-1051.311) * (-1046.667) (-1033.058) (-1049.359) [-1048.308] -- 0:03:07
428000 -- (-1047.022) (-1033.765) (-1045.789) [-1035.384] * (-1039.374) [-1041.266] (-1048.312) (-1049.353) -- 0:03:07
428500 -- [-1042.853] (-1043.280) (-1046.680) (-1046.315) * (-1052.063) (-1049.767) (-1042.002) [-1039.282] -- 0:03:06
429000 -- (-1049.514) (-1040.651) (-1041.151) [-1045.121] * (-1052.646) (-1048.579) (-1054.676) [-1036.417] -- 0:03:07
429500 -- (-1051.024) [-1045.456] (-1034.283) (-1051.390) * (-1042.967) (-1053.849) [-1045.430] (-1031.542) -- 0:03:07
430000 -- [-1042.407] (-1047.759) (-1035.115) (-1054.011) * (-1035.785) (-1067.132) [-1044.176] (-1038.631) -- 0:03:06
Average standard deviation of split frequencies: 0.009851
430500 -- (-1039.377) (-1045.996) [-1033.926] (-1053.700) * (-1039.052) (-1054.443) (-1036.788) [-1035.666] -- 0:03:06
431000 -- (-1042.535) (-1041.836) (-1037.175) [-1039.688] * (-1053.303) (-1051.014) [-1048.399] (-1041.156) -- 0:03:06
431500 -- (-1043.955) [-1040.966] (-1040.677) (-1035.595) * (-1036.797) [-1038.627] (-1041.338) (-1042.624) -- 0:03:05
432000 -- [-1041.696] (-1036.484) (-1039.687) (-1049.503) * (-1044.297) (-1053.084) [-1034.584] (-1041.392) -- 0:03:05
432500 -- [-1040.710] (-1052.648) (-1051.699) (-1040.090) * (-1042.369) [-1039.150] (-1049.895) (-1045.515) -- 0:03:06
433000 -- (-1043.365) (-1049.962) [-1034.835] (-1036.876) * (-1056.744) [-1042.530] (-1052.893) (-1051.002) -- 0:03:05
433500 -- (-1040.837) (-1043.022) (-1039.793) [-1039.527] * (-1045.146) (-1049.693) [-1038.510] (-1037.358) -- 0:03:05
434000 -- (-1038.067) (-1035.551) (-1042.706) [-1035.577] * (-1040.401) (-1052.396) (-1042.092) [-1033.961] -- 0:03:05
434500 -- [-1036.164] (-1040.266) (-1043.701) (-1047.173) * (-1040.839) [-1040.472] (-1047.663) (-1047.620) -- 0:03:04
435000 -- (-1056.005) (-1047.363) [-1042.908] (-1051.246) * (-1042.693) [-1043.780] (-1036.395) (-1036.423) -- 0:03:04
Average standard deviation of split frequencies: 0.009564
435500 -- (-1050.772) (-1046.013) [-1038.168] (-1046.501) * (-1046.837) (-1043.075) (-1034.048) [-1056.859] -- 0:03:05
436000 -- (-1058.936) (-1050.945) (-1057.174) [-1042.555] * [-1036.248] (-1043.697) (-1057.980) (-1048.935) -- 0:03:04
436500 -- (-1049.208) [-1037.221] (-1051.888) (-1038.909) * (-1039.792) (-1047.054) [-1042.182] (-1047.136) -- 0:03:04
437000 -- (-1041.088) [-1041.740] (-1051.033) (-1045.531) * (-1066.604) (-1047.295) (-1042.118) [-1039.565] -- 0:03:04
437500 -- (-1050.351) (-1037.167) (-1045.335) [-1042.945] * [-1040.307] (-1041.401) (-1049.535) (-1048.877) -- 0:03:03
438000 -- (-1043.021) (-1053.765) (-1049.257) [-1034.648] * [-1044.077] (-1043.798) (-1062.709) (-1035.018) -- 0:03:04
438500 -- (-1048.856) (-1049.464) [-1045.452] (-1036.244) * (-1042.158) (-1050.198) (-1046.459) [-1036.123] -- 0:03:04
439000 -- (-1040.029) (-1055.170) [-1047.527] (-1037.026) * (-1050.079) (-1048.023) (-1046.278) [-1040.968] -- 0:03:04
439500 -- (-1053.909) (-1052.312) [-1044.315] (-1044.109) * (-1054.846) (-1047.550) (-1050.217) [-1040.523] -- 0:03:03
440000 -- (-1048.703) [-1045.046] (-1042.521) (-1052.592) * (-1045.320) [-1035.619] (-1047.029) (-1045.241) -- 0:03:03
Average standard deviation of split frequencies: 0.009052
440500 -- [-1038.352] (-1046.713) (-1038.228) (-1040.073) * (-1058.382) (-1048.452) (-1050.985) [-1039.161] -- 0:03:04
441000 -- [-1045.950] (-1047.222) (-1046.739) (-1053.393) * (-1055.787) (-1043.366) [-1034.859] (-1042.409) -- 0:03:03
441500 -- (-1044.956) (-1052.056) [-1037.365] (-1051.436) * (-1037.128) (-1044.762) [-1034.502] (-1044.025) -- 0:03:03
442000 -- [-1051.360] (-1047.990) (-1035.746) (-1049.510) * (-1058.168) [-1037.073] (-1038.768) (-1037.445) -- 0:03:03
442500 -- (-1043.122) [-1047.189] (-1059.264) (-1051.988) * [-1042.641] (-1053.657) (-1046.865) (-1037.423) -- 0:03:02
443000 -- (-1047.838) (-1048.688) [-1040.768] (-1042.247) * (-1043.166) (-1048.694) [-1042.428] (-1044.186) -- 0:03:02
443500 -- (-1044.796) (-1055.996) [-1046.727] (-1064.224) * (-1048.664) (-1057.030) [-1051.036] (-1043.641) -- 0:03:01
444000 -- (-1054.067) (-1043.655) [-1047.639] (-1046.051) * (-1044.388) (-1051.758) [-1051.336] (-1044.319) -- 0:03:02
444500 -- (-1039.689) (-1044.592) [-1034.600] (-1055.875) * (-1050.462) (-1041.528) (-1041.542) [-1048.152] -- 0:03:02
445000 -- [-1047.087] (-1042.043) (-1041.849) (-1053.140) * (-1035.424) (-1037.924) [-1043.232] (-1049.322) -- 0:03:02
Average standard deviation of split frequencies: 0.009106
445500 -- (-1047.824) (-1044.126) (-1045.570) [-1037.062] * [-1034.415] (-1049.014) (-1043.249) (-1040.734) -- 0:03:01
446000 -- (-1038.612) [-1041.461] (-1053.791) (-1054.971) * (-1036.297) (-1043.715) (-1056.922) [-1043.204] -- 0:03:01
446500 -- (-1049.437) [-1039.228] (-1050.816) (-1047.585) * (-1052.979) [-1035.956] (-1046.731) (-1041.439) -- 0:03:00
447000 -- (-1048.879) [-1040.013] (-1038.203) (-1053.310) * (-1055.797) [-1039.614] (-1044.549) (-1045.681) -- 0:03:01
447500 -- (-1049.027) [-1038.748] (-1055.836) (-1049.510) * [-1036.443] (-1051.651) (-1034.644) (-1033.123) -- 0:03:01
448000 -- (-1041.546) (-1035.441) (-1040.024) [-1040.311] * (-1042.948) (-1038.196) (-1045.050) [-1038.033] -- 0:03:01
448500 -- [-1047.568] (-1051.799) (-1053.959) (-1052.658) * (-1053.112) [-1034.649] (-1038.378) (-1047.601) -- 0:03:00
449000 -- (-1043.177) (-1043.849) [-1042.834] (-1040.026) * (-1047.547) (-1037.923) [-1038.037] (-1048.707) -- 0:03:00
449500 -- (-1036.614) (-1041.481) (-1056.026) [-1043.255] * (-1051.045) [-1041.361] (-1042.945) (-1035.540) -- 0:03:00
450000 -- (-1043.010) (-1049.156) [-1047.233] (-1050.243) * (-1039.090) [-1036.502] (-1055.511) (-1040.349) -- 0:03:00
Average standard deviation of split frequencies: 0.009736
450500 -- (-1034.490) [-1042.974] (-1043.752) (-1054.118) * (-1041.027) (-1041.173) (-1050.491) [-1036.436] -- 0:03:00
451000 -- [-1041.256] (-1034.140) (-1050.561) (-1048.760) * (-1045.698) (-1048.650) (-1053.085) [-1036.207] -- 0:03:00
451500 -- (-1043.434) (-1048.604) [-1042.486] (-1045.605) * [-1042.126] (-1048.520) (-1049.660) (-1047.727) -- 0:02:59
452000 -- [-1041.150] (-1036.060) (-1047.075) (-1051.169) * [-1043.627] (-1056.736) (-1043.397) (-1054.061) -- 0:02:59
452500 -- (-1044.736) (-1045.269) [-1040.009] (-1042.791) * (-1042.939) [-1042.888] (-1041.738) (-1054.232) -- 0:02:59
453000 -- (-1047.791) (-1041.202) [-1035.301] (-1049.903) * (-1049.580) (-1045.070) [-1033.361] (-1044.567) -- 0:02:59
453500 -- (-1045.478) (-1042.796) (-1044.934) [-1035.452] * (-1048.970) (-1042.897) [-1044.013] (-1042.276) -- 0:02:59
454000 -- [-1039.475] (-1044.183) (-1055.870) (-1042.083) * (-1041.632) [-1042.330] (-1056.458) (-1039.783) -- 0:02:59
454500 -- (-1045.305) (-1037.730) [-1046.174] (-1045.690) * (-1036.534) (-1056.007) (-1049.301) [-1038.603] -- 0:02:58
455000 -- (-1056.321) (-1045.815) (-1035.202) [-1038.515] * (-1038.687) [-1044.279] (-1042.702) (-1043.125) -- 0:02:58
Average standard deviation of split frequencies: 0.009940
455500 -- (-1038.956) (-1035.900) (-1052.110) [-1045.128] * (-1042.739) (-1049.762) (-1071.094) [-1032.014] -- 0:02:58
456000 -- (-1041.221) [-1032.198] (-1052.922) (-1044.204) * [-1032.124] (-1037.678) (-1048.349) (-1041.422) -- 0:02:57
456500 -- (-1041.719) (-1048.723) (-1043.605) [-1043.297] * (-1043.863) (-1049.844) (-1048.781) [-1030.993] -- 0:02:58
457000 -- [-1039.556] (-1051.381) (-1047.168) (-1049.041) * (-1040.055) (-1051.513) (-1042.739) [-1038.566] -- 0:02:58
457500 -- (-1044.511) [-1037.415] (-1043.224) (-1039.069) * (-1048.023) (-1058.204) (-1036.864) [-1040.732] -- 0:02:57
458000 -- (-1050.105) [-1034.810] (-1042.437) (-1059.144) * (-1055.064) (-1044.329) (-1044.371) [-1043.460] -- 0:02:57
458500 -- (-1054.633) (-1037.874) (-1053.705) [-1039.808] * [-1040.193] (-1055.485) (-1041.302) (-1040.491) -- 0:02:57
459000 -- (-1051.492) (-1039.838) [-1041.093] (-1041.713) * (-1036.111) (-1044.534) [-1035.499] (-1041.496) -- 0:02:56
459500 -- (-1053.573) (-1035.925) (-1049.136) [-1043.887] * [-1035.610] (-1047.516) (-1040.136) (-1040.461) -- 0:02:57
460000 -- (-1062.533) (-1041.999) (-1041.734) [-1038.911] * [-1036.264] (-1047.961) (-1048.843) (-1049.193) -- 0:02:57
Average standard deviation of split frequencies: 0.009289
460500 -- (-1045.925) (-1046.831) (-1050.707) [-1032.919] * (-1043.881) [-1051.087] (-1052.097) (-1044.397) -- 0:02:56
461000 -- (-1037.218) (-1047.798) [-1042.268] (-1040.722) * (-1048.158) [-1041.855] (-1043.829) (-1046.291) -- 0:02:56
461500 -- [-1041.315] (-1048.275) (-1035.297) (-1041.020) * [-1050.153] (-1052.763) (-1044.799) (-1044.901) -- 0:02:56
462000 -- (-1043.893) (-1046.705) (-1047.156) [-1039.967] * (-1045.560) [-1039.088] (-1047.215) (-1037.683) -- 0:02:55
462500 -- [-1033.098] (-1055.204) (-1052.646) (-1047.291) * (-1048.444) [-1039.552] (-1051.783) (-1046.035) -- 0:02:56
463000 -- (-1034.663) (-1046.460) (-1047.807) [-1033.544] * (-1038.481) [-1038.959] (-1044.127) (-1042.720) -- 0:02:56
463500 -- [-1041.063] (-1053.265) (-1036.119) (-1038.679) * (-1038.830) (-1037.143) [-1029.702] (-1046.776) -- 0:02:55
464000 -- (-1037.870) [-1044.013] (-1043.703) (-1048.218) * (-1039.071) (-1051.722) [-1040.581] (-1051.825) -- 0:02:55
464500 -- (-1045.101) [-1041.845] (-1044.113) (-1047.058) * (-1046.786) (-1036.933) [-1037.336] (-1057.835) -- 0:02:55
465000 -- (-1043.943) [-1045.895] (-1039.693) (-1040.561) * (-1037.707) [-1033.257] (-1044.778) (-1047.269) -- 0:02:54
Average standard deviation of split frequencies: 0.009571
465500 -- (-1057.554) [-1040.902] (-1034.935) (-1042.474) * (-1041.782) (-1038.226) [-1040.732] (-1061.053) -- 0:02:55
466000 -- (-1033.727) [-1040.575] (-1055.472) (-1037.330) * (-1053.610) (-1055.895) (-1039.242) [-1047.440] -- 0:02:55
466500 -- (-1037.842) [-1034.896] (-1048.296) (-1049.281) * (-1057.038) (-1041.581) [-1035.669] (-1055.893) -- 0:02:54
467000 -- (-1043.278) (-1053.776) (-1045.984) [-1042.587] * (-1041.710) [-1032.469] (-1036.474) (-1055.325) -- 0:02:54
467500 -- (-1050.069) (-1048.074) (-1047.277) [-1042.858] * (-1044.889) (-1039.122) [-1040.685] (-1049.569) -- 0:02:54
468000 -- (-1053.216) (-1045.134) [-1051.381] (-1044.196) * (-1041.361) [-1036.268] (-1030.896) (-1046.564) -- 0:02:53
468500 -- (-1052.376) [-1040.262] (-1051.552) (-1046.224) * [-1032.801] (-1036.965) (-1056.630) (-1046.052) -- 0:02:54
469000 -- (-1045.919) (-1041.106) [-1036.997] (-1040.087) * (-1045.622) (-1037.681) (-1037.425) [-1040.004] -- 0:02:54
469500 -- [-1038.882] (-1053.948) (-1050.004) (-1045.831) * (-1045.113) (-1044.921) [-1037.403] (-1050.024) -- 0:02:54
470000 -- [-1040.787] (-1055.832) (-1045.794) (-1048.646) * [-1039.759] (-1063.225) (-1052.695) (-1045.309) -- 0:02:53
Average standard deviation of split frequencies: 0.009939
470500 -- [-1043.743] (-1052.360) (-1042.417) (-1044.475) * (-1036.936) (-1048.846) (-1052.733) [-1045.610] -- 0:02:53
471000 -- (-1055.139) (-1048.468) [-1040.473] (-1050.476) * (-1040.844) (-1047.869) (-1039.559) [-1046.508] -- 0:02:54
471500 -- [-1047.907] (-1052.381) (-1056.389) (-1040.351) * (-1046.622) [-1040.119] (-1036.449) (-1065.154) -- 0:02:53
472000 -- [-1043.928] (-1042.666) (-1046.859) (-1048.061) * (-1035.538) (-1055.243) (-1052.549) [-1045.905] -- 0:02:53
472500 -- (-1049.472) (-1050.985) [-1052.525] (-1040.441) * [-1047.234] (-1050.068) (-1037.175) (-1044.990) -- 0:02:53
473000 -- (-1051.194) (-1044.447) (-1042.911) [-1039.462] * [-1044.485] (-1046.700) (-1051.228) (-1038.569) -- 0:02:52
473500 -- [-1040.602] (-1054.756) (-1067.178) (-1039.645) * (-1040.086) [-1045.138] (-1051.814) (-1037.837) -- 0:02:52
474000 -- (-1054.080) (-1047.573) [-1050.575] (-1050.109) * (-1053.004) (-1051.557) [-1036.213] (-1042.505) -- 0:02:53
474500 -- [-1049.842] (-1045.228) (-1045.318) (-1046.921) * (-1045.299) (-1043.835) (-1039.984) [-1036.131] -- 0:02:52
475000 -- [-1042.588] (-1042.633) (-1051.330) (-1049.312) * (-1049.276) (-1053.387) (-1048.810) [-1044.943] -- 0:02:52
Average standard deviation of split frequencies: 0.009675
475500 -- [-1042.074] (-1052.483) (-1041.707) (-1040.580) * [-1036.544] (-1042.463) (-1063.955) (-1042.255) -- 0:02:52
476000 -- (-1044.910) (-1055.341) [-1042.882] (-1039.463) * [-1034.009] (-1042.618) (-1057.134) (-1045.715) -- 0:02:51
476500 -- (-1044.270) (-1057.344) (-1065.188) [-1034.727] * (-1045.710) [-1038.940] (-1046.304) (-1058.204) -- 0:02:51
477000 -- (-1051.501) (-1050.336) [-1039.334] (-1040.420) * (-1051.515) (-1053.835) [-1044.988] (-1052.952) -- 0:02:51
477500 -- [-1035.349] (-1044.882) (-1054.842) (-1043.811) * [-1037.367] (-1048.266) (-1055.827) (-1063.753) -- 0:02:51
478000 -- (-1049.539) [-1047.499] (-1049.854) (-1034.698) * (-1041.042) (-1044.848) (-1051.096) [-1036.252] -- 0:02:51
478500 -- (-1052.719) [-1029.585] (-1048.366) (-1042.299) * (-1041.714) [-1034.036] (-1043.995) (-1045.278) -- 0:02:51
479000 -- (-1041.509) (-1043.870) (-1045.937) [-1040.590] * (-1045.622) (-1038.726) [-1043.363] (-1045.400) -- 0:02:50
479500 -- (-1045.969) (-1039.691) [-1037.786] (-1040.293) * (-1039.818) (-1042.002) (-1048.010) [-1037.249] -- 0:02:50
480000 -- (-1043.925) [-1043.474] (-1047.661) (-1043.548) * (-1051.932) (-1057.428) [-1041.768] (-1046.216) -- 0:02:50
Average standard deviation of split frequencies: 0.009355
480500 -- (-1055.331) (-1039.772) [-1047.181] (-1049.817) * (-1050.862) (-1043.004) [-1053.899] (-1054.454) -- 0:02:50
481000 -- (-1044.312) (-1045.075) [-1042.031] (-1037.536) * (-1051.962) [-1045.329] (-1045.293) (-1048.160) -- 0:02:50
481500 -- (-1047.924) [-1045.414] (-1059.403) (-1047.510) * (-1049.560) [-1040.396] (-1050.640) (-1042.794) -- 0:02:50
482000 -- (-1061.598) (-1048.410) (-1037.478) [-1043.402] * (-1056.213) (-1039.822) [-1043.807] (-1058.045) -- 0:02:49
482500 -- (-1048.600) (-1046.345) (-1043.068) [-1040.729] * (-1061.378) (-1043.628) (-1052.558) [-1045.767] -- 0:02:49
483000 -- (-1054.246) [-1049.626] (-1044.501) (-1045.447) * (-1057.099) (-1038.407) [-1039.718] (-1040.091) -- 0:02:49
483500 -- (-1064.702) (-1041.966) (-1047.245) [-1036.827] * (-1070.624) (-1055.155) [-1045.309] (-1041.796) -- 0:02:49
484000 -- (-1048.797) (-1041.106) (-1049.104) [-1038.027] * (-1044.282) [-1043.000] (-1041.366) (-1048.418) -- 0:02:49
484500 -- (-1052.880) (-1039.150) (-1042.233) [-1045.937] * (-1046.834) (-1046.415) [-1035.048] (-1043.844) -- 0:02:49
485000 -- (-1051.557) (-1044.099) [-1037.907] (-1044.603) * (-1041.054) [-1037.258] (-1039.947) (-1040.815) -- 0:02:48
Average standard deviation of split frequencies: 0.009849
485500 -- (-1051.110) (-1043.536) (-1037.882) [-1042.950] * (-1038.097) (-1042.861) [-1036.427] (-1043.212) -- 0:02:48
486000 -- (-1047.107) [-1047.660] (-1040.440) (-1049.631) * (-1040.345) [-1042.580] (-1048.272) (-1040.618) -- 0:02:48
486500 -- [-1044.186] (-1044.058) (-1039.246) (-1041.579) * (-1035.814) (-1050.396) (-1049.944) [-1040.561] -- 0:02:48
487000 -- (-1037.820) [-1051.061] (-1053.580) (-1033.371) * [-1037.866] (-1035.378) (-1044.734) (-1036.614) -- 0:02:48
487500 -- (-1041.514) (-1049.417) (-1052.123) [-1037.176] * (-1042.183) (-1042.656) (-1045.284) [-1052.067] -- 0:02:48
488000 -- [-1043.463] (-1058.273) (-1048.558) (-1056.914) * [-1044.703] (-1046.289) (-1040.232) (-1058.302) -- 0:02:47
488500 -- (-1046.682) (-1051.512) (-1041.666) [-1041.217] * (-1048.046) (-1041.143) [-1039.044] (-1044.396) -- 0:02:47
489000 -- (-1042.423) [-1045.643] (-1042.621) (-1049.396) * (-1042.437) (-1040.279) (-1048.777) [-1034.109] -- 0:02:47
489500 -- (-1048.888) (-1048.041) [-1041.590] (-1040.502) * (-1044.833) (-1045.380) [-1040.936] (-1046.741) -- 0:02:47
490000 -- (-1044.746) [-1035.757] (-1049.437) (-1043.206) * [-1041.400] (-1049.422) (-1036.518) (-1045.572) -- 0:02:47
Average standard deviation of split frequencies: 0.009829
490500 -- (-1042.860) (-1052.253) [-1037.214] (-1052.544) * [-1058.578] (-1048.614) (-1040.815) (-1040.350) -- 0:02:47
491000 -- (-1045.449) [-1042.660] (-1035.632) (-1057.385) * (-1065.144) (-1047.554) [-1036.266] (-1045.904) -- 0:02:46
491500 -- (-1043.881) [-1048.221] (-1040.764) (-1059.112) * [-1046.648] (-1038.151) (-1051.870) (-1046.433) -- 0:02:46
492000 -- (-1039.532) (-1049.891) (-1058.518) [-1038.292] * [-1038.830] (-1049.277) (-1032.282) (-1051.238) -- 0:02:46
492500 -- [-1035.819] (-1047.063) (-1045.264) (-1045.902) * [-1043.860] (-1045.761) (-1039.799) (-1054.265) -- 0:02:45
493000 -- (-1048.950) (-1041.706) [-1042.505] (-1046.684) * (-1050.084) (-1043.928) [-1042.149] (-1036.268) -- 0:02:46
493500 -- (-1043.620) (-1046.295) (-1039.164) [-1038.273] * (-1041.013) [-1041.507] (-1050.410) (-1034.426) -- 0:02:46
494000 -- (-1046.959) (-1047.686) [-1045.439] (-1049.734) * (-1042.373) (-1061.708) [-1034.763] (-1046.868) -- 0:02:45
494500 -- (-1051.887) (-1041.865) [-1043.973] (-1050.703) * (-1059.118) [-1048.061] (-1041.386) (-1052.965) -- 0:02:45
495000 -- (-1056.420) (-1042.709) (-1047.338) [-1039.566] * (-1040.141) [-1040.276] (-1048.699) (-1041.918) -- 0:02:45
Average standard deviation of split frequencies: 0.009650
495500 -- [-1041.022] (-1045.339) (-1048.337) (-1045.010) * [-1039.782] (-1043.998) (-1051.762) (-1047.653) -- 0:02:45
496000 -- (-1050.949) [-1048.930] (-1043.299) (-1043.624) * [-1040.236] (-1062.827) (-1043.745) (-1044.787) -- 0:02:45
496500 -- (-1040.748) (-1044.008) [-1038.698] (-1044.384) * (-1043.065) (-1051.847) (-1037.726) [-1039.575] -- 0:02:45
497000 -- (-1050.664) (-1039.948) (-1037.054) [-1033.651] * (-1042.847) (-1042.730) (-1041.884) [-1045.377] -- 0:02:44
497500 -- (-1050.636) [-1037.159] (-1050.903) (-1035.755) * (-1044.981) [-1044.026] (-1051.748) (-1046.694) -- 0:02:44
498000 -- (-1046.369) (-1038.046) [-1036.263] (-1043.792) * (-1050.376) (-1051.618) (-1042.365) [-1039.065] -- 0:02:44
498500 -- (-1044.166) (-1039.507) (-1048.296) [-1054.440] * (-1049.662) (-1053.559) [-1038.192] (-1041.353) -- 0:02:44
499000 -- [-1037.469] (-1049.748) (-1037.805) (-1050.645) * (-1042.850) [-1046.745] (-1040.050) (-1050.899) -- 0:02:44
499500 -- (-1040.026) [-1039.192] (-1045.171) (-1050.760) * (-1044.157) (-1043.711) (-1049.181) [-1035.120] -- 0:02:44
500000 -- (-1053.680) (-1052.097) (-1038.245) [-1037.143] * [-1043.952] (-1039.293) (-1039.381) (-1051.714) -- 0:02:44
Average standard deviation of split frequencies: 0.009995
500500 -- (-1052.783) (-1036.303) [-1033.996] (-1047.614) * (-1055.024) (-1042.683) [-1044.053] (-1040.903) -- 0:02:43
501000 -- (-1053.900) (-1048.855) (-1049.003) [-1042.388] * (-1062.018) (-1054.851) (-1039.409) [-1039.056] -- 0:02:44
501500 -- (-1041.024) [-1039.529] (-1044.287) (-1051.177) * (-1051.162) (-1043.035) [-1040.239] (-1042.717) -- 0:02:44
502000 -- (-1044.577) (-1056.851) [-1036.204] (-1053.402) * (-1057.249) (-1045.893) (-1045.148) [-1051.690] -- 0:02:43
502500 -- (-1053.804) (-1048.496) [-1039.734] (-1047.007) * [-1045.381] (-1045.401) (-1051.414) (-1039.000) -- 0:02:43
503000 -- (-1047.891) [-1042.024] (-1034.400) (-1046.032) * (-1038.692) (-1050.446) (-1040.395) [-1038.610] -- 0:02:43
503500 -- (-1057.724) (-1047.370) [-1040.143] (-1037.376) * [-1047.552] (-1044.785) (-1044.047) (-1050.357) -- 0:02:42
504000 -- (-1053.644) (-1043.984) [-1034.982] (-1046.624) * (-1046.044) [-1052.553] (-1051.895) (-1050.934) -- 0:02:43
504500 -- (-1057.414) (-1049.131) [-1042.391] (-1039.134) * (-1041.474) (-1053.217) [-1057.558] (-1040.510) -- 0:02:43
505000 -- (-1057.575) (-1035.666) [-1050.973] (-1046.434) * [-1033.640] (-1050.609) (-1057.097) (-1041.900) -- 0:02:42
Average standard deviation of split frequencies: 0.009388
505500 -- (-1050.341) (-1040.945) [-1043.764] (-1059.313) * [-1042.792] (-1056.222) (-1046.537) (-1046.036) -- 0:02:42
506000 -- [-1043.819] (-1046.827) (-1049.399) (-1065.849) * (-1044.788) (-1055.784) [-1050.491] (-1051.720) -- 0:02:42
506500 -- [-1041.363] (-1046.360) (-1046.161) (-1049.670) * (-1051.652) (-1046.848) (-1041.764) [-1040.734] -- 0:02:42
507000 -- (-1043.214) (-1038.633) (-1049.810) [-1045.754] * [-1048.668] (-1046.237) (-1046.213) (-1042.052) -- 0:02:42
507500 -- (-1043.064) (-1049.004) [-1042.212] (-1036.907) * (-1063.728) (-1049.612) (-1036.947) [-1036.678] -- 0:02:42
508000 -- (-1038.723) (-1038.987) [-1037.941] (-1041.350) * (-1056.656) (-1046.307) [-1034.569] (-1040.521) -- 0:02:41
508500 -- (-1036.813) (-1054.070) (-1053.288) [-1041.492] * (-1055.062) [-1034.775] (-1033.582) (-1043.385) -- 0:02:41
509000 -- (-1049.404) [-1036.865] (-1049.453) (-1047.216) * (-1050.208) (-1045.694) (-1051.181) [-1042.894] -- 0:02:41
509500 -- (-1041.121) [-1037.193] (-1047.534) (-1039.806) * (-1048.082) (-1041.912) [-1047.177] (-1043.858) -- 0:02:40
510000 -- (-1052.486) [-1036.966] (-1047.093) (-1047.922) * (-1055.361) [-1043.705] (-1036.356) (-1040.571) -- 0:02:41
Average standard deviation of split frequencies: 0.009799
510500 -- (-1043.732) [-1039.633] (-1039.959) (-1058.055) * [-1048.077] (-1048.883) (-1054.766) (-1034.245) -- 0:02:41
511000 -- [-1042.167] (-1049.773) (-1046.776) (-1049.723) * [-1046.730] (-1042.174) (-1047.584) (-1045.238) -- 0:02:40
511500 -- (-1040.698) (-1072.962) [-1043.085] (-1053.339) * (-1047.337) (-1051.317) [-1037.387] (-1054.688) -- 0:02:40
512000 -- [-1038.133] (-1034.188) (-1040.553) (-1060.585) * (-1034.463) (-1044.915) [-1040.006] (-1059.923) -- 0:02:40
512500 -- (-1054.663) (-1049.295) (-1042.340) [-1040.896] * [-1046.224] (-1049.056) (-1051.601) (-1045.442) -- 0:02:39
513000 -- (-1046.225) [-1046.856] (-1054.888) (-1047.074) * [-1043.549] (-1042.464) (-1040.799) (-1046.415) -- 0:02:40
513500 -- (-1043.939) (-1043.297) [-1040.637] (-1039.248) * [-1037.798] (-1045.355) (-1060.198) (-1047.447) -- 0:02:40
514000 -- (-1051.125) (-1046.255) [-1036.329] (-1044.739) * (-1047.849) (-1040.580) (-1038.298) [-1047.816] -- 0:02:39
514500 -- (-1045.506) [-1044.851] (-1035.169) (-1048.690) * [-1045.494] (-1042.841) (-1043.040) (-1056.285) -- 0:02:39
515000 -- (-1057.215) (-1047.403) (-1048.248) [-1030.933] * (-1053.712) (-1037.684) [-1041.320] (-1059.702) -- 0:02:39
Average standard deviation of split frequencies: 0.010401
515500 -- [-1034.602] (-1053.799) (-1036.848) (-1040.961) * (-1060.279) (-1051.224) [-1040.301] (-1049.203) -- 0:02:39
516000 -- (-1049.725) (-1045.481) (-1046.465) [-1040.126] * (-1043.749) (-1044.382) [-1035.073] (-1046.057) -- 0:02:39
516500 -- (-1052.895) (-1041.267) (-1035.934) [-1039.594] * (-1047.663) [-1043.397] (-1043.992) (-1056.452) -- 0:02:39
517000 -- [-1053.064] (-1052.934) (-1054.712) (-1046.522) * [-1033.482] (-1038.182) (-1046.970) (-1044.646) -- 0:02:38
517500 -- (-1053.282) (-1046.059) (-1045.924) [-1043.719] * [-1035.339] (-1041.233) (-1054.008) (-1047.292) -- 0:02:38
518000 -- (-1059.140) (-1044.898) [-1040.951] (-1045.393) * (-1041.276) (-1051.166) [-1033.691] (-1044.838) -- 0:02:38
518500 -- (-1045.668) (-1042.491) (-1034.341) [-1050.298] * (-1042.548) (-1053.354) [-1040.873] (-1053.200) -- 0:02:38
519000 -- (-1051.154) (-1040.378) (-1043.706) [-1043.639] * [-1039.885] (-1040.840) (-1049.061) (-1048.152) -- 0:02:38
519500 -- [-1047.156] (-1044.084) (-1047.359) (-1063.473) * [-1036.842] (-1062.719) (-1039.653) (-1040.601) -- 0:02:38
520000 -- (-1072.844) (-1039.030) (-1044.676) [-1049.882] * (-1048.384) (-1070.070) [-1035.132] (-1042.781) -- 0:02:37
Average standard deviation of split frequencies: 0.010725
520500 -- (-1041.384) (-1039.610) (-1053.042) [-1039.526] * (-1050.376) (-1060.161) [-1036.133] (-1034.590) -- 0:02:37
521000 -- (-1043.572) (-1049.508) [-1035.137] (-1043.513) * (-1042.532) (-1052.263) [-1037.442] (-1045.923) -- 0:02:37
521500 -- (-1051.966) (-1052.193) [-1036.900] (-1042.831) * (-1051.024) (-1055.998) (-1049.963) [-1045.586] -- 0:02:37
522000 -- (-1050.091) [-1038.552] (-1049.520) (-1036.673) * (-1050.192) (-1052.226) [-1042.118] (-1050.317) -- 0:02:37
522500 -- (-1052.041) (-1043.102) (-1052.160) [-1036.268] * (-1052.763) (-1045.760) (-1049.479) [-1037.124] -- 0:02:37
523000 -- (-1046.879) [-1042.152] (-1048.577) (-1042.337) * (-1045.625) (-1050.532) [-1044.432] (-1052.323) -- 0:02:36
523500 -- (-1058.221) [-1051.563] (-1053.218) (-1045.867) * (-1053.829) (-1048.300) [-1036.563] (-1047.458) -- 0:02:36
524000 -- (-1038.541) (-1044.800) (-1043.799) [-1040.693] * (-1059.083) (-1055.748) (-1040.667) [-1046.228] -- 0:02:37
524500 -- [-1044.978] (-1045.417) (-1039.456) (-1047.790) * (-1046.225) [-1045.759] (-1047.459) (-1049.100) -- 0:02:36
525000 -- (-1048.252) (-1054.959) [-1039.941] (-1061.401) * (-1039.687) [-1037.605] (-1044.446) (-1042.045) -- 0:02:36
Average standard deviation of split frequencies: 0.010823
525500 -- (-1041.625) (-1052.174) (-1050.039) [-1041.777] * (-1056.450) (-1051.183) (-1032.412) [-1046.200] -- 0:02:36
526000 -- (-1043.109) (-1044.837) [-1034.052] (-1053.949) * (-1048.329) [-1037.114] (-1037.331) (-1051.986) -- 0:02:35
526500 -- [-1049.324] (-1051.881) (-1040.598) (-1050.802) * [-1046.219] (-1044.281) (-1064.030) (-1054.504) -- 0:02:35
527000 -- (-1044.376) [-1040.436] (-1051.278) (-1043.616) * (-1056.980) (-1057.037) [-1039.414] (-1044.385) -- 0:02:36
527500 -- (-1048.662) (-1040.709) (-1050.218) [-1041.473] * (-1044.576) (-1047.208) [-1042.105] (-1042.821) -- 0:02:35
528000 -- [-1048.435] (-1035.471) (-1044.801) (-1042.661) * [-1043.892] (-1050.853) (-1038.070) (-1049.400) -- 0:02:35
528500 -- [-1040.562] (-1046.376) (-1058.123) (-1046.316) * (-1049.828) (-1048.704) [-1034.269] (-1049.832) -- 0:02:35
529000 -- (-1044.814) (-1038.460) (-1057.677) [-1034.963] * (-1048.364) [-1039.130] (-1033.035) (-1062.603) -- 0:02:34
529500 -- (-1046.297) (-1045.284) (-1047.680) [-1035.590] * (-1044.395) [-1043.112] (-1046.885) (-1047.116) -- 0:02:34
530000 -- (-1047.749) (-1043.730) (-1049.585) [-1037.691] * [-1036.594] (-1035.987) (-1044.121) (-1042.256) -- 0:02:35
Average standard deviation of split frequencies: 0.010797
530500 -- (-1046.589) [-1037.228] (-1059.647) (-1057.440) * [-1042.494] (-1039.933) (-1040.745) (-1046.697) -- 0:02:34
531000 -- [-1047.038] (-1042.311) (-1051.781) (-1036.958) * (-1040.491) (-1051.323) [-1039.256] (-1057.286) -- 0:02:34
531500 -- [-1042.959] (-1041.005) (-1040.114) (-1035.916) * (-1056.137) [-1044.052] (-1045.686) (-1044.318) -- 0:02:34
532000 -- (-1041.832) [-1040.511] (-1057.229) (-1044.671) * (-1042.439) (-1042.664) [-1048.224] (-1038.768) -- 0:02:33
532500 -- (-1041.528) (-1046.477) (-1038.155) [-1041.010] * [-1041.864] (-1045.938) (-1040.793) (-1037.340) -- 0:02:33
533000 -- (-1045.261) [-1047.234] (-1045.520) (-1039.202) * (-1038.150) [-1035.643] (-1049.737) (-1034.636) -- 0:02:33
533500 -- (-1049.386) (-1059.274) (-1037.039) [-1039.327] * (-1046.706) (-1041.211) (-1038.228) [-1040.019] -- 0:02:33
534000 -- (-1054.606) (-1063.554) [-1045.726] (-1043.422) * [-1040.976] (-1053.133) (-1051.136) (-1051.452) -- 0:02:33
534500 -- (-1039.621) (-1070.787) (-1045.261) [-1041.800] * [-1038.542] (-1060.777) (-1045.239) (-1045.822) -- 0:02:33
535000 -- (-1043.273) (-1062.443) [-1042.009] (-1038.187) * [-1034.349] (-1044.930) (-1043.976) (-1054.756) -- 0:02:32
Average standard deviation of split frequencies: 0.010960
535500 -- (-1036.933) (-1045.684) [-1035.021] (-1038.838) * (-1043.490) (-1053.306) (-1043.129) [-1042.945] -- 0:02:32
536000 -- (-1054.353) (-1050.738) [-1038.068] (-1049.387) * (-1041.903) (-1052.457) [-1037.556] (-1046.929) -- 0:02:32
536500 -- (-1043.677) (-1043.669) (-1045.140) [-1048.636] * (-1048.703) (-1045.838) [-1038.041] (-1048.615) -- 0:02:32
537000 -- [-1043.972] (-1051.748) (-1041.787) (-1044.208) * (-1051.535) (-1052.066) [-1044.777] (-1046.856) -- 0:02:32
537500 -- (-1043.492) (-1054.395) [-1037.241] (-1051.161) * (-1041.066) [-1047.059] (-1045.923) (-1056.091) -- 0:02:32
538000 -- (-1043.617) (-1040.828) [-1039.292] (-1054.780) * (-1059.763) (-1051.334) [-1039.103] (-1059.049) -- 0:02:31
538500 -- (-1054.248) (-1058.833) [-1031.998] (-1050.679) * (-1038.429) (-1055.740) (-1042.878) [-1045.122] -- 0:02:31
539000 -- [-1042.151] (-1051.741) (-1039.582) (-1043.106) * [-1039.868] (-1060.026) (-1042.304) (-1043.773) -- 0:02:31
539500 -- (-1048.095) (-1046.296) [-1044.724] (-1046.642) * (-1037.530) (-1040.561) (-1052.277) [-1036.834] -- 0:02:31
540000 -- (-1046.196) [-1033.677] (-1047.119) (-1046.729) * (-1044.203) [-1041.142] (-1046.865) (-1049.550) -- 0:02:31
Average standard deviation of split frequencies: 0.011402
540500 -- (-1055.959) [-1043.980] (-1056.033) (-1043.591) * (-1056.334) [-1041.094] (-1049.000) (-1044.907) -- 0:02:31
541000 -- (-1040.304) (-1046.401) [-1038.247] (-1051.594) * [-1044.057] (-1047.965) (-1044.541) (-1047.873) -- 0:02:31
541500 -- [-1043.936] (-1045.301) (-1044.540) (-1046.816) * (-1059.874) (-1053.205) [-1041.636] (-1067.358) -- 0:02:30
542000 -- (-1056.546) (-1044.445) (-1038.448) [-1034.931] * (-1049.532) (-1045.803) [-1041.416] (-1050.284) -- 0:02:30
542500 -- (-1049.522) (-1048.735) [-1050.779] (-1050.823) * (-1063.512) [-1050.677] (-1055.131) (-1043.526) -- 0:02:30
543000 -- (-1058.494) (-1040.105) [-1036.049] (-1045.939) * (-1044.205) (-1052.063) [-1043.237] (-1052.251) -- 0:02:30
543500 -- (-1050.396) (-1047.721) [-1045.376] (-1058.080) * (-1043.183) [-1044.947] (-1056.237) (-1040.507) -- 0:02:30
544000 -- (-1047.629) [-1040.121] (-1044.895) (-1044.614) * [-1046.723] (-1040.857) (-1044.816) (-1036.976) -- 0:02:30
544500 -- [-1043.531] (-1035.682) (-1044.676) (-1064.143) * (-1040.523) [-1041.614] (-1044.721) (-1036.783) -- 0:02:29
545000 -- (-1036.380) (-1045.400) [-1053.851] (-1047.297) * (-1043.581) (-1053.778) [-1040.309] (-1051.058) -- 0:02:29
Average standard deviation of split frequencies: 0.010825
545500 -- [-1044.807] (-1040.776) (-1044.652) (-1046.672) * (-1048.311) [-1045.017] (-1046.022) (-1043.230) -- 0:02:29
546000 -- (-1047.094) (-1051.050) (-1061.098) [-1041.294] * (-1039.077) (-1045.617) (-1044.758) [-1039.629] -- 0:02:29
546500 -- (-1043.042) (-1049.398) (-1061.796) [-1037.751] * (-1040.058) (-1046.872) (-1046.986) [-1041.140] -- 0:02:29
547000 -- [-1041.054] (-1046.879) (-1038.780) (-1048.141) * [-1032.935] (-1050.588) (-1044.336) (-1033.418) -- 0:02:29
547500 -- (-1037.781) [-1046.233] (-1049.617) (-1046.068) * (-1051.260) [-1048.330] (-1043.977) (-1041.696) -- 0:02:28
548000 -- (-1038.490) [-1041.524] (-1044.958) (-1039.926) * (-1038.042) (-1044.388) [-1040.365] (-1045.757) -- 0:02:28
548500 -- [-1038.228] (-1047.167) (-1046.405) (-1040.222) * (-1044.511) [-1043.052] (-1040.066) (-1071.963) -- 0:02:28
549000 -- (-1044.071) (-1040.681) (-1039.527) [-1046.085] * (-1033.231) (-1042.003) [-1038.913] (-1056.419) -- 0:02:28
549500 -- (-1046.180) [-1038.856] (-1050.456) (-1046.881) * [-1035.533] (-1043.771) (-1051.229) (-1049.990) -- 0:02:28
550000 -- [-1041.846] (-1037.075) (-1050.275) (-1053.347) * [-1035.771] (-1047.621) (-1044.119) (-1054.729) -- 0:02:28
Average standard deviation of split frequencies: 0.009746
550500 -- (-1041.169) (-1041.614) [-1043.664] (-1043.118) * (-1043.497) [-1043.710] (-1048.002) (-1048.774) -- 0:02:27
551000 -- (-1046.550) (-1052.945) (-1035.914) [-1041.010] * (-1047.422) [-1040.935] (-1040.090) (-1043.015) -- 0:02:27
551500 -- (-1045.735) (-1050.976) [-1042.970] (-1035.638) * (-1043.646) (-1050.608) (-1046.974) [-1040.824] -- 0:02:27
552000 -- (-1046.685) (-1042.498) (-1042.246) [-1034.939] * (-1056.211) (-1043.659) [-1041.631] (-1047.098) -- 0:02:27
552500 -- (-1045.525) [-1039.239] (-1046.274) (-1044.536) * (-1063.501) [-1043.770] (-1045.790) (-1052.625) -- 0:02:27
553000 -- [-1033.004] (-1050.230) (-1049.468) (-1046.131) * (-1047.719) [-1034.277] (-1043.746) (-1054.417) -- 0:02:27
553500 -- [-1032.022] (-1051.506) (-1044.123) (-1051.054) * (-1037.777) [-1036.673] (-1052.080) (-1039.244) -- 0:02:26
554000 -- (-1035.383) (-1043.652) [-1041.499] (-1054.016) * (-1043.410) (-1052.380) (-1042.386) [-1037.366] -- 0:02:26
554500 -- (-1044.269) (-1046.541) [-1035.085] (-1048.345) * [-1046.861] (-1048.345) (-1053.842) (-1043.415) -- 0:02:26
555000 -- (-1040.860) (-1040.931) [-1042.537] (-1053.526) * (-1051.489) (-1043.257) [-1044.087] (-1049.575) -- 0:02:26
Average standard deviation of split frequencies: 0.009848
555500 -- [-1033.323] (-1038.436) (-1036.273) (-1036.677) * (-1040.286) [-1042.016] (-1034.662) (-1056.709) -- 0:02:26
556000 -- (-1039.727) (-1049.035) [-1040.270] (-1043.573) * (-1047.818) (-1038.484) (-1040.700) [-1039.120] -- 0:02:26
556500 -- (-1053.790) (-1045.150) (-1043.059) [-1036.157] * [-1034.302] (-1043.898) (-1037.173) (-1052.648) -- 0:02:25
557000 -- [-1039.222] (-1039.237) (-1038.012) (-1048.500) * (-1041.821) [-1038.880] (-1056.455) (-1037.694) -- 0:02:25
557500 -- (-1057.009) (-1057.153) (-1045.531) [-1041.653] * [-1040.264] (-1050.260) (-1041.556) (-1057.045) -- 0:02:25
558000 -- [-1042.871] (-1053.828) (-1043.142) (-1040.829) * (-1051.085) (-1052.334) (-1043.977) [-1042.898] -- 0:02:25
558500 -- [-1045.311] (-1046.334) (-1049.644) (-1041.929) * (-1065.340) [-1044.249] (-1039.813) (-1051.654) -- 0:02:25
559000 -- (-1063.425) [-1036.340] (-1042.549) (-1046.601) * (-1042.235) [-1047.362] (-1048.064) (-1046.316) -- 0:02:25
559500 -- (-1061.024) [-1036.896] (-1042.650) (-1045.184) * (-1051.541) (-1046.376) (-1052.512) [-1046.478] -- 0:02:24
560000 -- (-1055.709) (-1050.373) (-1033.009) [-1039.543] * (-1054.405) (-1044.863) [-1048.862] (-1043.673) -- 0:02:24
Average standard deviation of split frequencies: 0.010478
560500 -- (-1050.088) (-1038.065) [-1041.877] (-1046.948) * (-1049.335) (-1045.356) (-1044.560) [-1042.591] -- 0:02:24
561000 -- (-1045.418) [-1043.535] (-1036.311) (-1033.839) * (-1049.515) [-1046.725] (-1055.271) (-1047.251) -- 0:02:24
561500 -- [-1037.245] (-1045.730) (-1035.489) (-1039.030) * [-1039.959] (-1054.245) (-1051.651) (-1043.158) -- 0:02:24
562000 -- (-1042.656) (-1044.163) [-1040.512] (-1055.874) * (-1056.328) (-1047.548) (-1045.506) [-1039.429] -- 0:02:24
562500 -- (-1045.943) (-1049.614) (-1054.957) [-1039.591] * [-1048.248] (-1050.196) (-1051.381) (-1043.056) -- 0:02:23
563000 -- [-1037.357] (-1052.234) (-1064.315) (-1042.520) * (-1042.027) (-1042.877) (-1036.026) [-1040.648] -- 0:02:23
563500 -- (-1048.217) (-1042.868) [-1040.026] (-1039.911) * [-1037.595] (-1043.064) (-1043.742) (-1042.130) -- 0:02:23
564000 -- [-1032.526] (-1044.682) (-1041.147) (-1042.240) * (-1041.178) (-1051.056) [-1043.709] (-1043.637) -- 0:02:23
564500 -- [-1037.213] (-1049.591) (-1039.341) (-1037.512) * [-1038.531] (-1052.666) (-1046.826) (-1053.128) -- 0:02:23
565000 -- (-1044.484) (-1043.907) [-1039.870] (-1047.868) * (-1046.381) (-1045.733) [-1039.254] (-1044.664) -- 0:02:23
Average standard deviation of split frequencies: 0.010123
565500 -- (-1050.126) [-1038.111] (-1057.985) (-1041.937) * [-1039.872] (-1045.080) (-1053.485) (-1043.668) -- 0:02:22
566000 -- (-1047.821) [-1038.500] (-1055.142) (-1041.125) * (-1057.130) [-1044.888] (-1053.231) (-1055.630) -- 0:02:22
566500 -- (-1037.458) (-1052.148) [-1035.257] (-1036.925) * (-1050.599) [-1033.900] (-1045.088) (-1049.409) -- 0:02:22
567000 -- (-1036.724) (-1043.609) (-1043.910) [-1038.996] * (-1048.570) [-1037.999] (-1052.479) (-1037.770) -- 0:02:22
567500 -- (-1040.652) (-1048.811) (-1050.013) [-1044.561] * (-1038.636) (-1040.004) [-1038.753] (-1037.832) -- 0:02:22
568000 -- (-1039.647) (-1055.385) [-1045.405] (-1038.015) * (-1039.512) (-1045.533) (-1045.850) [-1033.089] -- 0:02:22
568500 -- (-1043.114) (-1047.214) (-1046.299) [-1041.154] * [-1049.710] (-1064.115) (-1048.313) (-1037.244) -- 0:02:21
569000 -- (-1043.107) (-1053.610) (-1052.412) [-1044.377] * (-1054.856) [-1037.807] (-1039.248) (-1043.540) -- 0:02:21
569500 -- [-1041.566] (-1054.917) (-1046.259) (-1051.546) * (-1044.200) [-1033.395] (-1041.441) (-1043.636) -- 0:02:21
570000 -- (-1044.622) [-1045.614] (-1039.312) (-1049.524) * (-1042.563) (-1039.974) [-1051.568] (-1052.426) -- 0:02:21
Average standard deviation of split frequencies: 0.010294
570500 -- (-1040.425) (-1049.024) (-1042.508) [-1042.501] * (-1039.298) [-1038.184] (-1035.806) (-1041.813) -- 0:02:21
571000 -- (-1040.704) [-1040.337] (-1054.184) (-1051.940) * (-1052.152) (-1041.823) [-1038.060] (-1042.975) -- 0:02:21
571500 -- [-1039.873] (-1036.521) (-1042.283) (-1051.405) * [-1047.160] (-1043.994) (-1054.056) (-1042.495) -- 0:02:20
572000 -- (-1058.693) (-1034.911) (-1038.726) [-1038.960] * [-1042.272] (-1041.470) (-1049.227) (-1052.423) -- 0:02:20
572500 -- (-1048.480) (-1032.611) [-1050.986] (-1050.199) * (-1046.014) (-1037.803) (-1044.761) [-1039.452] -- 0:02:20
573000 -- (-1047.387) (-1049.505) (-1051.351) [-1034.870] * (-1065.291) (-1061.114) [-1040.903] (-1052.636) -- 0:02:20
573500 -- (-1043.757) (-1039.185) (-1046.661) [-1045.117] * [-1043.896] (-1044.094) (-1051.358) (-1040.529) -- 0:02:20
574000 -- (-1059.551) [-1036.425] (-1042.117) (-1048.960) * (-1048.738) (-1048.233) (-1048.348) [-1040.540] -- 0:02:20
574500 -- (-1051.292) (-1040.383) [-1046.986] (-1045.398) * [-1045.230] (-1044.489) (-1043.441) (-1041.206) -- 0:02:19
575000 -- (-1054.225) [-1040.685] (-1051.540) (-1050.896) * (-1054.429) [-1041.989] (-1036.641) (-1044.580) -- 0:02:19
Average standard deviation of split frequencies: 0.010765
575500 -- (-1052.811) [-1037.606] (-1052.141) (-1042.173) * (-1058.634) [-1035.047] (-1033.472) (-1038.287) -- 0:02:19
576000 -- (-1044.624) [-1036.533] (-1047.547) (-1048.740) * [-1053.288] (-1041.974) (-1037.476) (-1053.318) -- 0:02:19
576500 -- [-1047.458] (-1051.642) (-1048.539) (-1046.649) * (-1053.019) [-1036.325] (-1043.391) (-1045.994) -- 0:02:19
577000 -- (-1046.680) (-1046.579) [-1047.738] (-1041.723) * [-1039.524] (-1042.272) (-1053.521) (-1043.737) -- 0:02:19
577500 -- (-1045.239) (-1057.069) (-1058.679) [-1037.242] * (-1040.493) [-1037.907] (-1047.068) (-1046.371) -- 0:02:19
578000 -- [-1035.786] (-1044.255) (-1058.827) (-1050.673) * (-1037.512) (-1037.064) (-1041.552) [-1047.300] -- 0:02:18
578500 -- (-1036.547) (-1043.677) (-1052.575) [-1046.346] * [-1045.735] (-1033.018) (-1045.165) (-1046.589) -- 0:02:18
579000 -- (-1044.497) [-1039.969] (-1039.522) (-1056.869) * (-1045.009) (-1047.246) [-1038.970] (-1049.001) -- 0:02:18
579500 -- (-1044.704) (-1039.980) [-1041.485] (-1035.556) * (-1043.273) [-1039.611] (-1061.378) (-1037.955) -- 0:02:18
580000 -- (-1039.417) [-1034.388] (-1045.896) (-1047.497) * [-1042.060] (-1046.577) (-1054.967) (-1033.224) -- 0:02:18
Average standard deviation of split frequencies: 0.010804
580500 -- (-1050.065) [-1036.663] (-1050.283) (-1049.944) * [-1040.194] (-1040.017) (-1041.919) (-1040.585) -- 0:02:18
581000 -- [-1039.063] (-1049.910) (-1044.805) (-1044.798) * (-1047.867) (-1039.787) [-1039.249] (-1036.339) -- 0:02:17
581500 -- (-1050.411) [-1043.234] (-1040.755) (-1048.493) * [-1037.651] (-1046.046) (-1042.230) (-1043.125) -- 0:02:17
582000 -- [-1043.994] (-1042.962) (-1044.687) (-1044.782) * (-1039.761) [-1046.215] (-1039.889) (-1052.668) -- 0:02:17
582500 -- (-1048.223) [-1047.532] (-1044.312) (-1043.003) * [-1042.675] (-1040.087) (-1047.724) (-1050.402) -- 0:02:17
583000 -- [-1039.454] (-1045.885) (-1041.233) (-1046.138) * (-1049.067) (-1040.919) [-1042.364] (-1041.657) -- 0:02:17
583500 -- [-1036.495] (-1057.388) (-1058.551) (-1041.470) * (-1042.992) [-1035.292] (-1048.184) (-1038.043) -- 0:02:17
584000 -- (-1044.896) [-1035.141] (-1040.414) (-1038.915) * (-1046.000) (-1039.650) (-1044.319) [-1042.385] -- 0:02:16
584500 -- (-1045.697) (-1053.597) [-1043.984] (-1042.156) * [-1045.090] (-1049.923) (-1044.853) (-1046.381) -- 0:02:16
585000 -- (-1043.079) (-1041.933) (-1052.347) [-1033.788] * (-1039.249) (-1051.026) [-1050.603] (-1043.337) -- 0:02:16
Average standard deviation of split frequencies: 0.010953
585500 -- (-1055.656) (-1041.780) [-1040.421] (-1044.848) * (-1043.527) (-1043.741) [-1045.917] (-1039.164) -- 0:02:16
586000 -- (-1053.588) [-1045.807] (-1045.031) (-1035.155) * (-1046.084) (-1035.492) [-1035.620] (-1049.198) -- 0:02:16
586500 -- (-1061.731) (-1041.670) (-1058.874) [-1040.001] * [-1043.430] (-1053.464) (-1047.586) (-1038.532) -- 0:02:16
587000 -- (-1039.306) (-1043.132) [-1038.525] (-1050.709) * (-1039.859) [-1040.555] (-1038.839) (-1047.914) -- 0:02:15
587500 -- (-1045.935) [-1041.822] (-1038.741) (-1049.123) * (-1051.343) (-1044.427) [-1037.342] (-1048.748) -- 0:02:15
588000 -- (-1054.245) (-1055.834) [-1034.580] (-1038.625) * (-1043.272) (-1045.971) (-1050.049) [-1054.144] -- 0:02:15
588500 -- (-1046.701) (-1048.355) [-1040.012] (-1049.630) * (-1052.270) (-1044.878) (-1041.916) [-1047.353] -- 0:02:15
589000 -- [-1042.215] (-1060.436) (-1035.889) (-1044.711) * (-1032.318) (-1046.436) [-1045.552] (-1037.153) -- 0:02:15
589500 -- (-1052.633) [-1034.438] (-1055.665) (-1043.401) * [-1040.735] (-1054.277) (-1042.203) (-1047.804) -- 0:02:15
590000 -- (-1042.480) [-1038.284] (-1050.526) (-1038.856) * (-1039.055) [-1046.599] (-1040.162) (-1044.920) -- 0:02:14
Average standard deviation of split frequencies: 0.010744
590500 -- (-1044.536) [-1043.282] (-1047.421) (-1048.888) * [-1050.476] (-1057.189) (-1048.823) (-1039.347) -- 0:02:14
591000 -- (-1047.245) (-1037.516) (-1049.886) [-1046.615] * (-1053.759) [-1044.663] (-1048.102) (-1050.865) -- 0:02:14
591500 -- (-1038.117) (-1052.689) (-1045.328) [-1038.965] * (-1043.181) [-1038.852] (-1049.401) (-1057.021) -- 0:02:14
592000 -- (-1049.505) (-1053.313) [-1049.966] (-1042.691) * (-1048.773) [-1049.093] (-1041.027) (-1057.623) -- 0:02:14
592500 -- (-1048.369) [-1039.652] (-1046.464) (-1060.099) * (-1039.550) (-1050.885) [-1034.910] (-1049.892) -- 0:02:14
593000 -- (-1047.801) [-1039.092] (-1046.952) (-1047.316) * (-1043.964) (-1049.268) (-1061.419) [-1049.958] -- 0:02:13
593500 -- (-1044.073) [-1035.098] (-1041.379) (-1037.337) * [-1043.183] (-1045.069) (-1038.182) (-1049.814) -- 0:02:13
594000 -- (-1037.974) [-1037.472] (-1050.583) (-1046.420) * (-1045.027) (-1045.274) [-1039.702] (-1047.106) -- 0:02:13
594500 -- (-1046.647) [-1037.752] (-1049.446) (-1053.505) * (-1048.492) (-1048.711) [-1037.339] (-1038.485) -- 0:02:13
595000 -- (-1050.792) (-1041.828) (-1042.390) [-1040.809] * (-1037.125) (-1035.551) [-1044.526] (-1043.949) -- 0:02:13
Average standard deviation of split frequencies: 0.010404
595500 -- [-1049.081] (-1039.932) (-1060.784) (-1037.835) * [-1039.904] (-1049.140) (-1057.312) (-1048.164) -- 0:02:13
596000 -- (-1047.266) (-1034.471) (-1053.125) [-1048.791] * [-1035.983] (-1046.984) (-1050.701) (-1047.366) -- 0:02:12
596500 -- (-1053.778) [-1038.494] (-1044.651) (-1053.124) * (-1042.019) [-1041.024] (-1051.242) (-1049.806) -- 0:02:12
597000 -- (-1041.628) [-1043.493] (-1050.013) (-1055.301) * (-1042.808) [-1041.546] (-1052.065) (-1035.609) -- 0:02:12
597500 -- (-1044.210) (-1039.727) (-1054.427) [-1044.092] * (-1047.583) [-1037.744] (-1059.913) (-1053.259) -- 0:02:12
598000 -- (-1041.115) (-1045.633) [-1043.600] (-1039.202) * (-1045.416) (-1047.411) (-1046.920) [-1040.687] -- 0:02:12
598500 -- (-1044.201) [-1039.909] (-1048.423) (-1043.321) * [-1044.343] (-1048.286) (-1046.151) (-1048.476) -- 0:02:12
599000 -- (-1047.102) (-1047.212) [-1036.754] (-1045.668) * (-1045.159) (-1056.081) (-1052.889) [-1035.945] -- 0:02:11
599500 -- (-1067.075) (-1055.946) [-1041.929] (-1060.170) * [-1043.653] (-1050.426) (-1052.051) (-1051.705) -- 0:02:11
600000 -- (-1059.158) [-1046.786] (-1044.809) (-1047.058) * (-1043.238) (-1046.427) [-1041.830] (-1042.530) -- 0:02:11
Average standard deviation of split frequencies: 0.009901
600500 -- (-1047.728) (-1046.319) [-1047.340] (-1043.307) * (-1041.239) (-1059.385) (-1039.662) [-1045.913] -- 0:02:11
601000 -- (-1043.797) (-1039.018) [-1046.217] (-1046.443) * [-1036.394] (-1050.064) (-1053.981) (-1051.145) -- 0:02:11
601500 -- (-1045.858) (-1037.958) (-1044.280) [-1033.766] * (-1052.246) [-1049.579] (-1055.615) (-1051.785) -- 0:02:11
602000 -- (-1050.073) (-1047.343) (-1047.104) [-1042.840] * [-1041.490] (-1046.551) (-1041.363) (-1046.645) -- 0:02:10
602500 -- (-1051.244) [-1041.790] (-1066.977) (-1036.055) * (-1033.632) (-1045.578) (-1051.535) [-1050.082] -- 0:02:10
603000 -- (-1046.413) (-1034.188) (-1052.422) [-1035.577] * (-1035.280) (-1040.795) (-1042.745) [-1042.114] -- 0:02:10
603500 -- (-1047.579) [-1040.243] (-1045.429) (-1042.970) * (-1051.311) (-1046.121) [-1039.569] (-1047.171) -- 0:02:10
604000 -- [-1040.479] (-1049.384) (-1034.925) (-1047.283) * (-1046.210) (-1062.501) (-1043.950) [-1032.366] -- 0:02:10
604500 -- [-1034.580] (-1054.712) (-1045.708) (-1037.879) * (-1043.678) (-1050.861) [-1040.290] (-1041.075) -- 0:02:10
605000 -- (-1043.607) (-1051.161) [-1037.018] (-1049.768) * (-1046.461) [-1035.197] (-1057.352) (-1043.105) -- 0:02:09
Average standard deviation of split frequencies: 0.009933
605500 -- [-1041.016] (-1048.757) (-1034.612) (-1037.652) * (-1045.453) [-1037.867] (-1039.800) (-1043.326) -- 0:02:09
606000 -- (-1037.175) (-1045.095) [-1043.617] (-1041.542) * (-1045.874) (-1040.933) (-1048.615) [-1047.840] -- 0:02:09
606500 -- [-1039.986] (-1051.100) (-1035.017) (-1040.047) * (-1043.403) [-1049.927] (-1042.334) (-1048.275) -- 0:02:09
607000 -- (-1041.954) (-1058.518) (-1048.961) [-1048.469] * (-1038.843) (-1045.066) [-1038.298] (-1045.637) -- 0:02:09
607500 -- (-1044.438) (-1055.842) (-1041.861) [-1036.255] * (-1045.231) (-1039.515) (-1039.458) [-1044.642] -- 0:02:09
608000 -- (-1041.214) (-1042.697) (-1042.227) [-1046.168] * (-1047.939) [-1036.102] (-1043.843) (-1060.313) -- 0:02:08
608500 -- (-1045.788) (-1057.854) [-1042.289] (-1052.139) * (-1036.707) [-1041.525] (-1036.899) (-1051.753) -- 0:02:08
609000 -- (-1045.599) (-1058.263) (-1039.119) [-1044.160] * (-1042.242) (-1042.192) (-1039.097) [-1043.839] -- 0:02:08
609500 -- (-1037.609) (-1043.884) (-1042.517) [-1046.742] * (-1048.816) (-1054.312) [-1035.933] (-1041.756) -- 0:02:08
610000 -- [-1037.011] (-1039.545) (-1047.696) (-1037.556) * (-1050.996) [-1035.170] (-1042.146) (-1048.058) -- 0:02:08
Average standard deviation of split frequencies: 0.010392
610500 -- [-1040.856] (-1041.493) (-1038.905) (-1046.678) * [-1047.536] (-1054.033) (-1035.518) (-1058.414) -- 0:02:08
611000 -- (-1048.045) [-1036.909] (-1037.520) (-1046.444) * (-1051.198) (-1052.541) [-1039.954] (-1044.147) -- 0:02:07
611500 -- (-1033.873) [-1046.845] (-1050.069) (-1051.833) * (-1045.228) (-1041.622) (-1044.180) [-1048.523] -- 0:02:07
612000 -- (-1050.944) [-1039.919] (-1053.824) (-1042.993) * (-1043.797) [-1041.920] (-1049.185) (-1042.209) -- 0:02:07
612500 -- (-1047.800) (-1050.701) (-1040.797) [-1043.631] * (-1040.941) (-1059.747) [-1037.385] (-1041.945) -- 0:02:07
613000 -- (-1040.487) (-1041.255) (-1044.982) [-1041.945] * (-1046.296) (-1052.924) (-1042.930) [-1051.019] -- 0:02:07
613500 -- (-1046.511) [-1042.649] (-1042.908) (-1046.414) * (-1057.594) (-1046.672) (-1041.485) [-1034.089] -- 0:02:07
614000 -- (-1048.002) [-1042.022] (-1045.865) (-1036.108) * (-1051.913) [-1053.419] (-1041.237) (-1046.821) -- 0:02:06
614500 -- (-1045.998) (-1047.701) (-1048.454) [-1045.675] * (-1061.327) (-1054.517) (-1045.883) [-1038.981] -- 0:02:06
615000 -- [-1038.675] (-1041.531) (-1050.814) (-1052.609) * (-1045.052) (-1060.730) (-1050.052) [-1035.376] -- 0:02:06
Average standard deviation of split frequencies: 0.010655
615500 -- [-1041.639] (-1036.829) (-1034.924) (-1050.404) * (-1038.398) [-1044.708] (-1039.592) (-1040.904) -- 0:02:06
616000 -- [-1040.496] (-1042.071) (-1043.992) (-1050.701) * [-1050.558] (-1053.975) (-1051.612) (-1042.325) -- 0:02:06
616500 -- (-1048.267) [-1043.143] (-1041.766) (-1042.073) * (-1050.014) [-1042.896] (-1059.351) (-1048.512) -- 0:02:06
617000 -- (-1049.144) (-1035.347) [-1044.361] (-1056.814) * (-1050.803) (-1041.526) (-1043.198) [-1042.179] -- 0:02:06
617500 -- (-1038.481) [-1037.693] (-1042.418) (-1036.527) * (-1056.115) (-1050.570) (-1047.704) [-1046.309] -- 0:02:05
618000 -- [-1044.831] (-1049.095) (-1044.852) (-1044.867) * [-1050.368] (-1042.605) (-1040.019) (-1053.872) -- 0:02:05
618500 -- (-1045.579) (-1045.899) [-1044.014] (-1043.582) * [-1044.773] (-1042.046) (-1054.206) (-1047.105) -- 0:02:05
619000 -- (-1043.567) (-1043.067) (-1035.688) [-1053.608] * (-1043.912) (-1039.481) (-1049.112) [-1039.989] -- 0:02:05
619500 -- (-1042.899) (-1039.916) (-1049.317) [-1032.608] * (-1048.329) (-1050.021) [-1040.357] (-1051.578) -- 0:02:05
620000 -- (-1048.050) [-1046.817] (-1057.319) (-1047.657) * [-1038.352] (-1051.006) (-1033.022) (-1047.089) -- 0:02:05
Average standard deviation of split frequencies: 0.009757
620500 -- [-1044.770] (-1038.838) (-1038.391) (-1052.118) * (-1058.377) (-1051.668) (-1033.941) [-1052.502] -- 0:02:04
621000 -- [-1035.694] (-1040.275) (-1051.662) (-1046.209) * (-1063.100) (-1046.737) [-1040.771] (-1048.198) -- 0:02:04
621500 -- (-1053.408) (-1044.344) [-1046.449] (-1054.440) * (-1041.403) [-1039.126] (-1071.710) (-1048.665) -- 0:02:04
622000 -- (-1051.896) (-1050.263) (-1043.459) [-1044.604] * (-1063.221) (-1041.899) [-1041.952] (-1050.334) -- 0:02:04
622500 -- (-1044.745) (-1042.789) (-1044.524) [-1041.444] * (-1049.430) (-1054.238) (-1044.689) [-1047.187] -- 0:02:04
623000 -- [-1048.089] (-1047.311) (-1042.297) (-1044.577) * [-1052.039] (-1040.168) (-1044.613) (-1044.870) -- 0:02:04
623500 -- (-1046.750) (-1053.406) [-1045.569] (-1052.848) * [-1042.673] (-1047.159) (-1042.736) (-1041.614) -- 0:02:03
624000 -- (-1044.209) (-1046.190) [-1042.638] (-1048.482) * [-1040.320] (-1048.279) (-1053.610) (-1043.241) -- 0:02:03
624500 -- (-1042.425) (-1043.126) (-1040.753) [-1046.402] * [-1047.149] (-1049.622) (-1044.700) (-1044.698) -- 0:02:03
625000 -- (-1035.504) (-1050.965) (-1052.585) [-1039.727] * [-1032.478] (-1042.775) (-1046.547) (-1038.997) -- 0:02:03
Average standard deviation of split frequencies: 0.009732
625500 -- (-1046.534) [-1046.735] (-1047.592) (-1053.913) * [-1046.360] (-1055.465) (-1047.774) (-1046.280) -- 0:02:03
626000 -- (-1058.283) [-1039.267] (-1048.706) (-1040.235) * (-1039.013) (-1054.399) [-1052.063] (-1041.963) -- 0:02:03
626500 -- (-1042.118) (-1037.397) [-1042.506] (-1046.273) * [-1044.183] (-1052.931) (-1056.572) (-1042.488) -- 0:02:02
627000 -- (-1054.848) (-1045.492) (-1044.166) [-1042.690] * [-1046.507] (-1042.157) (-1052.688) (-1047.771) -- 0:02:02
627500 -- (-1061.601) (-1031.463) [-1043.368] (-1043.431) * (-1043.261) (-1045.664) [-1045.012] (-1037.503) -- 0:02:02
628000 -- (-1047.449) (-1030.551) [-1037.173] (-1045.065) * (-1053.713) (-1043.726) (-1058.643) [-1046.164] -- 0:02:02
628500 -- (-1047.485) [-1046.430] (-1044.592) (-1036.121) * (-1046.763) (-1060.183) (-1054.901) [-1038.448] -- 0:02:02
629000 -- (-1041.369) (-1044.207) (-1051.725) [-1041.477] * (-1047.754) (-1046.646) (-1054.395) [-1042.555] -- 0:02:02
629500 -- (-1048.598) (-1040.723) (-1046.466) [-1039.774] * (-1051.909) (-1052.175) (-1047.325) [-1046.286] -- 0:02:01
630000 -- (-1063.162) (-1044.746) [-1045.986] (-1054.550) * (-1045.034) [-1040.164] (-1034.616) (-1050.323) -- 0:02:01
Average standard deviation of split frequencies: 0.009200
630500 -- (-1050.198) [-1039.970] (-1042.199) (-1056.086) * [-1046.880] (-1045.143) (-1056.446) (-1046.349) -- 0:02:01
631000 -- [-1055.484] (-1042.869) (-1044.458) (-1048.941) * (-1045.825) (-1042.936) [-1039.362] (-1067.262) -- 0:02:01
631500 -- (-1047.676) [-1040.747] (-1035.856) (-1050.502) * [-1033.237] (-1043.466) (-1050.082) (-1045.007) -- 0:02:01
632000 -- (-1041.234) (-1049.133) [-1036.243] (-1051.811) * (-1041.395) (-1052.317) [-1039.442] (-1038.701) -- 0:02:01
632500 -- [-1046.715] (-1041.137) (-1038.276) (-1055.059) * (-1046.535) [-1040.903] (-1031.397) (-1049.329) -- 0:02:00
633000 -- (-1039.978) [-1041.453] (-1041.467) (-1046.193) * (-1037.205) (-1052.527) [-1037.563] (-1040.917) -- 0:02:00
633500 -- [-1054.129] (-1045.993) (-1053.279) (-1048.242) * [-1043.034] (-1044.255) (-1053.502) (-1041.202) -- 0:02:00
634000 -- (-1047.422) (-1046.904) [-1040.845] (-1047.847) * (-1043.898) [-1049.623] (-1053.442) (-1041.137) -- 0:02:00
634500 -- (-1047.427) (-1047.053) (-1044.781) [-1030.300] * (-1043.253) (-1048.419) (-1052.236) [-1036.649] -- 0:02:00
635000 -- (-1045.557) (-1051.593) [-1041.145] (-1052.939) * (-1051.004) (-1052.371) (-1042.132) [-1040.981] -- 0:02:00
Average standard deviation of split frequencies: 0.009294
635500 -- (-1046.903) (-1039.520) [-1047.417] (-1041.037) * (-1038.577) (-1047.092) (-1036.969) [-1039.711] -- 0:01:59
636000 -- [-1038.154] (-1049.081) (-1035.704) (-1042.485) * (-1050.649) (-1064.416) (-1034.333) [-1034.525] -- 0:01:59
636500 -- (-1049.730) (-1054.951) (-1039.645) [-1037.905] * (-1050.415) [-1048.837] (-1040.253) (-1049.855) -- 0:01:59
637000 -- [-1047.065] (-1056.452) (-1050.798) (-1053.632) * (-1046.657) (-1045.154) (-1043.209) [-1043.521] -- 0:01:59
637500 -- (-1040.349) (-1045.687) [-1046.450] (-1040.192) * (-1049.848) (-1053.600) (-1043.631) [-1047.839] -- 0:01:59
638000 -- (-1036.172) [-1046.830] (-1036.567) (-1040.191) * [-1048.508] (-1050.289) (-1041.748) (-1036.567) -- 0:01:59
638500 -- [-1041.016] (-1064.366) (-1054.921) (-1037.814) * (-1037.967) (-1051.720) (-1043.590) [-1037.031] -- 0:01:58
639000 -- (-1046.554) (-1054.380) [-1038.051] (-1038.140) * (-1046.350) (-1040.457) [-1038.358] (-1042.188) -- 0:01:58
639500 -- [-1043.230] (-1043.865) (-1052.697) (-1050.125) * [-1041.580] (-1052.487) (-1044.720) (-1039.793) -- 0:01:58
640000 -- [-1044.920] (-1049.291) (-1043.288) (-1037.061) * (-1040.029) [-1038.325] (-1048.076) (-1038.732) -- 0:01:58
Average standard deviation of split frequencies: 0.009679
640500 -- (-1041.324) [-1046.903] (-1050.570) (-1049.533) * (-1047.753) (-1047.058) (-1044.615) [-1037.660] -- 0:01:58
641000 -- (-1041.479) (-1049.781) [-1036.935] (-1054.677) * (-1043.440) (-1042.432) (-1062.777) [-1037.058] -- 0:01:58
641500 -- (-1054.469) (-1053.982) (-1045.946) [-1046.739] * (-1048.840) (-1049.088) (-1040.849) [-1047.509] -- 0:01:57
642000 -- (-1044.082) (-1053.437) (-1044.909) [-1041.815] * [-1037.925] (-1044.031) (-1047.036) (-1049.638) -- 0:01:57
642500 -- (-1053.382) (-1056.640) (-1043.940) [-1037.852] * [-1042.370] (-1044.408) (-1054.515) (-1054.912) -- 0:01:57
643000 -- (-1041.725) (-1035.541) (-1046.045) [-1035.943] * (-1049.244) [-1041.875] (-1061.029) (-1043.584) -- 0:01:57
643500 -- (-1045.133) (-1042.900) [-1039.982] (-1040.933) * [-1043.100] (-1047.255) (-1054.297) (-1043.144) -- 0:01:57
644000 -- (-1050.315) [-1038.268] (-1032.918) (-1043.681) * (-1038.490) (-1053.010) (-1063.050) [-1037.637] -- 0:01:57
644500 -- (-1042.646) (-1040.471) (-1043.258) [-1051.132] * (-1038.988) (-1053.661) (-1062.086) [-1033.226] -- 0:01:56
645000 -- (-1043.162) (-1051.500) [-1046.813] (-1043.351) * (-1041.862) (-1054.173) (-1056.650) [-1041.269] -- 0:01:56
Average standard deviation of split frequencies: 0.009430
645500 -- (-1038.659) [-1040.200] (-1046.156) (-1045.429) * [-1033.351] (-1045.620) (-1054.194) (-1041.996) -- 0:01:56
646000 -- (-1051.588) (-1041.303) (-1046.361) [-1042.465] * [-1035.800] (-1059.481) (-1052.973) (-1046.326) -- 0:01:56
646500 -- (-1048.701) (-1038.608) (-1047.014) [-1045.524] * [-1035.976] (-1048.533) (-1044.140) (-1051.859) -- 0:01:56
647000 -- [-1039.385] (-1038.156) (-1041.217) (-1056.535) * (-1050.167) (-1048.447) [-1044.307] (-1039.128) -- 0:01:56
647500 -- (-1047.732) (-1049.431) [-1031.120] (-1054.938) * (-1039.204) [-1039.563] (-1050.802) (-1041.937) -- 0:01:55
648000 -- (-1035.517) [-1049.420] (-1039.599) (-1058.075) * (-1049.664) [-1039.119] (-1054.638) (-1035.525) -- 0:01:55
648500 -- (-1048.514) (-1046.775) [-1044.394] (-1040.100) * (-1047.027) (-1045.599) [-1040.872] (-1052.947) -- 0:01:55
649000 -- (-1046.880) (-1053.376) [-1049.256] (-1041.467) * (-1050.247) (-1039.970) [-1043.712] (-1050.586) -- 0:01:55
649500 -- (-1037.868) (-1060.084) (-1057.120) [-1038.494] * (-1064.630) (-1043.944) [-1036.219] (-1042.902) -- 0:01:55
650000 -- (-1050.934) (-1060.440) (-1064.244) [-1040.231] * (-1049.651) [-1041.425] (-1040.333) (-1054.828) -- 0:01:55
Average standard deviation of split frequencies: 0.009418
650500 -- [-1034.044] (-1055.412) (-1041.488) (-1056.105) * (-1045.347) (-1041.206) (-1042.765) [-1043.827] -- 0:01:54
651000 -- (-1034.602) (-1051.415) (-1053.715) [-1047.765] * (-1055.925) [-1041.191] (-1051.842) (-1055.743) -- 0:01:54
651500 -- (-1039.700) (-1041.473) [-1039.593] (-1051.943) * [-1042.293] (-1048.385) (-1039.875) (-1050.733) -- 0:01:54
652000 -- [-1035.624] (-1059.560) (-1046.796) (-1038.452) * (-1044.009) [-1043.079] (-1049.411) (-1044.575) -- 0:01:54
652500 -- (-1039.290) [-1045.320] (-1045.053) (-1046.302) * (-1051.036) (-1052.110) [-1044.573] (-1051.320) -- 0:01:54
653000 -- [-1031.878] (-1045.090) (-1054.921) (-1042.854) * (-1049.948) (-1040.950) (-1054.630) [-1044.132] -- 0:01:54
653500 -- [-1037.939] (-1037.636) (-1047.288) (-1055.401) * (-1055.324) (-1037.669) (-1045.999) [-1037.812] -- 0:01:53
654000 -- (-1037.875) [-1037.863] (-1052.280) (-1048.774) * [-1041.081] (-1053.053) (-1032.893) (-1045.302) -- 0:01:53
654500 -- [-1036.886] (-1042.793) (-1042.408) (-1044.214) * (-1043.367) (-1047.684) (-1038.585) [-1038.365] -- 0:01:53
655000 -- (-1040.370) (-1059.842) [-1038.151] (-1043.909) * (-1054.295) (-1046.085) (-1045.731) [-1037.804] -- 0:01:53
Average standard deviation of split frequencies: 0.009342
655500 -- (-1044.312) (-1051.361) [-1045.190] (-1044.827) * (-1043.096) (-1051.942) (-1055.050) [-1045.108] -- 0:01:53
656000 -- (-1047.692) (-1046.869) [-1040.170] (-1038.969) * (-1044.065) (-1048.097) (-1040.753) [-1043.848] -- 0:01:53
656500 -- (-1039.467) (-1043.502) [-1043.870] (-1047.108) * (-1039.551) (-1042.062) (-1045.553) [-1035.203] -- 0:01:53
657000 -- (-1042.475) (-1043.969) (-1053.493) [-1037.097] * (-1048.177) (-1052.250) (-1047.503) [-1043.335] -- 0:01:52
657500 -- (-1054.692) (-1053.700) [-1044.187] (-1044.132) * [-1053.174] (-1038.174) (-1051.572) (-1045.619) -- 0:01:52
658000 -- (-1054.084) (-1041.096) (-1043.111) [-1035.752] * (-1051.266) [-1043.661] (-1047.798) (-1042.068) -- 0:01:52
658500 -- [-1036.837] (-1044.286) (-1053.615) (-1034.658) * (-1052.566) (-1045.875) [-1040.560] (-1043.780) -- 0:01:52
659000 -- (-1043.457) (-1039.158) (-1048.220) [-1045.017] * (-1049.595) (-1038.483) (-1039.442) [-1040.100] -- 0:01:52
659500 -- [-1037.330] (-1041.404) (-1053.384) (-1053.363) * (-1059.298) (-1033.350) (-1044.703) [-1036.255] -- 0:01:52
660000 -- (-1049.630) [-1044.791] (-1046.013) (-1054.049) * (-1054.840) (-1037.334) (-1056.407) [-1037.403] -- 0:01:51
Average standard deviation of split frequencies: 0.008947
660500 -- (-1039.154) [-1040.439] (-1048.227) (-1037.698) * (-1037.213) [-1042.788] (-1044.508) (-1049.058) -- 0:01:51
661000 -- (-1045.001) (-1047.760) (-1052.729) [-1041.882] * (-1039.740) (-1037.044) (-1062.375) [-1043.962] -- 0:01:51
661500 -- [-1039.541] (-1033.743) (-1051.533) (-1049.877) * (-1048.194) (-1058.629) (-1048.070) [-1044.786] -- 0:01:51
662000 -- [-1033.837] (-1057.666) (-1045.587) (-1047.445) * (-1050.717) (-1044.478) (-1044.085) [-1035.315] -- 0:01:51
662500 -- (-1041.479) (-1042.200) [-1042.334] (-1043.761) * (-1043.044) (-1049.299) (-1058.932) [-1039.075] -- 0:01:51
663000 -- (-1043.272) (-1046.488) [-1041.819] (-1046.389) * [-1047.760] (-1045.989) (-1048.312) (-1038.987) -- 0:01:50
663500 -- [-1037.675] (-1044.655) (-1039.416) (-1051.997) * (-1033.766) (-1048.058) (-1048.127) [-1035.027] -- 0:01:50
664000 -- [-1039.224] (-1043.351) (-1046.605) (-1046.027) * (-1057.310) (-1055.384) (-1042.568) [-1034.899] -- 0:01:50
664500 -- (-1047.621) (-1055.230) [-1039.256] (-1032.438) * (-1047.219) [-1033.081] (-1049.660) (-1043.825) -- 0:01:50
665000 -- (-1048.159) (-1044.653) [-1039.156] (-1053.891) * (-1056.046) [-1044.668] (-1045.957) (-1049.123) -- 0:01:50
Average standard deviation of split frequencies: 0.008929
665500 -- (-1039.995) (-1044.288) (-1043.046) [-1036.306] * (-1048.544) (-1041.899) (-1050.705) [-1039.486] -- 0:01:50
666000 -- (-1044.172) (-1057.553) [-1040.439] (-1045.543) * [-1034.110] (-1054.885) (-1049.780) (-1038.924) -- 0:01:49
666500 -- (-1060.840) (-1042.079) [-1042.530] (-1055.560) * (-1036.763) (-1045.489) [-1035.172] (-1042.734) -- 0:01:49
667000 -- (-1061.000) (-1046.168) (-1051.241) [-1058.762] * (-1050.185) (-1055.533) [-1047.257] (-1055.965) -- 0:01:49
667500 -- (-1048.726) (-1049.071) [-1045.247] (-1039.696) * (-1041.329) (-1065.561) (-1041.674) [-1045.740] -- 0:01:49
668000 -- (-1050.895) (-1048.897) (-1047.902) [-1048.168] * (-1036.879) [-1065.442] (-1034.509) (-1052.703) -- 0:01:49
668500 -- (-1047.782) (-1043.138) (-1049.865) [-1038.698] * (-1036.256) (-1047.217) [-1040.246] (-1054.188) -- 0:01:49
669000 -- (-1054.263) (-1046.622) [-1041.884] (-1036.340) * (-1039.703) (-1050.864) [-1032.706] (-1067.327) -- 0:01:48
669500 -- (-1048.297) (-1038.998) (-1047.358) [-1034.039] * (-1042.144) (-1047.093) [-1030.795] (-1048.209) -- 0:01:48
670000 -- (-1053.604) (-1044.901) [-1040.780] (-1042.267) * (-1043.990) (-1047.220) [-1036.585] (-1044.821) -- 0:01:48
Average standard deviation of split frequencies: 0.008489
670500 -- (-1063.199) (-1048.044) [-1043.207] (-1045.473) * (-1049.424) (-1055.637) [-1037.248] (-1038.909) -- 0:01:48
671000 -- (-1038.877) (-1052.176) [-1037.300] (-1052.019) * [-1038.632] (-1052.558) (-1052.246) (-1051.143) -- 0:01:48
671500 -- (-1051.636) (-1042.206) [-1043.151] (-1053.574) * (-1036.894) (-1062.921) [-1038.474] (-1045.554) -- 0:01:48
672000 -- (-1055.212) (-1040.151) [-1050.907] (-1050.341) * (-1049.264) (-1048.913) [-1044.999] (-1049.025) -- 0:01:47
672500 -- (-1057.936) [-1040.677] (-1042.405) (-1040.630) * [-1038.045] (-1052.469) (-1046.139) (-1057.832) -- 0:01:47
673000 -- (-1042.404) [-1040.335] (-1042.283) (-1063.268) * (-1043.162) (-1039.755) [-1034.416] (-1054.009) -- 0:01:47
673500 -- (-1037.562) [-1038.624] (-1048.944) (-1062.520) * (-1048.109) [-1043.214] (-1042.080) (-1048.324) -- 0:01:47
674000 -- [-1038.514] (-1053.250) (-1044.140) (-1058.392) * (-1061.237) [-1043.842] (-1040.400) (-1056.043) -- 0:01:47
674500 -- (-1050.578) (-1044.279) (-1048.063) [-1050.743] * (-1056.606) (-1043.110) [-1041.362] (-1047.542) -- 0:01:47
675000 -- (-1045.581) [-1041.512] (-1044.491) (-1056.035) * (-1041.676) [-1040.754] (-1053.870) (-1041.710) -- 0:01:46
Average standard deviation of split frequencies: 0.008368
675500 -- (-1047.535) [-1042.842] (-1056.842) (-1055.925) * [-1037.204] (-1044.190) (-1048.207) (-1049.183) -- 0:01:46
676000 -- (-1044.476) (-1050.362) (-1047.984) [-1040.326] * [-1032.963] (-1043.841) (-1047.704) (-1046.413) -- 0:01:46
676500 -- (-1044.246) (-1043.850) (-1050.255) [-1043.581] * (-1037.951) (-1041.301) (-1045.324) [-1042.788] -- 0:01:46
677000 -- [-1038.299] (-1061.196) (-1042.977) (-1032.315) * (-1036.007) (-1052.638) [-1044.980] (-1044.415) -- 0:01:46
677500 -- (-1044.285) (-1055.251) (-1052.191) [-1038.646] * (-1051.020) (-1063.139) [-1040.134] (-1051.516) -- 0:01:46
678000 -- (-1042.604) (-1048.669) [-1040.610] (-1033.834) * (-1040.195) (-1047.257) (-1039.946) [-1035.589] -- 0:01:45
678500 -- (-1048.250) [-1050.413] (-1049.260) (-1041.449) * (-1048.411) [-1041.717] (-1033.017) (-1043.703) -- 0:01:45
679000 -- (-1043.442) [-1041.636] (-1041.139) (-1042.941) * (-1045.968) (-1056.729) [-1050.323] (-1047.253) -- 0:01:45
679500 -- (-1046.999) [-1040.873] (-1053.177) (-1052.872) * [-1041.519] (-1044.415) (-1042.270) (-1048.233) -- 0:01:45
680000 -- (-1047.977) (-1043.000) (-1040.125) [-1045.582] * [-1039.903] (-1047.254) (-1043.193) (-1055.124) -- 0:01:45
Average standard deviation of split frequencies: 0.007991
680500 -- (-1041.002) (-1050.270) (-1043.489) [-1040.157] * (-1046.760) [-1037.118] (-1043.869) (-1056.741) -- 0:01:45
681000 -- [-1043.412] (-1065.106) (-1045.065) (-1045.836) * (-1051.195) (-1062.205) (-1040.313) [-1036.938] -- 0:01:44
681500 -- [-1046.174] (-1039.059) (-1046.669) (-1048.994) * [-1044.893] (-1039.934) (-1046.358) (-1046.494) -- 0:01:44
682000 -- [-1047.416] (-1044.433) (-1041.267) (-1049.564) * (-1047.621) (-1051.506) (-1047.824) [-1041.302] -- 0:01:44
682500 -- (-1041.951) [-1039.602] (-1060.984) (-1046.387) * (-1041.004) [-1036.960] (-1046.461) (-1039.931) -- 0:01:44
683000 -- [-1047.190] (-1039.312) (-1078.853) (-1059.147) * [-1042.489] (-1047.501) (-1047.947) (-1052.108) -- 0:01:44
683500 -- [-1041.289] (-1033.936) (-1054.085) (-1050.785) * (-1048.674) (-1040.353) (-1061.728) [-1049.541] -- 0:01:44
684000 -- (-1042.483) [-1035.058] (-1046.614) (-1053.606) * (-1041.828) (-1050.330) (-1038.609) [-1041.390] -- 0:01:43
684500 -- (-1046.672) [-1043.216] (-1043.060) (-1043.427) * [-1043.809] (-1049.771) (-1042.106) (-1038.066) -- 0:01:43
685000 -- (-1054.207) (-1047.188) (-1040.469) [-1044.076] * (-1044.640) [-1038.340] (-1052.548) (-1043.546) -- 0:01:43
Average standard deviation of split frequencies: 0.007506
685500 -- (-1045.194) (-1061.437) (-1044.302) [-1043.309] * [-1041.899] (-1039.660) (-1052.060) (-1043.123) -- 0:01:43
686000 -- (-1043.610) [-1043.107] (-1055.320) (-1045.646) * [-1047.132] (-1039.873) (-1052.374) (-1045.190) -- 0:01:43
686500 -- (-1053.724) (-1043.277) (-1041.208) [-1053.550] * [-1035.580] (-1055.607) (-1036.634) (-1041.079) -- 0:01:43
687000 -- (-1052.129) (-1042.476) (-1045.766) [-1038.465] * [-1036.690] (-1049.713) (-1040.972) (-1053.598) -- 0:01:42
687500 -- (-1039.818) (-1047.803) [-1043.192] (-1051.271) * (-1032.663) [-1037.554] (-1044.721) (-1039.267) -- 0:01:42
688000 -- (-1048.435) (-1036.288) [-1043.092] (-1059.571) * (-1043.229) [-1037.591] (-1061.521) (-1040.607) -- 0:01:42
688500 -- (-1040.780) (-1045.511) [-1041.197] (-1055.677) * [-1044.045] (-1053.414) (-1044.253) (-1037.903) -- 0:01:42
689000 -- [-1044.414] (-1043.554) (-1051.472) (-1048.132) * (-1048.656) (-1043.641) (-1051.355) [-1036.020] -- 0:01:42
689500 -- (-1052.703) (-1037.273) (-1047.317) [-1034.995] * (-1049.576) [-1052.217] (-1036.577) (-1041.491) -- 0:01:42
690000 -- (-1047.192) [-1037.452] (-1038.019) (-1042.605) * [-1036.996] (-1042.052) (-1043.464) (-1052.834) -- 0:01:41
Average standard deviation of split frequencies: 0.007245
690500 -- (-1052.521) (-1039.903) [-1044.196] (-1050.396) * (-1044.816) (-1045.463) (-1040.693) [-1036.100] -- 0:01:41
691000 -- (-1046.470) [-1043.066] (-1044.995) (-1044.083) * (-1051.506) (-1044.878) [-1040.482] (-1049.939) -- 0:01:41
691500 -- (-1048.841) (-1048.986) [-1039.487] (-1053.684) * (-1056.179) (-1040.063) (-1042.041) [-1040.509] -- 0:01:41
692000 -- (-1045.719) [-1044.834] (-1042.882) (-1044.137) * [-1040.400] (-1039.261) (-1061.544) (-1045.089) -- 0:01:41
692500 -- (-1043.357) (-1041.984) (-1044.652) [-1035.135] * (-1043.677) [-1034.617] (-1054.314) (-1054.836) -- 0:01:41
693000 -- (-1048.703) (-1047.467) [-1050.111] (-1038.225) * (-1051.047) [-1040.197] (-1043.779) (-1039.736) -- 0:01:41
693500 -- (-1056.533) (-1045.259) (-1045.940) [-1036.537] * (-1043.116) (-1048.944) [-1035.427] (-1045.786) -- 0:01:40
694000 -- (-1051.094) [-1041.682] (-1041.925) (-1039.733) * (-1036.521) (-1046.090) (-1038.243) [-1036.786] -- 0:01:40
694500 -- (-1049.872) (-1044.711) (-1043.315) [-1036.121] * (-1068.682) (-1042.938) (-1037.247) [-1060.229] -- 0:01:40
695000 -- (-1048.430) [-1043.690] (-1040.230) (-1057.363) * (-1052.499) [-1040.471] (-1040.650) (-1040.979) -- 0:01:40
Average standard deviation of split frequencies: 0.007450
695500 -- (-1042.966) (-1051.896) (-1044.315) [-1039.897] * (-1048.397) (-1047.595) [-1036.448] (-1052.911) -- 0:01:40
696000 -- (-1056.443) (-1044.640) (-1038.447) [-1038.847] * (-1046.017) (-1043.690) [-1045.062] (-1044.110) -- 0:01:40
696500 -- (-1055.230) (-1056.276) [-1036.878] (-1045.373) * (-1039.890) (-1048.469) [-1039.386] (-1040.236) -- 0:01:39
697000 -- (-1055.904) (-1044.442) [-1036.319] (-1045.137) * (-1048.164) (-1059.781) [-1043.120] (-1035.462) -- 0:01:39
697500 -- (-1058.081) [-1040.002] (-1041.224) (-1038.722) * (-1045.320) (-1050.554) (-1044.373) [-1038.123] -- 0:01:39
698000 -- (-1038.460) (-1061.576) (-1040.579) [-1037.656] * (-1049.270) [-1044.221] (-1046.150) (-1046.957) -- 0:01:39
698500 -- [-1045.945] (-1040.656) (-1063.773) (-1059.574) * [-1044.265] (-1048.841) (-1044.417) (-1040.117) -- 0:01:39
699000 -- (-1041.931) [-1036.035] (-1040.563) (-1042.353) * (-1054.986) [-1037.493] (-1058.959) (-1051.921) -- 0:01:39
699500 -- (-1043.543) (-1042.362) [-1036.811] (-1048.601) * (-1040.845) (-1041.596) (-1040.013) [-1039.328] -- 0:01:38
700000 -- [-1039.075] (-1053.616) (-1049.907) (-1037.810) * (-1033.300) [-1040.793] (-1039.925) (-1041.078) -- 0:01:38
Average standard deviation of split frequencies: 0.008125
700500 -- (-1043.202) (-1037.764) (-1036.869) [-1038.427] * [-1043.449] (-1043.823) (-1042.757) (-1051.028) -- 0:01:38
701000 -- (-1051.158) [-1044.891] (-1042.247) (-1059.294) * (-1040.752) [-1054.756] (-1045.117) (-1047.623) -- 0:01:38
701500 -- [-1032.910] (-1048.508) (-1040.756) (-1045.802) * (-1034.316) [-1042.304] (-1047.654) (-1039.559) -- 0:01:38
702000 -- (-1040.952) (-1064.100) (-1038.209) [-1036.310] * [-1047.907] (-1037.300) (-1053.471) (-1055.634) -- 0:01:38
702500 -- [-1043.279] (-1049.278) (-1044.465) (-1040.762) * (-1043.477) [-1040.061] (-1036.798) (-1049.844) -- 0:01:37
703000 -- (-1041.804) (-1036.040) [-1044.445] (-1042.069) * (-1049.452) [-1041.189] (-1037.557) (-1052.678) -- 0:01:37
703500 -- (-1037.791) (-1050.828) [-1042.220] (-1048.661) * (-1051.453) (-1042.055) [-1043.913] (-1045.520) -- 0:01:37
704000 -- (-1036.443) (-1047.792) (-1047.640) [-1041.219] * (-1054.802) [-1040.290] (-1045.640) (-1043.753) -- 0:01:37
704500 -- [-1045.859] (-1047.309) (-1047.993) (-1044.293) * (-1050.218) [-1038.159] (-1040.684) (-1046.716) -- 0:01:37
705000 -- (-1037.576) (-1043.391) (-1046.580) [-1037.949] * [-1044.481] (-1040.297) (-1046.632) (-1045.508) -- 0:01:37
Average standard deviation of split frequencies: 0.007499
705500 -- (-1043.324) (-1043.620) (-1052.482) [-1042.522] * (-1045.464) (-1041.236) (-1047.580) [-1037.304] -- 0:01:36
706000 -- [-1037.344] (-1043.473) (-1052.669) (-1044.303) * [-1042.452] (-1045.342) (-1044.192) (-1039.985) -- 0:01:36
706500 -- (-1051.070) [-1038.162] (-1042.660) (-1051.789) * (-1045.962) (-1047.390) (-1044.083) [-1041.680] -- 0:01:36
707000 -- (-1045.671) (-1038.920) [-1038.734] (-1040.543) * (-1042.018) (-1046.383) (-1045.756) [-1037.880] -- 0:01:36
707500 -- (-1046.385) (-1035.409) (-1045.479) [-1045.079] * (-1058.422) (-1040.588) (-1050.414) [-1036.230] -- 0:01:36
708000 -- (-1050.160) (-1055.040) (-1057.170) [-1045.422] * [-1039.394] (-1044.935) (-1040.245) (-1034.505) -- 0:01:36
708500 -- (-1054.978) [-1044.476] (-1054.901) (-1039.210) * (-1041.992) (-1045.267) (-1043.234) [-1037.309] -- 0:01:35
709000 -- (-1058.889) [-1044.063] (-1048.159) (-1049.208) * (-1055.379) (-1051.451) (-1038.890) [-1035.772] -- 0:01:35
709500 -- (-1046.339) [-1046.659] (-1057.730) (-1043.597) * (-1044.460) [-1044.053] (-1044.130) (-1045.547) -- 0:01:35
710000 -- (-1044.615) [-1037.636] (-1046.189) (-1042.430) * (-1043.007) [-1046.521] (-1046.283) (-1053.449) -- 0:01:35
Average standard deviation of split frequencies: 0.007144
710500 -- (-1050.855) [-1037.022] (-1038.168) (-1046.711) * [-1036.516] (-1038.051) (-1045.764) (-1038.067) -- 0:01:35
711000 -- (-1056.023) [-1046.448] (-1038.463) (-1040.155) * (-1041.885) (-1042.400) (-1046.290) [-1046.377] -- 0:01:35
711500 -- (-1047.153) (-1043.364) [-1042.469] (-1050.978) * (-1052.546) (-1050.780) [-1041.498] (-1058.634) -- 0:01:34
712000 -- [-1044.155] (-1037.010) (-1038.455) (-1042.180) * (-1059.916) (-1052.054) (-1047.219) [-1046.647] -- 0:01:34
712500 -- (-1058.685) (-1054.333) (-1052.938) [-1050.332] * (-1058.690) (-1037.099) (-1049.794) [-1044.751] -- 0:01:34
713000 -- (-1047.873) (-1046.667) (-1052.702) [-1037.787] * (-1051.001) [-1038.719] (-1051.467) (-1048.460) -- 0:01:34
713500 -- (-1055.442) [-1042.246] (-1046.214) (-1039.652) * [-1044.337] (-1051.108) (-1046.965) (-1048.100) -- 0:01:34
714000 -- (-1059.838) [-1044.464] (-1039.240) (-1042.836) * [-1037.072] (-1043.872) (-1038.869) (-1038.592) -- 0:01:34
714500 -- (-1040.756) (-1036.821) (-1052.048) [-1039.609] * [-1038.281] (-1036.807) (-1042.288) (-1056.486) -- 0:01:33
715000 -- [-1041.289] (-1041.441) (-1045.485) (-1049.554) * (-1048.091) (-1048.259) [-1039.447] (-1035.913) -- 0:01:33
Average standard deviation of split frequencies: 0.007040
715500 -- (-1048.275) [-1039.442] (-1040.820) (-1037.782) * [-1041.198] (-1046.019) (-1036.524) (-1042.244) -- 0:01:33
716000 -- (-1056.153) (-1037.290) [-1038.886] (-1048.492) * (-1038.036) (-1053.572) [-1038.992] (-1061.730) -- 0:01:33
716500 -- (-1043.562) (-1044.868) [-1041.140] (-1049.266) * (-1043.809) [-1044.476] (-1044.410) (-1049.522) -- 0:01:33
717000 -- (-1053.718) [-1042.260] (-1037.696) (-1045.903) * (-1044.798) (-1048.336) [-1039.624] (-1043.540) -- 0:01:33
717500 -- (-1049.927) (-1043.035) (-1032.999) [-1042.514] * (-1037.283) (-1046.928) [-1048.388] (-1051.631) -- 0:01:32
718000 -- (-1049.098) [-1037.648] (-1046.938) (-1051.904) * (-1042.952) [-1033.376] (-1045.695) (-1048.676) -- 0:01:32
718500 -- (-1040.890) (-1044.659) (-1052.346) [-1037.333] * (-1035.652) (-1044.938) [-1041.426] (-1044.279) -- 0:01:32
719000 -- (-1050.379) (-1039.433) (-1048.665) [-1041.242] * (-1043.900) (-1046.350) (-1042.315) [-1036.978] -- 0:01:32
719500 -- [-1039.693] (-1041.249) (-1049.036) (-1060.962) * (-1042.718) (-1046.952) (-1041.407) [-1036.567] -- 0:01:32
720000 -- (-1049.648) (-1048.391) (-1051.278) [-1034.864] * (-1050.133) (-1040.108) [-1040.009] (-1047.530) -- 0:01:32
Average standard deviation of split frequencies: 0.006642
720500 -- (-1054.578) (-1047.515) (-1048.358) [-1037.736] * [-1038.134] (-1043.751) (-1048.077) (-1045.186) -- 0:01:31
721000 -- (-1043.541) (-1043.652) [-1045.786] (-1049.406) * (-1040.180) (-1056.981) (-1039.256) [-1043.033] -- 0:01:31
721500 -- (-1037.690) (-1051.353) [-1038.612] (-1056.224) * (-1055.678) [-1037.022] (-1052.286) (-1042.642) -- 0:01:31
722000 -- (-1048.509) (-1054.918) [-1035.690] (-1045.742) * (-1052.498) [-1040.862] (-1048.860) (-1047.917) -- 0:01:31
722500 -- (-1050.929) (-1043.020) (-1047.766) [-1042.730] * (-1041.276) [-1039.519] (-1046.740) (-1041.101) -- 0:01:31
723000 -- (-1051.773) (-1042.844) [-1047.709] (-1050.380) * [-1036.745] (-1044.968) (-1041.549) (-1044.240) -- 0:01:31
723500 -- [-1048.571] (-1071.026) (-1049.045) (-1044.390) * (-1052.266) (-1044.344) [-1037.793] (-1052.503) -- 0:01:30
724000 -- (-1046.589) (-1052.174) (-1037.090) [-1042.813] * [-1040.058] (-1045.722) (-1038.566) (-1046.034) -- 0:01:30
724500 -- (-1045.572) (-1056.134) (-1045.788) [-1034.075] * (-1040.316) (-1056.536) [-1038.456] (-1047.032) -- 0:01:30
725000 -- (-1041.801) (-1042.471) [-1046.743] (-1044.907) * (-1052.242) [-1037.355] (-1049.301) (-1044.849) -- 0:01:30
Average standard deviation of split frequencies: 0.006893
725500 -- (-1048.625) [-1039.876] (-1043.783) (-1046.682) * (-1045.973) [-1041.937] (-1045.682) (-1063.695) -- 0:01:30
726000 -- (-1039.467) (-1050.581) [-1036.075] (-1062.819) * [-1043.413] (-1047.207) (-1047.731) (-1052.549) -- 0:01:30
726500 -- (-1043.628) (-1048.866) (-1042.698) [-1041.225] * [-1045.219] (-1041.219) (-1052.675) (-1057.307) -- 0:01:29
727000 -- [-1043.654] (-1049.898) (-1042.616) (-1043.066) * [-1046.930] (-1051.424) (-1045.063) (-1056.359) -- 0:01:29
727500 -- (-1045.689) (-1049.283) (-1044.539) [-1044.266] * [-1038.167] (-1067.887) (-1056.960) (-1053.406) -- 0:01:29
728000 -- (-1056.153) [-1042.783] (-1052.997) (-1054.109) * [-1037.118] (-1041.502) (-1033.297) (-1059.822) -- 0:01:29
728500 -- (-1047.626) [-1034.322] (-1046.657) (-1038.749) * (-1043.410) (-1045.266) (-1053.781) [-1040.804] -- 0:01:29
729000 -- (-1048.208) (-1041.657) (-1051.802) [-1041.530] * [-1041.620] (-1056.774) (-1036.889) (-1045.021) -- 0:01:29
729500 -- (-1040.856) (-1035.581) [-1048.739] (-1055.509) * [-1043.545] (-1060.657) (-1035.077) (-1057.693) -- 0:01:28
730000 -- (-1039.782) (-1041.634) (-1047.727) [-1054.602] * (-1046.050) [-1047.170] (-1047.016) (-1049.016) -- 0:01:28
Average standard deviation of split frequencies: 0.006799
730500 -- [-1040.566] (-1050.544) (-1050.987) (-1043.212) * [-1038.192] (-1045.426) (-1053.274) (-1050.272) -- 0:01:28
731000 -- (-1053.311) (-1036.876) (-1048.759) [-1038.344] * (-1045.805) (-1045.380) (-1038.823) [-1046.584] -- 0:01:28
731500 -- (-1047.933) (-1031.050) (-1045.665) [-1042.379] * (-1039.635) (-1059.236) [-1036.347] (-1050.000) -- 0:01:28
732000 -- (-1041.322) [-1042.559] (-1044.481) (-1055.303) * [-1035.099] (-1057.151) (-1049.635) (-1041.052) -- 0:01:28
732500 -- (-1043.724) [-1040.750] (-1039.627) (-1049.380) * (-1050.016) (-1047.981) [-1042.184] (-1036.941) -- 0:01:28
733000 -- (-1040.864) (-1041.077) [-1038.355] (-1043.469) * (-1044.272) (-1041.831) (-1040.493) [-1036.600] -- 0:01:27
733500 -- (-1040.152) [-1043.409] (-1051.280) (-1042.366) * (-1058.791) (-1049.619) [-1043.457] (-1043.041) -- 0:01:27
734000 -- (-1049.094) (-1048.085) (-1056.491) [-1044.009] * (-1038.799) [-1045.195] (-1055.816) (-1042.039) -- 0:01:27
734500 -- (-1049.465) [-1039.929] (-1047.609) (-1045.505) * (-1048.385) (-1044.750) (-1053.345) [-1036.178] -- 0:01:27
735000 -- (-1038.877) (-1045.005) (-1046.666) [-1041.402] * [-1042.135] (-1048.509) (-1037.742) (-1047.772) -- 0:01:27
Average standard deviation of split frequencies: 0.006799
735500 -- (-1050.883) [-1046.018] (-1049.973) (-1037.790) * [-1036.100] (-1048.644) (-1045.696) (-1038.865) -- 0:01:27
736000 -- (-1045.757) (-1057.059) (-1044.623) [-1033.447] * (-1036.614) (-1055.590) [-1040.320] (-1035.899) -- 0:01:26
736500 -- (-1037.091) (-1056.670) [-1034.474] (-1037.209) * (-1043.250) (-1040.268) [-1046.813] (-1043.870) -- 0:01:26
737000 -- (-1048.957) (-1044.138) (-1043.697) [-1033.372] * (-1041.286) (-1047.675) [-1041.745] (-1046.516) -- 0:01:26
737500 -- (-1048.387) (-1043.434) (-1042.489) [-1043.502] * [-1043.560] (-1043.142) (-1044.855) (-1043.175) -- 0:01:26
738000 -- (-1038.400) [-1040.837] (-1036.085) (-1055.541) * (-1049.868) [-1039.415] (-1040.807) (-1048.561) -- 0:01:26
738500 -- (-1040.013) (-1042.129) [-1041.010] (-1039.815) * (-1044.165) [-1037.057] (-1042.436) (-1050.351) -- 0:01:26
739000 -- (-1061.408) [-1036.961] (-1045.840) (-1038.838) * [-1039.724] (-1047.933) (-1057.622) (-1053.660) -- 0:01:25
739500 -- (-1049.143) (-1042.173) (-1053.847) [-1041.888] * [-1038.018] (-1039.061) (-1054.107) (-1053.775) -- 0:01:25
740000 -- (-1045.991) (-1044.118) (-1042.533) [-1034.633] * (-1046.629) (-1049.699) [-1041.916] (-1039.525) -- 0:01:25
Average standard deviation of split frequencies: 0.006952
740500 -- (-1052.161) [-1041.468] (-1053.069) (-1038.618) * (-1055.445) (-1046.216) (-1045.064) [-1033.103] -- 0:01:25
741000 -- [-1039.307] (-1042.407) (-1037.877) (-1042.970) * (-1051.765) [-1032.783] (-1050.238) (-1049.102) -- 0:01:25
741500 -- [-1037.725] (-1047.729) (-1040.373) (-1045.417) * (-1045.031) [-1041.275] (-1050.401) (-1059.034) -- 0:01:25
742000 -- (-1056.063) [-1031.404] (-1043.648) (-1045.197) * (-1043.959) (-1040.967) (-1051.383) [-1051.207] -- 0:01:24
742500 -- (-1048.748) [-1033.507] (-1052.337) (-1042.349) * (-1046.181) (-1049.457) (-1055.267) [-1042.246] -- 0:01:24
743000 -- (-1041.853) [-1042.861] (-1051.019) (-1042.102) * (-1060.004) (-1050.179) (-1044.951) [-1040.567] -- 0:01:24
743500 -- (-1041.750) [-1034.293] (-1040.539) (-1050.063) * [-1037.522] (-1040.133) (-1047.243) (-1051.261) -- 0:01:24
744000 -- (-1053.798) [-1043.570] (-1045.847) (-1039.624) * [-1043.721] (-1045.747) (-1058.243) (-1038.585) -- 0:01:24
744500 -- (-1058.030) (-1036.360) (-1055.508) [-1044.035] * [-1042.164] (-1047.226) (-1052.425) (-1047.738) -- 0:01:24
745000 -- (-1055.396) [-1041.052] (-1047.780) (-1044.651) * [-1046.876] (-1043.664) (-1047.154) (-1053.926) -- 0:01:23
Average standard deviation of split frequencies: 0.007048
745500 -- [-1043.032] (-1047.142) (-1044.980) (-1040.794) * [-1047.090] (-1057.179) (-1047.646) (-1048.453) -- 0:01:23
746000 -- [-1037.313] (-1039.802) (-1040.715) (-1040.998) * (-1057.198) (-1046.073) [-1049.082] (-1042.786) -- 0:01:23
746500 -- (-1047.994) [-1038.202] (-1047.122) (-1045.346) * (-1045.711) (-1053.506) (-1047.086) [-1039.695] -- 0:01:23
747000 -- [-1039.090] (-1050.649) (-1036.353) (-1054.043) * (-1053.736) (-1049.225) [-1037.334] (-1043.261) -- 0:01:23
747500 -- (-1042.049) (-1044.522) [-1041.017] (-1052.075) * (-1041.884) (-1046.609) (-1043.404) [-1035.320] -- 0:01:23
748000 -- [-1038.882] (-1040.454) (-1037.276) (-1049.432) * (-1047.566) (-1049.426) [-1038.701] (-1056.612) -- 0:01:22
748500 -- (-1043.617) (-1035.978) (-1035.762) [-1035.935] * (-1041.086) (-1043.959) [-1042.670] (-1048.249) -- 0:01:22
749000 -- [-1050.537] (-1040.072) (-1047.406) (-1044.587) * (-1047.017) (-1053.911) [-1033.000] (-1039.874) -- 0:01:22
749500 -- (-1046.911) [-1040.231] (-1045.586) (-1041.143) * (-1052.606) [-1036.211] (-1043.535) (-1051.931) -- 0:01:22
750000 -- [-1038.549] (-1041.432) (-1041.604) (-1045.854) * (-1040.149) [-1043.652] (-1031.683) (-1048.346) -- 0:01:22
Average standard deviation of split frequencies: 0.007294
750500 -- (-1049.154) (-1055.657) [-1046.898] (-1041.279) * (-1041.620) [-1044.085] (-1040.078) (-1038.376) -- 0:01:22
751000 -- (-1043.598) (-1060.986) (-1036.807) [-1039.119] * [-1038.509] (-1039.098) (-1043.181) (-1033.312) -- 0:01:21
751500 -- (-1046.678) (-1040.318) (-1035.361) [-1041.311] * (-1050.355) [-1039.366] (-1052.425) (-1043.230) -- 0:01:21
752000 -- (-1046.231) (-1038.106) [-1034.285] (-1046.280) * (-1032.346) (-1047.566) [-1038.430] (-1045.699) -- 0:01:21
752500 -- [-1041.354] (-1039.034) (-1049.696) (-1044.212) * (-1045.382) [-1049.901] (-1045.896) (-1048.453) -- 0:01:21
753000 -- [-1044.354] (-1033.492) (-1045.634) (-1047.988) * [-1043.666] (-1053.345) (-1043.972) (-1043.129) -- 0:01:21
753500 -- (-1048.585) [-1039.302] (-1050.745) (-1039.946) * (-1040.261) (-1051.346) [-1032.763] (-1033.036) -- 0:01:21
754000 -- [-1041.924] (-1038.000) (-1050.421) (-1046.322) * (-1047.604) (-1056.085) (-1038.195) [-1032.985] -- 0:01:20
754500 -- (-1036.050) [-1033.819] (-1061.331) (-1057.387) * (-1051.444) (-1059.165) (-1044.342) [-1050.285] -- 0:01:20
755000 -- (-1040.317) (-1043.197) [-1043.247] (-1064.193) * [-1036.075] (-1040.801) (-1068.344) (-1047.809) -- 0:01:20
Average standard deviation of split frequencies: 0.007003
755500 -- (-1044.074) [-1051.064] (-1034.602) (-1049.741) * (-1044.262) [-1034.195] (-1037.437) (-1040.554) -- 0:01:20
756000 -- [-1036.629] (-1037.368) (-1045.389) (-1051.306) * [-1047.011] (-1051.348) (-1035.770) (-1043.577) -- 0:01:20
756500 -- [-1032.253] (-1046.172) (-1045.306) (-1065.128) * (-1050.922) (-1041.681) [-1042.649] (-1051.905) -- 0:01:20
757000 -- (-1040.684) (-1038.542) [-1038.338] (-1048.820) * (-1051.470) [-1030.491] (-1044.694) (-1040.738) -- 0:01:19
757500 -- (-1048.255) [-1047.094] (-1037.122) (-1057.697) * (-1043.134) (-1040.627) (-1049.962) [-1048.867] -- 0:01:19
758000 -- (-1053.330) [-1040.223] (-1038.348) (-1055.126) * [-1036.748] (-1034.269) (-1056.385) (-1052.077) -- 0:01:19
758500 -- [-1041.478] (-1050.856) (-1048.711) (-1046.668) * [-1051.350] (-1039.871) (-1052.864) (-1055.920) -- 0:01:19
759000 -- (-1043.249) [-1044.271] (-1038.330) (-1044.924) * (-1037.987) [-1039.453] (-1038.645) (-1065.253) -- 0:01:19
759500 -- (-1042.581) [-1040.838] (-1041.064) (-1038.969) * (-1041.300) (-1045.235) [-1032.861] (-1051.044) -- 0:01:19
760000 -- [-1034.722] (-1039.664) (-1046.721) (-1047.842) * (-1047.433) (-1051.165) [-1033.901] (-1048.553) -- 0:01:18
Average standard deviation of split frequencies: 0.006769
760500 -- (-1041.209) (-1044.840) (-1042.203) [-1037.656] * [-1041.397] (-1044.106) (-1051.140) (-1049.109) -- 0:01:18
761000 -- [-1045.955] (-1046.316) (-1040.133) (-1051.525) * (-1046.673) [-1038.234] (-1042.282) (-1044.332) -- 0:01:18
761500 -- (-1047.230) [-1037.029] (-1050.342) (-1050.385) * (-1048.713) (-1045.872) [-1032.216] (-1049.709) -- 0:01:18
762000 -- [-1035.262] (-1046.313) (-1052.205) (-1046.791) * (-1043.000) [-1035.084] (-1037.513) (-1055.595) -- 0:01:18
762500 -- [-1043.218] (-1048.581) (-1045.508) (-1055.400) * [-1046.710] (-1037.128) (-1043.921) (-1063.576) -- 0:01:18
763000 -- (-1046.528) (-1050.592) (-1037.339) [-1038.555] * [-1046.304] (-1040.216) (-1042.992) (-1040.186) -- 0:01:17
763500 -- [-1039.217] (-1036.758) (-1049.497) (-1048.141) * (-1054.306) [-1046.592] (-1034.490) (-1050.843) -- 0:01:17
764000 -- (-1052.219) [-1038.264] (-1042.665) (-1054.784) * [-1046.050] (-1057.196) (-1036.018) (-1051.419) -- 0:01:17
764500 -- (-1039.202) (-1039.104) [-1045.475] (-1044.877) * [-1039.898] (-1045.659) (-1043.523) (-1059.135) -- 0:01:17
765000 -- (-1053.419) (-1055.077) (-1039.509) [-1047.080] * (-1043.809) [-1037.742] (-1045.890) (-1037.333) -- 0:01:17
Average standard deviation of split frequencies: 0.007432
765500 -- (-1037.540) (-1052.879) (-1043.459) [-1046.139] * (-1046.576) (-1044.609) [-1051.039] (-1043.430) -- 0:01:17
766000 -- (-1042.644) [-1033.946] (-1054.365) (-1049.045) * (-1048.147) [-1041.500] (-1046.210) (-1044.625) -- 0:01:16
766500 -- (-1046.491) [-1043.132] (-1048.557) (-1038.949) * [-1048.532] (-1042.864) (-1050.944) (-1046.325) -- 0:01:16
767000 -- (-1044.239) [-1039.793] (-1046.823) (-1048.256) * (-1039.133) (-1051.213) (-1046.450) [-1040.859] -- 0:01:16
767500 -- (-1054.921) (-1039.272) [-1048.725] (-1047.667) * (-1042.999) (-1054.247) [-1035.455] (-1052.001) -- 0:01:16
768000 -- (-1056.897) [-1035.310] (-1045.531) (-1051.543) * (-1046.608) (-1035.402) (-1063.189) [-1041.561] -- 0:01:16
768500 -- (-1044.606) [-1033.062] (-1041.339) (-1042.439) * [-1046.336] (-1047.312) (-1055.783) (-1043.087) -- 0:01:15
769000 -- (-1042.784) (-1044.559) [-1046.270] (-1047.584) * (-1052.146) (-1044.395) (-1048.379) [-1048.594] -- 0:01:15
769500 -- (-1039.801) (-1038.186) (-1047.059) [-1044.117] * (-1055.960) (-1041.688) (-1057.389) [-1046.257] -- 0:01:15
770000 -- (-1039.783) (-1057.296) (-1042.234) [-1038.480] * (-1055.192) [-1040.517] (-1040.195) (-1037.963) -- 0:01:15
Average standard deviation of split frequencies: 0.007387
770500 -- [-1041.104] (-1044.650) (-1043.643) (-1056.091) * (-1055.692) (-1041.200) (-1046.940) [-1047.664] -- 0:01:15
771000 -- (-1038.552) [-1039.502] (-1048.065) (-1043.499) * (-1044.564) (-1043.549) [-1038.900] (-1044.745) -- 0:01:15
771500 -- (-1053.691) (-1049.132) (-1042.120) [-1033.193] * [-1040.551] (-1035.897) (-1039.729) (-1056.089) -- 0:01:14
772000 -- (-1051.831) [-1040.649] (-1055.763) (-1041.296) * (-1040.287) (-1045.678) (-1045.084) [-1045.938] -- 0:01:15
772500 -- [-1055.807] (-1040.762) (-1048.584) (-1038.924) * (-1055.716) (-1047.820) (-1051.929) [-1043.746] -- 0:01:14
773000 -- (-1041.382) (-1035.652) (-1046.103) [-1038.568] * (-1046.834) (-1040.954) [-1041.473] (-1059.470) -- 0:01:14
773500 -- (-1041.099) [-1037.090] (-1051.471) (-1054.401) * (-1060.063) (-1046.077) [-1046.201] (-1047.067) -- 0:01:14
774000 -- [-1041.340] (-1049.179) (-1055.489) (-1042.235) * (-1046.203) [-1035.431] (-1044.934) (-1044.774) -- 0:01:14
774500 -- (-1043.764) (-1058.300) (-1041.808) [-1039.146] * (-1049.708) (-1046.147) (-1050.454) [-1044.313] -- 0:01:13
775000 -- (-1050.889) (-1050.327) [-1047.020] (-1038.733) * (-1051.828) [-1044.520] (-1060.693) (-1042.407) -- 0:01:14
Average standard deviation of split frequencies: 0.007383
775500 -- (-1050.069) (-1048.594) [-1044.477] (-1033.946) * (-1046.039) (-1040.054) (-1044.946) [-1043.299] -- 0:01:13
776000 -- [-1037.725] (-1053.440) (-1046.375) (-1041.716) * (-1042.616) (-1057.558) (-1052.653) [-1045.814] -- 0:01:13
776500 -- [-1037.272] (-1056.334) (-1039.972) (-1045.807) * (-1042.188) (-1050.274) (-1057.651) [-1037.537] -- 0:01:13
777000 -- (-1032.427) (-1045.370) [-1034.266] (-1051.874) * (-1043.594) (-1048.455) [-1051.996] (-1046.456) -- 0:01:13
777500 -- (-1041.190) [-1031.136] (-1042.704) (-1045.014) * (-1045.081) (-1045.827) (-1054.387) [-1041.869] -- 0:01:12
778000 -- [-1036.590] (-1043.678) (-1038.588) (-1042.777) * [-1052.744] (-1043.495) (-1046.143) (-1039.680) -- 0:01:13
778500 -- [-1033.904] (-1041.325) (-1049.450) (-1039.876) * (-1039.024) (-1046.920) (-1047.904) [-1038.237] -- 0:01:12
779000 -- [-1043.646] (-1052.762) (-1047.275) (-1046.786) * (-1037.368) [-1048.327] (-1053.797) (-1046.784) -- 0:01:12
779500 -- (-1047.518) (-1056.910) [-1042.104] (-1042.522) * [-1045.898] (-1048.502) (-1060.778) (-1047.954) -- 0:01:12
780000 -- (-1050.669) (-1047.100) (-1041.572) [-1044.992] * (-1048.792) (-1038.747) [-1044.370] (-1050.575) -- 0:01:12
Average standard deviation of split frequencies: 0.007618
780500 -- (-1061.304) (-1048.925) (-1053.550) [-1048.951] * (-1054.088) (-1044.084) (-1043.557) [-1044.549] -- 0:01:11
781000 -- (-1041.213) (-1050.688) [-1036.845] (-1042.789) * (-1050.763) (-1037.071) [-1039.933] (-1045.180) -- 0:01:12
781500 -- (-1038.311) [-1040.809] (-1044.774) (-1036.370) * (-1050.100) [-1035.455] (-1046.469) (-1046.334) -- 0:01:11
782000 -- [-1039.388] (-1043.086) (-1040.607) (-1041.998) * (-1046.275) [-1046.059] (-1053.379) (-1055.653) -- 0:01:11
782500 -- (-1048.047) (-1057.984) [-1047.592] (-1047.987) * (-1037.289) [-1045.589] (-1048.812) (-1050.911) -- 0:01:11
783000 -- (-1037.576) [-1041.217] (-1053.208) (-1049.627) * (-1055.832) [-1037.782] (-1057.214) (-1053.851) -- 0:01:11
783500 -- [-1040.745] (-1047.135) (-1045.576) (-1063.391) * (-1055.028) [-1050.313] (-1049.233) (-1065.155) -- 0:01:11
784000 -- (-1050.390) (-1043.370) [-1049.207] (-1049.759) * (-1049.268) [-1048.424] (-1049.882) (-1043.252) -- 0:01:11
784500 -- (-1056.526) (-1048.716) [-1044.673] (-1046.833) * (-1049.353) [-1036.174] (-1049.682) (-1055.897) -- 0:01:10
785000 -- [-1044.441] (-1054.075) (-1061.423) (-1046.078) * [-1051.132] (-1033.038) (-1055.898) (-1052.332) -- 0:01:10
Average standard deviation of split frequencies: 0.007335
785500 -- (-1045.690) [-1038.987] (-1056.116) (-1047.333) * [-1035.246] (-1039.541) (-1045.951) (-1056.588) -- 0:01:10
786000 -- [-1037.693] (-1043.657) (-1061.995) (-1038.052) * [-1033.675] (-1045.423) (-1056.493) (-1050.831) -- 0:01:10
786500 -- (-1053.212) (-1037.774) (-1059.298) [-1040.465] * [-1038.597] (-1041.622) (-1046.920) (-1060.486) -- 0:01:10
787000 -- (-1044.284) [-1040.192] (-1072.189) (-1057.452) * [-1035.752] (-1045.181) (-1042.966) (-1038.989) -- 0:01:10
787500 -- (-1046.687) (-1046.453) (-1052.812) [-1037.884] * [-1039.594] (-1039.786) (-1054.175) (-1046.363) -- 0:01:09
788000 -- (-1054.744) (-1039.868) (-1051.573) [-1045.293] * [-1041.323] (-1052.145) (-1051.156) (-1052.342) -- 0:01:09
788500 -- (-1042.982) (-1043.120) [-1038.697] (-1041.293) * (-1037.675) (-1042.190) [-1045.510] (-1049.733) -- 0:01:09
789000 -- [-1040.351] (-1042.585) (-1053.367) (-1044.456) * [-1039.174] (-1059.761) (-1044.795) (-1047.485) -- 0:01:09
789500 -- (-1057.926) (-1055.222) (-1041.791) [-1038.064] * (-1043.000) (-1047.320) [-1042.082] (-1042.584) -- 0:01:09
790000 -- [-1044.154] (-1054.417) (-1042.985) (-1050.103) * (-1053.537) (-1038.068) (-1041.841) [-1042.742] -- 0:01:08
Average standard deviation of split frequencies: 0.006742
790500 -- (-1047.933) [-1050.877] (-1041.036) (-1051.714) * (-1033.796) (-1050.688) (-1046.356) [-1043.525] -- 0:01:08
791000 -- (-1052.162) [-1048.414] (-1045.292) (-1045.445) * (-1035.694) (-1039.554) [-1039.781] (-1047.969) -- 0:01:08
791500 -- (-1039.477) [-1037.339] (-1042.443) (-1060.166) * (-1041.566) (-1049.241) [-1035.207] (-1038.602) -- 0:01:08
792000 -- [-1034.553] (-1046.569) (-1044.811) (-1043.206) * [-1037.582] (-1053.265) (-1039.740) (-1048.933) -- 0:01:08
792500 -- (-1037.551) [-1038.461] (-1044.502) (-1041.413) * (-1042.427) (-1050.596) (-1057.093) [-1036.853] -- 0:01:08
793000 -- [-1040.239] (-1043.738) (-1048.680) (-1058.720) * (-1047.076) [-1043.346] (-1049.095) (-1048.655) -- 0:01:07
793500 -- [-1040.679] (-1045.305) (-1052.066) (-1048.152) * (-1044.086) (-1055.812) (-1045.922) [-1040.565] -- 0:01:07
794000 -- (-1037.996) (-1046.709) (-1048.206) [-1053.833] * (-1041.775) (-1051.485) (-1034.756) [-1037.595] -- 0:01:07
794500 -- [-1030.957] (-1047.654) (-1051.403) (-1039.215) * (-1048.551) (-1047.269) (-1048.701) [-1035.938] -- 0:01:07
795000 -- (-1038.643) (-1050.669) [-1039.941] (-1037.008) * (-1046.797) (-1057.513) (-1045.422) [-1038.484] -- 0:01:07
Average standard deviation of split frequencies: 0.006605
795500 -- [-1039.594] (-1049.455) (-1045.111) (-1052.461) * (-1054.758) (-1039.665) (-1044.261) [-1032.355] -- 0:01:07
796000 -- (-1042.973) (-1054.329) (-1042.337) [-1037.480] * (-1067.959) (-1046.272) (-1057.230) [-1036.450] -- 0:01:06
796500 -- (-1055.217) [-1041.220] (-1045.282) (-1049.617) * [-1038.533] (-1044.986) (-1038.334) (-1040.657) -- 0:01:06
797000 -- (-1040.803) (-1048.686) [-1045.049] (-1045.746) * (-1042.198) (-1046.503) [-1045.982] (-1043.631) -- 0:01:06
797500 -- (-1050.644) (-1040.049) [-1049.773] (-1052.068) * (-1045.949) [-1043.693] (-1055.125) (-1051.894) -- 0:01:06
798000 -- (-1040.104) [-1042.355] (-1053.361) (-1035.557) * (-1051.626) [-1044.150] (-1047.479) (-1038.881) -- 0:01:06
798500 -- (-1048.275) (-1059.267) (-1042.268) [-1038.295] * (-1039.900) (-1052.203) [-1042.845] (-1045.499) -- 0:01:06
799000 -- (-1041.926) (-1060.116) [-1044.628] (-1039.967) * (-1050.301) [-1032.389] (-1056.905) (-1046.975) -- 0:01:05
799500 -- [-1046.806] (-1053.140) (-1053.299) (-1047.701) * [-1039.302] (-1043.209) (-1054.858) (-1051.064) -- 0:01:05
800000 -- (-1043.532) [-1042.825] (-1049.581) (-1048.051) * (-1046.205) [-1041.052] (-1043.959) (-1053.705) -- 0:01:05
Average standard deviation of split frequencies: 0.006159
800500 -- [-1049.770] (-1045.518) (-1050.434) (-1046.818) * (-1051.442) (-1040.018) [-1042.229] (-1038.224) -- 0:01:05
801000 -- (-1047.749) (-1043.992) [-1041.674] (-1051.437) * [-1039.667] (-1044.683) (-1055.123) (-1044.454) -- 0:01:05
801500 -- (-1043.959) [-1039.142] (-1051.472) (-1045.120) * (-1049.112) (-1048.600) (-1044.621) [-1041.347] -- 0:01:05
802000 -- (-1039.766) [-1043.868] (-1044.228) (-1045.662) * (-1040.659) [-1041.140] (-1050.521) (-1044.701) -- 0:01:04
802500 -- (-1048.957) (-1050.965) (-1044.191) [-1044.279] * (-1041.112) [-1042.409] (-1038.283) (-1048.568) -- 0:01:04
803000 -- (-1053.534) [-1039.588] (-1060.319) (-1043.640) * (-1043.857) [-1039.811] (-1040.124) (-1041.198) -- 0:01:04
803500 -- (-1047.673) [-1040.556] (-1050.662) (-1040.502) * [-1043.337] (-1054.549) (-1044.505) (-1038.828) -- 0:01:04
804000 -- (-1048.461) (-1053.091) (-1041.920) [-1056.799] * (-1045.465) (-1049.750) (-1046.899) [-1038.699] -- 0:01:04
804500 -- (-1052.363) (-1047.097) [-1050.502] (-1043.649) * (-1048.777) (-1051.785) (-1052.497) [-1042.928] -- 0:01:04
805000 -- [-1040.893] (-1039.653) (-1040.060) (-1054.870) * (-1050.991) (-1065.677) (-1045.781) [-1042.422] -- 0:01:03
Average standard deviation of split frequencies: 0.005624
805500 -- [-1034.178] (-1040.873) (-1058.250) (-1049.681) * (-1051.804) (-1048.267) [-1038.571] (-1041.639) -- 0:01:03
806000 -- [-1048.780] (-1045.695) (-1051.629) (-1045.467) * (-1049.523) (-1039.442) [-1032.682] (-1046.639) -- 0:01:03
806500 -- [-1036.871] (-1046.603) (-1061.212) (-1038.198) * (-1044.399) (-1044.179) [-1034.720] (-1061.933) -- 0:01:03
807000 -- (-1052.693) (-1047.134) (-1054.017) [-1038.203] * (-1049.542) [-1044.608] (-1062.558) (-1041.209) -- 0:01:03
807500 -- [-1039.993] (-1048.983) (-1044.139) (-1050.119) * [-1049.586] (-1052.062) (-1045.103) (-1047.467) -- 0:01:03
808000 -- (-1052.533) [-1032.789] (-1044.869) (-1036.568) * (-1045.894) (-1044.984) [-1041.938] (-1055.038) -- 0:01:02
808500 -- (-1045.510) [-1043.644] (-1052.225) (-1052.238) * (-1045.442) [-1048.662] (-1048.901) (-1042.608) -- 0:01:02
809000 -- (-1051.696) [-1035.011] (-1044.188) (-1040.941) * [-1035.054] (-1044.454) (-1056.551) (-1064.113) -- 0:01:02
809500 -- (-1045.374) [-1037.137] (-1040.954) (-1054.516) * [-1053.104] (-1064.025) (-1055.342) (-1047.981) -- 0:01:02
810000 -- (-1051.108) (-1041.442) [-1047.836] (-1046.346) * (-1044.663) (-1039.096) (-1052.074) [-1036.413] -- 0:01:02
Average standard deviation of split frequencies: 0.005770
810500 -- (-1041.630) (-1050.271) (-1040.227) [-1041.961] * (-1053.100) [-1040.171] (-1047.853) (-1040.209) -- 0:01:02
811000 -- (-1037.394) (-1049.231) (-1042.831) [-1052.186] * (-1052.466) (-1044.142) (-1048.525) [-1033.886] -- 0:01:01
811500 -- (-1053.261) (-1042.482) (-1040.956) [-1048.650] * [-1038.186] (-1045.466) (-1040.643) (-1060.090) -- 0:01:01
812000 -- (-1046.965) (-1042.758) [-1033.274] (-1044.228) * (-1052.843) (-1055.653) [-1042.108] (-1047.389) -- 0:01:01
812500 -- (-1045.419) (-1044.497) [-1044.265] (-1038.584) * (-1050.100) (-1037.530) (-1039.477) [-1048.145] -- 0:01:01
813000 -- (-1051.441) [-1040.014] (-1056.054) (-1042.436) * (-1047.199) [-1046.400] (-1042.124) (-1051.411) -- 0:01:01
813500 -- (-1048.397) [-1038.595] (-1044.971) (-1047.649) * (-1044.624) (-1034.349) (-1032.595) [-1041.445] -- 0:01:01
814000 -- (-1050.136) (-1049.453) [-1041.612] (-1042.704) * [-1047.787] (-1043.083) (-1042.183) (-1039.667) -- 0:01:01
814500 -- (-1045.794) (-1044.511) [-1043.949] (-1039.210) * (-1049.951) (-1054.416) (-1042.919) [-1042.359] -- 0:01:00
815000 -- (-1040.923) [-1046.336] (-1046.677) (-1051.114) * (-1069.633) (-1050.397) (-1051.022) [-1043.771] -- 0:01:00
Average standard deviation of split frequencies: 0.005777
815500 -- (-1041.702) [-1044.396] (-1042.619) (-1049.594) * (-1044.690) [-1047.479] (-1052.622) (-1036.956) -- 0:01:00
816000 -- [-1040.578] (-1045.808) (-1049.539) (-1044.045) * (-1057.590) (-1038.097) (-1040.535) [-1037.290] -- 0:01:00
816500 -- (-1044.454) (-1041.612) (-1041.262) [-1038.816] * (-1049.390) (-1042.558) [-1039.777] (-1041.366) -- 0:01:00
817000 -- (-1046.778) (-1048.002) [-1035.294] (-1037.563) * (-1055.758) (-1049.111) [-1041.791] (-1045.643) -- 0:01:00
817500 -- (-1042.290) (-1043.509) (-1047.842) [-1045.794] * (-1046.992) [-1044.336] (-1048.607) (-1037.610) -- 0:00:59
818000 -- [-1054.102] (-1038.160) (-1049.999) (-1056.458) * (-1045.282) (-1052.987) (-1050.158) [-1042.845] -- 0:00:59
818500 -- (-1039.382) [-1038.679] (-1040.785) (-1035.149) * (-1048.254) (-1051.621) [-1043.922] (-1045.058) -- 0:00:59
819000 -- (-1061.031) [-1040.434] (-1058.540) (-1039.192) * (-1048.145) (-1055.263) [-1040.143] (-1041.604) -- 0:00:59
819500 -- (-1043.103) (-1037.640) (-1044.716) [-1046.145] * [-1033.631] (-1039.590) (-1032.133) (-1048.835) -- 0:00:59
820000 -- (-1039.271) (-1059.465) [-1044.507] (-1045.769) * (-1049.692) [-1041.397] (-1043.310) (-1036.000) -- 0:00:59
Average standard deviation of split frequencies: 0.005346
820500 -- [-1038.339] (-1039.031) (-1049.377) (-1041.885) * (-1044.062) (-1041.301) [-1038.482] (-1042.191) -- 0:00:59
821000 -- (-1038.598) (-1050.621) (-1040.965) [-1040.064] * [-1036.748] (-1042.956) (-1054.772) (-1040.495) -- 0:00:58
821500 -- (-1053.672) (-1044.153) [-1038.771] (-1048.527) * (-1047.382) [-1036.862] (-1037.671) (-1042.797) -- 0:00:58
822000 -- (-1050.336) (-1053.026) (-1048.321) [-1037.986] * (-1053.644) (-1044.545) (-1056.614) [-1038.327] -- 0:00:58
822500 -- (-1045.689) (-1045.789) (-1046.488) [-1031.862] * (-1039.663) (-1044.840) (-1050.628) [-1044.803] -- 0:00:58
823000 -- (-1060.357) (-1048.274) (-1048.286) [-1037.009] * [-1034.839] (-1044.523) (-1056.216) (-1041.225) -- 0:00:58
823500 -- [-1043.135] (-1051.000) (-1045.560) (-1046.574) * [-1038.723] (-1057.845) (-1046.012) (-1041.210) -- 0:00:58
824000 -- (-1047.195) (-1043.861) (-1046.606) [-1040.242] * (-1058.629) (-1040.959) (-1062.878) [-1034.431] -- 0:00:57
824500 -- (-1051.267) (-1036.585) (-1049.944) [-1042.407] * (-1040.362) (-1041.797) (-1040.489) [-1042.854] -- 0:00:57
825000 -- (-1049.232) (-1045.655) (-1040.719) [-1043.073] * (-1050.399) (-1038.128) [-1037.977] (-1041.453) -- 0:00:57
Average standard deviation of split frequencies: 0.005312
825500 -- (-1055.177) (-1040.235) (-1047.749) [-1045.604] * (-1046.660) (-1044.955) [-1041.298] (-1047.311) -- 0:00:57
826000 -- (-1048.686) [-1041.109] (-1046.772) (-1047.558) * (-1049.705) (-1043.745) (-1049.854) [-1040.435] -- 0:00:57
826500 -- [-1036.434] (-1042.186) (-1038.074) (-1050.236) * (-1044.424) (-1039.782) [-1045.147] (-1037.766) -- 0:00:57
827000 -- [-1037.445] (-1064.538) (-1047.898) (-1044.373) * [-1030.789] (-1046.805) (-1055.107) (-1042.779) -- 0:00:56
827500 -- (-1048.931) (-1061.023) (-1038.066) [-1040.451] * (-1043.693) [-1041.917] (-1040.506) (-1050.572) -- 0:00:56
828000 -- (-1052.545) (-1042.334) (-1037.757) [-1052.480] * (-1048.927) (-1060.426) [-1040.810] (-1042.499) -- 0:00:56
828500 -- (-1042.557) (-1048.965) [-1038.377] (-1042.826) * (-1052.950) [-1041.393] (-1046.751) (-1056.745) -- 0:00:56
829000 -- [-1047.419] (-1065.304) (-1038.961) (-1055.108) * (-1046.761) (-1056.989) [-1045.151] (-1048.506) -- 0:00:56
829500 -- [-1045.419] (-1048.346) (-1047.782) (-1043.530) * (-1041.625) (-1045.091) (-1047.169) [-1042.513] -- 0:00:56
830000 -- (-1059.758) (-1051.842) [-1034.000] (-1044.539) * (-1048.975) [-1039.323] (-1045.779) (-1048.022) -- 0:00:55
Average standard deviation of split frequencies: 0.005806
830500 -- (-1042.799) (-1048.737) (-1038.056) [-1035.936] * (-1043.261) (-1046.789) [-1041.557] (-1050.377) -- 0:00:55
831000 -- [-1040.704] (-1040.244) (-1052.081) (-1044.184) * (-1055.154) (-1031.943) (-1049.947) [-1049.108] -- 0:00:55
831500 -- (-1053.124) (-1052.676) (-1061.033) [-1040.752] * (-1046.171) [-1038.549] (-1044.135) (-1042.516) -- 0:00:55
832000 -- (-1042.374) (-1047.381) [-1043.855] (-1054.147) * [-1047.099] (-1038.311) (-1039.759) (-1044.518) -- 0:00:55
832500 -- (-1046.764) [-1036.900] (-1043.183) (-1041.012) * (-1045.171) [-1041.216] (-1042.684) (-1047.787) -- 0:00:55
833000 -- (-1049.201) (-1041.180) (-1043.876) [-1045.552] * [-1041.728] (-1045.313) (-1048.329) (-1044.462) -- 0:00:54
833500 -- (-1036.942) (-1037.744) (-1063.029) [-1039.654] * (-1039.518) [-1037.479] (-1048.583) (-1064.117) -- 0:00:54
834000 -- (-1048.132) [-1043.577] (-1048.560) (-1050.884) * [-1040.327] (-1043.214) (-1032.962) (-1047.895) -- 0:00:54
834500 -- (-1046.813) [-1040.748] (-1039.320) (-1044.561) * (-1047.021) (-1049.367) (-1043.429) [-1039.842] -- 0:00:54
835000 -- (-1046.795) (-1038.208) (-1043.021) [-1035.315] * (-1053.166) [-1055.257] (-1046.995) (-1061.747) -- 0:00:54
Average standard deviation of split frequencies: 0.005986
835500 -- (-1045.668) (-1051.061) (-1040.933) [-1038.090] * (-1040.595) (-1045.874) [-1039.329] (-1048.707) -- 0:00:54
836000 -- (-1053.749) (-1035.421) (-1040.969) [-1037.416] * (-1042.329) [-1043.605] (-1047.767) (-1044.780) -- 0:00:53
836500 -- (-1040.875) (-1046.333) [-1036.026] (-1037.266) * (-1060.345) (-1038.936) (-1042.246) [-1041.030] -- 0:00:53
837000 -- (-1053.150) (-1037.036) (-1046.433) [-1042.903] * (-1046.039) [-1051.850] (-1037.709) (-1042.472) -- 0:00:53
837500 -- (-1046.937) [-1039.200] (-1038.206) (-1050.511) * (-1040.491) (-1047.512) [-1055.465] (-1053.504) -- 0:00:53
838000 -- [-1039.696] (-1044.422) (-1060.446) (-1040.850) * [-1042.401] (-1046.294) (-1058.850) (-1047.796) -- 0:00:53
838500 -- (-1049.042) [-1050.321] (-1046.686) (-1042.602) * (-1042.172) [-1035.006] (-1047.976) (-1041.780) -- 0:00:53
839000 -- (-1044.941) [-1032.612] (-1044.388) (-1051.641) * [-1039.476] (-1047.347) (-1045.228) (-1039.659) -- 0:00:52
839500 -- (-1040.799) [-1040.776] (-1053.382) (-1044.674) * (-1046.755) [-1044.969] (-1043.865) (-1054.083) -- 0:00:52
840000 -- (-1042.794) (-1058.528) (-1043.032) [-1039.255] * (-1040.823) [-1041.891] (-1050.434) (-1058.312) -- 0:00:52
Average standard deviation of split frequencies: 0.005608
840500 -- (-1041.986) [-1042.710] (-1055.199) (-1045.096) * (-1042.671) [-1039.187] (-1060.572) (-1057.623) -- 0:00:52
841000 -- (-1064.488) (-1055.474) (-1050.338) [-1032.809] * (-1049.789) (-1040.540) (-1048.911) [-1047.867] -- 0:00:52
841500 -- (-1047.878) (-1049.167) [-1040.317] (-1041.630) * (-1050.098) (-1038.110) (-1059.741) [-1041.763] -- 0:00:52
842000 -- (-1045.988) [-1047.781] (-1045.733) (-1038.719) * (-1044.814) [-1033.306] (-1054.298) (-1049.379) -- 0:00:51
842500 -- (-1053.840) (-1043.341) (-1050.951) [-1042.667] * (-1047.131) [-1032.727] (-1042.911) (-1046.280) -- 0:00:51
843000 -- (-1052.084) (-1059.610) [-1048.438] (-1039.895) * (-1038.880) [-1035.009] (-1040.639) (-1045.484) -- 0:00:51
843500 -- [-1046.621] (-1049.275) (-1051.951) (-1043.173) * [-1039.160] (-1030.453) (-1049.875) (-1055.096) -- 0:00:51
844000 -- (-1051.595) (-1057.066) (-1055.022) [-1049.256] * (-1040.151) [-1039.643] (-1043.138) (-1043.227) -- 0:00:51
844500 -- (-1049.708) (-1048.149) [-1040.301] (-1042.611) * [-1044.119] (-1047.001) (-1047.651) (-1048.548) -- 0:00:51
845000 -- [-1038.220] (-1041.584) (-1054.536) (-1042.824) * (-1045.812) (-1063.289) [-1042.864] (-1058.063) -- 0:00:50
Average standard deviation of split frequencies: 0.005701
845500 -- [-1045.092] (-1042.613) (-1043.220) (-1054.635) * (-1062.051) (-1047.312) [-1046.557] (-1037.660) -- 0:00:50
846000 -- (-1045.186) (-1049.196) (-1051.007) [-1053.095] * (-1042.824) [-1037.618] (-1043.183) (-1034.274) -- 0:00:50
846500 -- (-1042.432) (-1046.128) [-1040.661] (-1032.280) * [-1044.092] (-1046.790) (-1048.261) (-1037.123) -- 0:00:50
847000 -- (-1044.826) (-1050.335) (-1039.632) [-1037.540] * (-1042.495) [-1036.695] (-1051.485) (-1038.935) -- 0:00:50
847500 -- (-1044.307) (-1050.873) [-1038.951] (-1044.206) * (-1054.261) (-1051.121) (-1054.197) [-1043.869] -- 0:00:50
848000 -- (-1041.728) (-1064.337) (-1035.515) [-1044.517] * (-1050.368) [-1039.911] (-1047.221) (-1038.373) -- 0:00:50
848500 -- (-1042.073) (-1048.017) [-1048.792] (-1039.525) * (-1056.148) (-1044.741) (-1053.498) [-1046.063] -- 0:00:49
849000 -- (-1042.620) (-1039.066) [-1040.289] (-1048.234) * (-1046.225) (-1058.665) [-1035.135] (-1048.800) -- 0:00:49
849500 -- (-1061.741) [-1038.662] (-1047.262) (-1051.256) * (-1061.411) [-1039.940] (-1044.739) (-1047.591) -- 0:00:49
850000 -- [-1049.433] (-1047.578) (-1042.849) (-1048.197) * (-1058.445) (-1047.051) (-1051.145) [-1033.421] -- 0:00:49
Average standard deviation of split frequencies: 0.005925
850500 -- (-1042.838) (-1046.502) [-1040.420] (-1048.976) * (-1057.091) (-1040.703) (-1050.311) [-1040.810] -- 0:00:49
851000 -- (-1045.498) [-1047.103] (-1042.738) (-1058.968) * (-1057.885) (-1045.064) (-1041.180) [-1036.180] -- 0:00:49
851500 -- (-1049.096) (-1054.242) [-1037.560] (-1042.964) * (-1051.080) (-1040.469) [-1044.800] (-1048.239) -- 0:00:48
852000 -- (-1041.626) (-1053.664) (-1046.923) [-1044.193] * (-1051.596) (-1042.157) (-1040.438) [-1039.651] -- 0:00:48
852500 -- (-1035.886) (-1048.523) (-1047.745) [-1048.646] * (-1055.113) [-1037.005] (-1047.643) (-1039.146) -- 0:00:48
853000 -- (-1042.812) (-1046.792) (-1044.137) [-1044.388] * (-1042.709) (-1040.123) [-1035.683] (-1044.267) -- 0:00:48
853500 -- [-1041.926] (-1040.016) (-1044.272) (-1042.187) * (-1048.470) (-1035.084) (-1051.588) [-1039.239] -- 0:00:48
854000 -- [-1041.412] (-1043.889) (-1043.732) (-1045.244) * (-1049.798) (-1056.271) (-1047.695) [-1046.717] -- 0:00:48
854500 -- [-1032.887] (-1039.804) (-1046.253) (-1055.152) * (-1043.443) (-1048.110) [-1041.205] (-1053.815) -- 0:00:47
855000 -- [-1036.893] (-1037.531) (-1035.163) (-1037.067) * (-1040.572) (-1043.149) [-1040.778] (-1048.971) -- 0:00:47
Average standard deviation of split frequencies: 0.005549
855500 -- [-1042.457] (-1041.967) (-1044.540) (-1043.682) * (-1037.052) (-1042.689) [-1037.998] (-1042.599) -- 0:00:47
856000 -- (-1050.526) [-1042.218] (-1052.615) (-1040.355) * (-1045.190) (-1036.710) [-1039.661] (-1047.837) -- 0:00:47
856500 -- (-1042.667) (-1041.883) [-1049.004] (-1048.514) * (-1062.111) (-1049.581) [-1037.098] (-1043.465) -- 0:00:47
857000 -- [-1040.968] (-1045.385) (-1054.418) (-1038.895) * (-1049.027) [-1042.347] (-1045.971) (-1037.012) -- 0:00:47
857500 -- (-1039.248) (-1049.734) (-1044.725) [-1039.639] * (-1054.199) (-1036.129) [-1056.852] (-1044.721) -- 0:00:46
858000 -- (-1044.474) (-1068.437) (-1041.131) [-1038.954] * (-1047.400) (-1053.094) (-1053.065) [-1046.032] -- 0:00:46
858500 -- (-1043.569) (-1049.174) [-1041.293] (-1056.115) * (-1048.611) (-1057.046) [-1039.454] (-1038.161) -- 0:00:46
859000 -- (-1049.850) (-1053.021) (-1047.769) [-1050.577] * (-1045.477) (-1047.036) [-1048.039] (-1047.904) -- 0:00:46
859500 -- [-1032.206] (-1048.132) (-1058.107) (-1046.864) * (-1038.038) [-1038.630] (-1044.266) (-1039.749) -- 0:00:46
860000 -- (-1038.772) [-1037.954] (-1049.820) (-1039.727) * (-1048.191) (-1044.539) [-1045.491] (-1040.850) -- 0:00:46
Average standard deviation of split frequencies: 0.005561
860500 -- [-1035.318] (-1038.340) (-1047.506) (-1045.163) * (-1041.259) (-1042.867) [-1039.516] (-1036.915) -- 0:00:45
861000 -- (-1035.390) [-1039.721] (-1040.371) (-1050.962) * (-1050.513) (-1042.632) (-1048.222) [-1042.631] -- 0:00:45
861500 -- [-1033.148] (-1048.198) (-1039.591) (-1044.222) * [-1045.706] (-1045.402) (-1046.424) (-1048.306) -- 0:00:45
862000 -- [-1043.247] (-1057.896) (-1037.482) (-1047.428) * (-1041.819) (-1046.925) (-1045.713) [-1051.995] -- 0:00:45
862500 -- (-1044.889) (-1041.017) [-1052.223] (-1053.791) * (-1049.895) (-1046.668) (-1048.811) [-1048.394] -- 0:00:45
863000 -- (-1037.128) [-1032.954] (-1044.653) (-1046.123) * (-1048.870) (-1059.736) [-1044.093] (-1041.720) -- 0:00:45
863500 -- (-1049.064) [-1045.674] (-1052.250) (-1036.436) * [-1042.042] (-1045.203) (-1050.141) (-1043.892) -- 0:00:44
864000 -- (-1038.426) (-1045.863) (-1042.282) [-1036.811] * (-1040.790) (-1036.543) [-1044.313] (-1065.257) -- 0:00:44
864500 -- (-1047.776) [-1036.115] (-1037.475) (-1041.459) * (-1047.221) [-1037.775] (-1053.784) (-1056.639) -- 0:00:44
865000 -- [-1046.572] (-1045.756) (-1042.107) (-1037.219) * (-1056.111) (-1044.528) (-1053.139) [-1045.978] -- 0:00:44
Average standard deviation of split frequencies: 0.005611
865500 -- (-1046.885) (-1055.792) [-1037.389] (-1042.189) * (-1063.304) (-1050.017) [-1041.551] (-1058.076) -- 0:00:44
866000 -- (-1044.322) (-1046.510) [-1034.862] (-1038.374) * (-1045.737) (-1048.370) (-1040.464) [-1035.782] -- 0:00:44
866500 -- (-1042.811) [-1048.111] (-1048.326) (-1052.739) * (-1043.081) [-1038.238] (-1055.266) (-1033.775) -- 0:00:43
867000 -- (-1052.524) (-1043.919) [-1045.306] (-1049.697) * (-1050.713) (-1045.291) [-1045.601] (-1038.683) -- 0:00:43
867500 -- [-1035.785] (-1046.806) (-1056.506) (-1048.615) * [-1038.430] (-1040.072) (-1059.101) (-1051.137) -- 0:00:43
868000 -- (-1045.142) (-1040.570) (-1049.978) [-1052.674] * (-1051.391) [-1037.782] (-1038.031) (-1045.389) -- 0:00:43
868500 -- (-1043.413) (-1044.703) [-1042.360] (-1040.246) * (-1040.678) [-1042.736] (-1054.798) (-1040.825) -- 0:00:43
869000 -- (-1042.364) (-1057.004) [-1044.792] (-1040.157) * [-1041.539] (-1054.262) (-1045.332) (-1043.814) -- 0:00:43
869500 -- (-1044.993) (-1046.270) (-1041.912) [-1041.262] * (-1060.614) (-1052.290) (-1050.214) [-1033.595] -- 0:00:42
870000 -- [-1047.547] (-1040.682) (-1047.737) (-1039.336) * (-1041.061) (-1050.059) (-1044.335) [-1043.823] -- 0:00:42
Average standard deviation of split frequencies: 0.005539
870500 -- (-1054.861) (-1064.667) (-1048.850) [-1044.192] * (-1048.725) (-1047.601) (-1049.411) [-1036.196] -- 0:00:42
871000 -- (-1035.427) (-1069.219) [-1035.540] (-1043.225) * (-1040.815) (-1055.075) [-1046.968] (-1049.637) -- 0:00:42
871500 -- (-1046.645) (-1057.032) [-1041.964] (-1053.381) * (-1048.486) [-1046.525] (-1045.266) (-1050.595) -- 0:00:42
872000 -- [-1038.493] (-1059.201) (-1043.174) (-1046.442) * (-1050.545) [-1040.980] (-1041.909) (-1056.833) -- 0:00:42
872500 -- (-1054.698) [-1038.184] (-1055.626) (-1042.395) * (-1040.457) [-1045.326] (-1048.404) (-1042.988) -- 0:00:41
873000 -- (-1034.583) [-1041.244] (-1041.209) (-1044.182) * [-1036.511] (-1042.495) (-1047.165) (-1053.971) -- 0:00:41
873500 -- [-1033.718] (-1040.796) (-1049.908) (-1041.894) * (-1045.239) [-1035.880] (-1040.524) (-1037.615) -- 0:00:41
874000 -- (-1049.157) [-1031.031] (-1055.626) (-1037.297) * (-1052.900) [-1039.634] (-1056.212) (-1052.148) -- 0:00:41
874500 -- (-1040.136) (-1040.452) [-1039.628] (-1054.229) * (-1045.414) (-1049.862) (-1047.832) [-1041.074] -- 0:00:41
875000 -- (-1049.493) (-1038.668) (-1049.186) [-1037.585] * (-1060.713) (-1053.944) [-1040.603] (-1049.757) -- 0:00:41
Average standard deviation of split frequencies: 0.005216
875500 -- [-1036.346] (-1055.478) (-1037.927) (-1037.704) * [-1046.483] (-1043.697) (-1054.016) (-1044.584) -- 0:00:40
876000 -- (-1046.313) (-1043.400) (-1054.883) [-1047.194] * (-1051.822) (-1044.405) (-1041.854) [-1036.198] -- 0:00:40
876500 -- (-1056.705) (-1040.743) [-1042.677] (-1043.710) * (-1044.820) [-1036.310] (-1032.006) (-1060.434) -- 0:00:40
877000 -- (-1051.262) (-1049.570) [-1051.621] (-1041.323) * (-1044.359) (-1055.304) [-1043.593] (-1054.738) -- 0:00:40
877500 -- (-1046.862) [-1045.821] (-1042.293) (-1048.169) * (-1041.001) [-1048.191] (-1034.428) (-1057.018) -- 0:00:40
878000 -- (-1049.766) [-1050.560] (-1040.451) (-1057.208) * (-1061.711) [-1048.182] (-1038.017) (-1049.327) -- 0:00:40
878500 -- (-1044.865) (-1050.605) [-1039.968] (-1056.439) * [-1034.179] (-1048.314) (-1049.898) (-1044.385) -- 0:00:39
879000 -- (-1040.303) (-1047.121) [-1030.670] (-1048.359) * (-1060.414) [-1043.209] (-1042.461) (-1038.723) -- 0:00:39
879500 -- (-1051.785) (-1043.540) (-1044.548) [-1049.274] * (-1052.795) [-1038.979] (-1042.203) (-1049.809) -- 0:00:39
880000 -- (-1040.915) (-1041.900) (-1042.383) [-1039.719] * (-1043.850) (-1055.089) (-1036.800) [-1036.951] -- 0:00:39
Average standard deviation of split frequencies: 0.005106
880500 -- [-1037.692] (-1041.028) (-1051.889) (-1039.953) * [-1040.725] (-1043.702) (-1044.021) (-1056.287) -- 0:00:39
881000 -- (-1032.365) [-1040.976] (-1041.687) (-1039.186) * (-1044.855) [-1045.229] (-1046.233) (-1047.457) -- 0:00:39
881500 -- (-1052.441) [-1039.816] (-1044.510) (-1039.194) * (-1052.267) [-1044.265] (-1043.210) (-1044.048) -- 0:00:38
882000 -- (-1043.367) (-1052.160) (-1049.816) [-1042.014] * (-1042.823) (-1041.932) (-1042.336) [-1052.334] -- 0:00:38
882500 -- (-1044.458) (-1050.379) (-1046.894) [-1047.160] * (-1039.084) [-1036.696] (-1036.692) (-1047.224) -- 0:00:38
883000 -- [-1055.226] (-1042.287) (-1047.889) (-1047.207) * [-1039.194] (-1045.949) (-1042.431) (-1045.923) -- 0:00:38
883500 -- (-1050.731) (-1035.048) (-1051.380) [-1034.575] * (-1044.410) (-1040.909) [-1043.902] (-1047.810) -- 0:00:38
884000 -- (-1044.662) (-1046.955) (-1052.147) [-1042.485] * (-1053.574) (-1045.062) [-1039.673] (-1048.110) -- 0:00:38
884500 -- (-1040.517) [-1041.377] (-1055.734) (-1051.476) * (-1052.691) (-1055.384) (-1050.293) [-1039.563] -- 0:00:37
885000 -- (-1041.365) (-1058.316) [-1045.385] (-1043.129) * (-1042.735) [-1036.061] (-1045.058) (-1047.088) -- 0:00:37
Average standard deviation of split frequencies: 0.004952
885500 -- (-1046.877) (-1054.026) (-1045.196) [-1044.520] * (-1042.489) [-1042.400] (-1053.129) (-1049.342) -- 0:00:37
886000 -- (-1037.969) (-1050.099) [-1040.277] (-1037.528) * (-1039.825) (-1041.825) (-1054.121) [-1039.805] -- 0:00:37
886500 -- (-1048.977) [-1039.864] (-1051.813) (-1041.199) * (-1061.177) [-1032.465] (-1044.180) (-1050.473) -- 0:00:37
887000 -- (-1051.926) (-1042.807) [-1038.237] (-1050.747) * (-1041.749) (-1042.045) [-1045.154] (-1050.962) -- 0:00:37
887500 -- (-1041.761) (-1047.306) [-1043.064] (-1040.340) * [-1042.589] (-1042.963) (-1053.342) (-1044.488) -- 0:00:37
888000 -- (-1044.367) (-1046.781) [-1037.760] (-1042.737) * [-1052.173] (-1044.344) (-1061.024) (-1041.930) -- 0:00:36
888500 -- (-1038.391) (-1042.564) [-1049.413] (-1057.410) * (-1054.154) [-1034.061] (-1053.102) (-1053.213) -- 0:00:36
889000 -- (-1047.512) (-1047.180) [-1034.304] (-1058.252) * (-1049.340) [-1037.403] (-1044.641) (-1040.105) -- 0:00:36
889500 -- (-1059.219) [-1042.420] (-1042.955) (-1045.141) * [-1045.652] (-1045.661) (-1043.490) (-1039.143) -- 0:00:36
890000 -- (-1047.366) (-1054.301) (-1036.273) [-1038.684] * [-1038.907] (-1042.394) (-1063.607) (-1036.902) -- 0:00:36
Average standard deviation of split frequencies: 0.005333
890500 -- (-1059.211) (-1046.201) [-1039.688] (-1039.211) * (-1050.902) (-1041.867) [-1037.257] (-1045.833) -- 0:00:36
891000 -- [-1039.847] (-1035.914) (-1052.372) (-1052.367) * (-1052.063) (-1052.353) (-1045.714) [-1035.259] -- 0:00:35
891500 -- [-1034.404] (-1045.632) (-1065.050) (-1054.920) * (-1059.595) (-1044.493) (-1037.484) [-1039.119] -- 0:00:35
892000 -- (-1051.895) [-1053.505] (-1046.348) (-1052.838) * [-1044.836] (-1039.506) (-1043.972) (-1052.493) -- 0:00:35
892500 -- (-1043.733) [-1050.071] (-1059.960) (-1043.031) * (-1035.009) (-1043.976) (-1044.694) [-1039.601] -- 0:00:35
893000 -- (-1033.744) [-1042.935] (-1053.771) (-1058.363) * (-1043.953) (-1057.363) (-1047.634) [-1036.629] -- 0:00:35
893500 -- [-1042.170] (-1041.833) (-1048.451) (-1055.470) * [-1041.126] (-1047.030) (-1051.185) (-1048.158) -- 0:00:35
894000 -- (-1055.030) [-1041.638] (-1048.689) (-1042.707) * [-1032.837] (-1046.324) (-1058.995) (-1040.788) -- 0:00:34
894500 -- [-1039.884] (-1050.102) (-1057.633) (-1060.009) * (-1039.792) (-1048.842) (-1050.685) [-1036.253] -- 0:00:34
895000 -- (-1042.714) (-1042.832) [-1041.690] (-1042.504) * [-1038.693] (-1053.046) (-1051.604) (-1042.031) -- 0:00:34
Average standard deviation of split frequencies: 0.005545
895500 -- (-1040.262) (-1052.995) (-1040.442) [-1050.793] * [-1038.246] (-1047.857) (-1043.041) (-1041.738) -- 0:00:34
896000 -- (-1040.869) (-1045.202) (-1043.178) [-1041.608] * (-1047.222) [-1049.905] (-1047.354) (-1037.946) -- 0:00:34
896500 -- (-1042.260) [-1039.304] (-1055.678) (-1054.794) * (-1054.525) (-1050.310) [-1042.767] (-1043.801) -- 0:00:34
897000 -- (-1053.394) [-1031.490] (-1040.671) (-1047.546) * (-1046.602) (-1054.020) (-1050.675) [-1037.871] -- 0:00:33
897500 -- (-1039.494) (-1055.905) [-1039.394] (-1039.208) * (-1049.713) (-1051.775) (-1044.562) [-1038.845] -- 0:00:33
898000 -- (-1049.234) (-1048.404) [-1042.710] (-1041.606) * (-1043.119) [-1038.083] (-1040.622) (-1047.041) -- 0:00:33
898500 -- [-1041.427] (-1052.327) (-1047.662) (-1039.806) * (-1035.867) (-1046.343) [-1042.310] (-1044.969) -- 0:00:33
899000 -- (-1046.766) (-1045.862) (-1034.501) [-1045.004] * (-1043.202) (-1044.248) (-1043.723) [-1046.776] -- 0:00:33
899500 -- (-1047.940) (-1046.715) (-1049.518) [-1042.141] * [-1042.093] (-1042.289) (-1045.842) (-1045.455) -- 0:00:33
900000 -- (-1057.579) (-1050.366) [-1040.748] (-1051.913) * (-1038.136) (-1045.700) [-1042.390] (-1038.271) -- 0:00:32
Average standard deviation of split frequencies: 0.005476
900500 -- (-1037.719) [-1039.948] (-1048.318) (-1051.885) * (-1047.102) (-1054.791) [-1038.010] (-1056.911) -- 0:00:32
901000 -- (-1039.070) [-1034.038] (-1053.565) (-1041.621) * [-1041.694] (-1045.157) (-1041.627) (-1054.094) -- 0:00:32
901500 -- (-1045.355) (-1038.476) (-1051.599) [-1041.801] * (-1056.038) (-1052.345) [-1042.292] (-1046.367) -- 0:00:32
902000 -- (-1045.080) (-1053.162) [-1039.893] (-1039.638) * (-1061.433) (-1051.448) (-1049.321) [-1053.592] -- 0:00:32
902500 -- (-1040.983) [-1032.330] (-1048.245) (-1050.740) * (-1055.079) (-1043.796) (-1070.075) [-1046.890] -- 0:00:32
903000 -- [-1045.282] (-1047.739) (-1052.132) (-1036.195) * (-1042.272) [-1052.380] (-1055.550) (-1052.178) -- 0:00:31
903500 -- [-1037.834] (-1050.993) (-1040.831) (-1035.667) * (-1049.315) (-1046.498) [-1045.379] (-1040.800) -- 0:00:31
904000 -- (-1049.356) [-1043.896] (-1048.541) (-1032.369) * (-1055.165) [-1040.827] (-1044.264) (-1043.523) -- 0:00:31
904500 -- (-1041.052) [-1041.261] (-1050.349) (-1041.585) * (-1051.293) (-1043.917) [-1045.160] (-1046.691) -- 0:00:31
905000 -- (-1043.937) (-1049.034) [-1044.365] (-1045.231) * (-1050.873) [-1039.189] (-1056.681) (-1040.125) -- 0:00:31
Average standard deviation of split frequencies: 0.005723
905500 -- [-1043.187] (-1052.242) (-1046.840) (-1045.967) * (-1048.558) [-1052.833] (-1053.477) (-1037.855) -- 0:00:31
906000 -- (-1046.879) [-1050.722] (-1050.527) (-1048.650) * (-1048.724) (-1050.920) (-1061.977) [-1031.524] -- 0:00:30
906500 -- (-1047.562) (-1055.646) [-1039.634] (-1053.906) * (-1041.935) [-1038.370] (-1036.142) (-1044.343) -- 0:00:30
907000 -- (-1042.539) [-1054.622] (-1043.944) (-1047.216) * (-1048.450) (-1058.592) (-1045.436) [-1034.387] -- 0:00:30
907500 -- (-1038.331) (-1053.927) (-1055.002) [-1039.724] * (-1049.618) (-1060.762) [-1034.736] (-1035.732) -- 0:00:30
908000 -- (-1043.182) (-1046.160) (-1059.408) [-1031.992] * (-1048.160) (-1042.479) [-1034.853] (-1035.934) -- 0:00:30
908500 -- (-1050.526) (-1050.244) (-1047.305) [-1034.209] * (-1040.689) (-1040.922) (-1035.011) [-1043.213] -- 0:00:30
909000 -- (-1048.520) [-1044.569] (-1054.108) (-1033.959) * (-1041.544) (-1065.486) [-1039.387] (-1034.357) -- 0:00:29
909500 -- (-1048.908) [-1045.073] (-1056.789) (-1047.568) * [-1040.097] (-1047.935) (-1051.442) (-1042.952) -- 0:00:29
910000 -- (-1057.454) (-1040.136) [-1040.776] (-1049.433) * [-1036.460] (-1051.525) (-1044.673) (-1058.049) -- 0:00:29
Average standard deviation of split frequencies: 0.006013
910500 -- (-1054.336) (-1048.233) (-1051.644) [-1044.246] * [-1039.656] (-1044.278) (-1045.703) (-1058.357) -- 0:00:29
911000 -- (-1041.493) [-1045.336] (-1057.441) (-1039.240) * (-1045.564) [-1048.688] (-1042.170) (-1044.567) -- 0:00:29
911500 -- (-1045.379) [-1043.286] (-1046.870) (-1058.457) * (-1044.457) (-1035.705) (-1046.493) [-1041.075] -- 0:00:29
912000 -- (-1041.437) (-1041.864) (-1051.398) [-1044.933] * (-1049.807) [-1042.993] (-1045.322) (-1053.575) -- 0:00:28
912500 -- [-1038.620] (-1054.944) (-1053.569) (-1044.084) * (-1053.008) [-1048.582] (-1043.090) (-1053.287) -- 0:00:28
913000 -- (-1046.219) (-1055.919) (-1060.299) [-1043.076] * (-1044.316) (-1044.723) [-1045.159] (-1039.756) -- 0:00:28
913500 -- (-1049.283) (-1048.413) [-1045.763] (-1047.551) * (-1050.501) (-1044.525) (-1043.997) [-1041.053] -- 0:00:28
914000 -- [-1050.597] (-1056.512) (-1053.557) (-1049.197) * (-1043.077) (-1048.711) [-1034.849] (-1038.404) -- 0:00:28
914500 -- (-1048.436) (-1067.938) [-1044.555] (-1066.918) * (-1053.902) (-1045.296) (-1045.611) [-1041.408] -- 0:00:28
915000 -- (-1044.454) (-1044.882) (-1038.210) [-1044.464] * (-1047.467) (-1041.097) (-1049.176) [-1039.065] -- 0:00:27
Average standard deviation of split frequencies: 0.006215
915500 -- (-1049.464) [-1038.355] (-1052.471) (-1032.615) * (-1049.911) (-1041.437) (-1050.464) [-1041.608] -- 0:00:27
916000 -- (-1049.147) (-1039.205) (-1043.268) [-1047.010] * (-1048.154) [-1043.845] (-1044.463) (-1042.872) -- 0:00:27
916500 -- (-1041.418) (-1031.522) [-1044.318] (-1040.620) * (-1035.075) (-1052.301) (-1042.734) [-1035.904] -- 0:00:27
917000 -- (-1040.000) (-1033.786) (-1049.577) [-1045.567] * (-1042.350) (-1045.317) (-1044.601) [-1041.758] -- 0:00:27
917500 -- [-1042.548] (-1043.343) (-1050.724) (-1041.710) * (-1045.431) (-1048.647) (-1045.284) [-1040.340] -- 0:00:27
918000 -- [-1041.787] (-1037.303) (-1051.816) (-1059.926) * (-1048.490) (-1042.995) (-1043.000) [-1046.595] -- 0:00:26
918500 -- (-1037.641) (-1043.679) (-1057.533) [-1042.725] * [-1044.553] (-1047.870) (-1049.794) (-1038.705) -- 0:00:26
919000 -- (-1032.035) [-1034.884] (-1055.803) (-1044.736) * (-1053.263) (-1038.907) (-1036.862) [-1041.650] -- 0:00:26
919500 -- [-1041.738] (-1047.540) (-1053.754) (-1046.848) * (-1041.815) (-1052.617) (-1047.991) [-1032.845] -- 0:00:26
920000 -- [-1043.587] (-1044.987) (-1058.765) (-1040.292) * (-1058.190) (-1043.289) (-1047.067) [-1044.250] -- 0:00:26
Average standard deviation of split frequencies: 0.006381
920500 -- (-1049.866) (-1044.692) (-1058.170) [-1038.589] * (-1046.686) (-1049.546) [-1043.431] (-1042.290) -- 0:00:26
921000 -- [-1036.379] (-1039.837) (-1060.530) (-1049.618) * (-1044.377) (-1048.225) (-1044.939) [-1048.072] -- 0:00:25
921500 -- (-1041.218) (-1038.334) (-1067.282) [-1040.316] * (-1046.213) [-1039.385] (-1039.815) (-1058.575) -- 0:00:25
922000 -- (-1039.645) (-1047.899) (-1053.323) [-1035.578] * (-1042.509) (-1051.203) [-1043.964] (-1048.570) -- 0:00:25
922500 -- (-1048.859) (-1037.928) (-1055.161) [-1041.041] * (-1051.936) [-1047.934] (-1042.188) (-1044.335) -- 0:00:25
923000 -- (-1039.488) (-1059.072) (-1051.274) [-1035.747] * [-1043.849] (-1037.040) (-1042.875) (-1049.071) -- 0:00:25
923500 -- (-1047.921) [-1031.402] (-1052.157) (-1045.354) * (-1054.592) (-1059.064) [-1038.801] (-1054.623) -- 0:00:25
924000 -- (-1043.284) [-1045.183] (-1047.176) (-1060.517) * (-1059.523) [-1042.948] (-1045.480) (-1051.755) -- 0:00:25
924500 -- (-1040.551) (-1040.431) [-1045.439] (-1056.243) * [-1047.193] (-1045.113) (-1040.099) (-1038.204) -- 0:00:24
925000 -- (-1046.261) [-1037.759] (-1040.903) (-1056.373) * (-1045.286) (-1053.653) (-1055.443) [-1038.543] -- 0:00:24
Average standard deviation of split frequencies: 0.006735
925500 -- [-1037.186] (-1053.268) (-1038.691) (-1053.786) * (-1040.642) (-1039.819) [-1049.641] (-1045.031) -- 0:00:24
926000 -- [-1035.175] (-1043.443) (-1045.542) (-1044.094) * (-1043.343) (-1042.737) [-1030.581] (-1052.349) -- 0:00:24
926500 -- [-1045.321] (-1045.341) (-1043.571) (-1039.022) * [-1050.549] (-1047.840) (-1038.531) (-1053.395) -- 0:00:24
927000 -- [-1051.884] (-1046.832) (-1054.182) (-1047.576) * [-1043.907] (-1049.982) (-1052.325) (-1050.210) -- 0:00:24
927500 -- [-1043.515] (-1033.804) (-1051.586) (-1048.246) * (-1051.918) (-1041.988) (-1053.508) [-1041.949] -- 0:00:23
928000 -- [-1045.514] (-1035.469) (-1048.401) (-1045.078) * (-1055.376) (-1044.476) [-1044.340] (-1040.349) -- 0:00:23
928500 -- (-1039.664) (-1046.528) (-1045.363) [-1041.473] * [-1050.527] (-1043.312) (-1044.286) (-1039.537) -- 0:00:23
929000 -- (-1036.220) (-1042.906) [-1043.549] (-1037.013) * (-1042.208) (-1047.316) (-1044.087) [-1038.079] -- 0:00:23
929500 -- (-1047.645) (-1044.782) [-1040.768] (-1050.072) * (-1046.613) [-1052.465] (-1043.798) (-1036.137) -- 0:00:23
930000 -- [-1039.035] (-1042.616) (-1045.061) (-1054.019) * (-1063.646) [-1039.453] (-1054.810) (-1043.505) -- 0:00:23
Average standard deviation of split frequencies: 0.006468
930500 -- (-1050.608) [-1039.593] (-1044.784) (-1049.825) * (-1044.404) (-1053.924) [-1041.594] (-1050.789) -- 0:00:22
931000 -- (-1043.254) (-1047.625) [-1039.940] (-1057.961) * (-1046.112) (-1061.391) [-1041.347] (-1054.854) -- 0:00:22
931500 -- (-1049.662) (-1042.965) [-1039.204] (-1038.751) * (-1040.876) (-1053.792) [-1038.129] (-1043.104) -- 0:00:22
932000 -- (-1034.284) [-1039.602] (-1038.859) (-1045.587) * [-1045.436] (-1058.922) (-1053.618) (-1043.327) -- 0:00:22
932500 -- (-1045.794) [-1037.343] (-1050.759) (-1042.166) * (-1047.561) (-1046.585) [-1037.400] (-1041.847) -- 0:00:22
933000 -- [-1036.243] (-1042.647) (-1052.145) (-1053.332) * (-1049.947) (-1051.748) [-1034.678] (-1047.644) -- 0:00:22
933500 -- (-1033.409) (-1054.599) (-1059.589) [-1045.530] * (-1042.691) [-1054.287] (-1054.988) (-1047.439) -- 0:00:21
934000 -- [-1047.663] (-1043.573) (-1051.795) (-1047.100) * (-1037.433) [-1050.110] (-1058.106) (-1048.159) -- 0:00:21
934500 -- (-1056.141) [-1044.463] (-1054.954) (-1039.061) * (-1061.474) (-1054.935) [-1040.526] (-1039.013) -- 0:00:21
935000 -- (-1044.898) [-1039.816] (-1063.700) (-1031.296) * (-1055.453) (-1046.954) (-1048.129) [-1036.925] -- 0:00:21
Average standard deviation of split frequencies: 0.006780
935500 -- (-1046.154) (-1056.058) [-1040.100] (-1031.999) * (-1041.491) (-1054.178) (-1049.340) [-1047.965] -- 0:00:21
936000 -- (-1052.042) (-1039.862) (-1038.524) [-1040.119] * (-1047.395) (-1048.409) (-1046.175) [-1040.948] -- 0:00:21
936500 -- (-1040.827) (-1041.254) [-1037.695] (-1048.736) * [-1045.137] (-1039.664) (-1050.015) (-1040.561) -- 0:00:20
937000 -- (-1044.290) (-1055.299) [-1053.514] (-1045.248) * (-1035.781) [-1051.082] (-1037.540) (-1059.236) -- 0:00:20
937500 -- (-1046.248) (-1044.914) (-1040.717) [-1038.090] * (-1035.914) [-1037.615] (-1050.166) (-1037.658) -- 0:00:20
938000 -- (-1058.226) [-1040.940] (-1037.381) (-1046.967) * (-1034.309) [-1038.176] (-1042.756) (-1052.321) -- 0:00:20
938500 -- (-1051.734) (-1047.999) [-1039.150] (-1045.504) * [-1040.163] (-1051.217) (-1044.675) (-1051.090) -- 0:00:20
939000 -- (-1044.764) (-1042.008) (-1042.881) [-1037.196] * [-1039.429] (-1053.669) (-1040.034) (-1052.218) -- 0:00:20
939500 -- (-1040.566) (-1048.802) [-1047.259] (-1052.320) * (-1041.176) (-1033.392) [-1036.808] (-1039.851) -- 0:00:19
940000 -- (-1051.878) [-1048.317] (-1040.616) (-1053.229) * (-1045.150) (-1039.590) [-1037.936] (-1041.740) -- 0:00:19
Average standard deviation of split frequencies: 0.006939
940500 -- (-1041.589) (-1040.519) [-1039.619] (-1056.610) * (-1039.525) (-1033.343) (-1045.140) [-1034.737] -- 0:00:19
941000 -- (-1047.476) (-1048.417) [-1038.606] (-1055.453) * (-1041.261) (-1037.470) [-1036.266] (-1039.005) -- 0:00:19
941500 -- (-1042.144) [-1039.658] (-1058.520) (-1053.033) * (-1049.781) (-1044.856) (-1054.747) [-1039.005] -- 0:00:19
942000 -- (-1036.542) (-1054.741) (-1042.130) [-1049.128] * [-1041.637] (-1042.032) (-1036.154) (-1044.668) -- 0:00:19
942500 -- (-1036.515) (-1057.054) [-1042.065] (-1050.255) * (-1054.519) [-1033.402] (-1038.443) (-1057.866) -- 0:00:18
943000 -- [-1037.764] (-1057.293) (-1046.579) (-1051.282) * [-1042.522] (-1043.668) (-1049.587) (-1052.863) -- 0:00:18
943500 -- (-1044.575) (-1063.694) [-1042.222] (-1046.093) * (-1043.657) (-1041.221) (-1036.951) [-1037.426] -- 0:00:18
944000 -- [-1035.212] (-1047.312) (-1037.050) (-1041.896) * [-1045.009] (-1043.017) (-1049.069) (-1052.944) -- 0:00:18
944500 -- [-1046.524] (-1054.934) (-1039.795) (-1054.648) * (-1049.378) (-1053.453) [-1041.637] (-1065.431) -- 0:00:18
945000 -- (-1055.250) (-1047.232) [-1040.314] (-1042.174) * (-1053.540) [-1055.400] (-1038.184) (-1053.399) -- 0:00:18
Average standard deviation of split frequencies: 0.007015
945500 -- (-1051.810) [-1041.132] (-1049.938) (-1044.904) * (-1048.511) [-1036.701] (-1059.907) (-1052.469) -- 0:00:17
946000 -- (-1054.040) (-1053.254) [-1046.362] (-1052.009) * [-1040.080] (-1045.155) (-1069.157) (-1046.400) -- 0:00:17
946500 -- (-1041.608) [-1039.288] (-1047.169) (-1046.559) * (-1044.803) (-1043.836) [-1046.107] (-1060.246) -- 0:00:17
947000 -- (-1038.298) (-1070.314) [-1037.585] (-1050.711) * (-1053.467) (-1042.957) [-1043.904] (-1046.467) -- 0:00:17
947500 -- (-1048.580) (-1057.448) (-1037.865) [-1039.461] * (-1042.660) (-1041.117) [-1050.629] (-1040.217) -- 0:00:17
948000 -- (-1048.181) (-1048.178) (-1040.887) [-1035.467] * (-1045.779) [-1042.694] (-1050.792) (-1047.583) -- 0:00:17
948500 -- [-1052.921] (-1055.800) (-1039.318) (-1046.559) * [-1034.846] (-1047.107) (-1049.033) (-1051.191) -- 0:00:16
949000 -- (-1048.851) (-1055.418) [-1038.427] (-1038.108) * [-1044.478] (-1050.124) (-1040.544) (-1059.519) -- 0:00:16
949500 -- (-1054.768) (-1049.680) (-1035.025) [-1033.134] * (-1051.434) (-1063.560) [-1036.258] (-1045.480) -- 0:00:16
950000 -- (-1044.133) [-1044.061] (-1045.413) (-1046.577) * (-1044.094) [-1051.703] (-1043.414) (-1057.939) -- 0:00:16
Average standard deviation of split frequencies: 0.007018
950500 -- (-1046.419) (-1047.623) (-1048.429) [-1040.674] * (-1040.534) (-1054.310) (-1048.876) [-1038.366] -- 0:00:16
951000 -- [-1043.292] (-1048.569) (-1052.859) (-1053.865) * [-1052.358] (-1048.293) (-1040.352) (-1056.308) -- 0:00:16
951500 -- (-1044.081) (-1039.898) [-1050.165] (-1036.694) * (-1061.433) (-1040.684) [-1042.612] (-1038.034) -- 0:00:15
952000 -- (-1047.427) (-1036.347) (-1039.233) [-1047.879] * [-1050.342] (-1041.509) (-1037.103) (-1054.772) -- 0:00:15
952500 -- (-1041.010) [-1034.631] (-1039.143) (-1047.356) * [-1051.734] (-1049.441) (-1041.051) (-1042.163) -- 0:00:15
953000 -- [-1039.430] (-1051.365) (-1053.654) (-1045.137) * (-1051.306) [-1044.249] (-1046.914) (-1051.559) -- 0:00:15
953500 -- (-1048.275) (-1050.171) (-1034.369) [-1051.438] * (-1048.376) (-1052.396) (-1044.869) [-1051.762] -- 0:00:15
954000 -- (-1045.905) (-1042.279) (-1047.415) [-1046.138] * (-1061.434) (-1042.935) (-1055.663) [-1037.825] -- 0:00:15
954500 -- (-1051.716) (-1048.379) (-1051.888) [-1045.881] * (-1056.174) (-1050.747) (-1068.438) [-1041.243] -- 0:00:14
955000 -- (-1039.436) (-1048.907) (-1058.933) [-1046.561] * (-1054.402) [-1037.005] (-1043.083) (-1041.884) -- 0:00:14
Average standard deviation of split frequencies: 0.006714
955500 -- (-1050.593) [-1039.743] (-1061.682) (-1037.102) * (-1045.956) [-1039.791] (-1044.881) (-1043.644) -- 0:00:14
956000 -- (-1046.241) (-1049.602) (-1054.757) [-1042.678] * (-1045.782) (-1053.059) (-1051.725) [-1042.263] -- 0:00:14
956500 -- [-1047.372] (-1042.727) (-1058.835) (-1040.632) * [-1039.469] (-1041.571) (-1053.358) (-1049.452) -- 0:00:14
957000 -- (-1056.829) [-1038.645] (-1046.583) (-1039.251) * (-1047.108) (-1038.598) (-1045.341) [-1047.910] -- 0:00:14
957500 -- (-1043.938) [-1039.451] (-1055.330) (-1042.255) * (-1056.171) [-1042.927] (-1040.339) (-1043.842) -- 0:00:13
958000 -- (-1048.510) (-1043.860) [-1049.920] (-1048.295) * (-1061.110) (-1041.385) (-1049.136) [-1040.842] -- 0:00:13
958500 -- (-1039.325) [-1037.989] (-1044.449) (-1059.686) * (-1048.988) [-1037.682] (-1047.537) (-1047.380) -- 0:00:13
959000 -- (-1045.542) (-1046.253) [-1048.582] (-1050.823) * (-1046.187) [-1039.843] (-1050.055) (-1037.955) -- 0:00:13
959500 -- (-1048.523) [-1047.334] (-1040.999) (-1054.222) * (-1042.124) [-1038.778] (-1041.740) (-1038.326) -- 0:00:13
960000 -- (-1058.609) [-1045.112] (-1040.179) (-1051.534) * (-1057.025) (-1036.840) [-1036.010] (-1043.642) -- 0:00:13
Average standard deviation of split frequencies: 0.006568
960500 -- (-1051.300) (-1043.437) (-1040.806) [-1045.427] * (-1048.573) (-1046.983) (-1052.133) [-1053.980] -- 0:00:12
961000 -- (-1046.235) [-1039.630] (-1040.011) (-1056.832) * (-1047.944) [-1039.772] (-1054.371) (-1043.512) -- 0:00:12
961500 -- (-1059.168) (-1051.545) [-1048.768] (-1049.546) * (-1051.266) [-1036.896] (-1044.229) (-1043.490) -- 0:00:12
962000 -- (-1048.234) (-1059.772) [-1046.080] (-1046.125) * [-1040.605] (-1060.233) (-1048.535) (-1043.219) -- 0:00:12
962500 -- (-1043.975) (-1043.182) (-1038.097) [-1049.841] * (-1041.353) (-1049.291) [-1042.203] (-1041.874) -- 0:00:12
963000 -- [-1042.695] (-1043.883) (-1053.843) (-1039.671) * (-1041.133) (-1044.257) (-1045.573) [-1037.540] -- 0:00:12
963500 -- [-1043.761] (-1053.390) (-1049.198) (-1040.917) * [-1042.083] (-1051.747) (-1040.605) (-1043.305) -- 0:00:12
964000 -- [-1045.218] (-1044.377) (-1056.165) (-1050.922) * (-1043.927) (-1045.383) (-1042.349) [-1041.523] -- 0:00:11
964500 -- [-1057.402] (-1038.006) (-1041.090) (-1045.093) * (-1048.133) [-1035.280] (-1045.999) (-1044.852) -- 0:00:11
965000 -- (-1058.551) (-1043.892) (-1041.124) [-1038.673] * (-1040.773) [-1043.470] (-1064.078) (-1039.173) -- 0:00:11
Average standard deviation of split frequencies: 0.006607
965500 -- (-1045.548) (-1046.544) (-1052.552) [-1042.009] * (-1042.946) [-1036.673] (-1048.255) (-1047.227) -- 0:00:11
966000 -- (-1043.057) (-1053.241) (-1033.316) [-1045.274] * (-1045.040) (-1056.032) [-1047.395] (-1044.832) -- 0:00:11
966500 -- (-1044.957) (-1040.179) [-1052.192] (-1044.250) * [-1037.387] (-1041.462) (-1035.690) (-1040.313) -- 0:00:10
967000 -- [-1039.414] (-1050.992) (-1040.808) (-1039.107) * (-1048.431) [-1039.177] (-1040.132) (-1045.244) -- 0:00:10
967500 -- [-1040.082] (-1042.249) (-1041.312) (-1048.292) * (-1054.118) (-1036.462) [-1040.682] (-1037.886) -- 0:00:10
968000 -- (-1048.186) (-1044.814) (-1037.095) [-1043.796] * (-1040.424) (-1033.112) [-1044.334] (-1046.698) -- 0:00:10
968500 -- [-1039.045] (-1048.511) (-1050.147) (-1051.631) * (-1039.925) (-1044.487) [-1044.523] (-1046.424) -- 0:00:10
969000 -- (-1047.166) [-1043.112] (-1043.458) (-1048.771) * [-1035.028] (-1050.588) (-1050.117) (-1042.445) -- 0:00:10
969500 -- (-1043.632) (-1045.676) [-1033.111] (-1040.734) * [-1042.392] (-1051.930) (-1043.401) (-1052.238) -- 0:00:10
970000 -- (-1040.251) [-1041.493] (-1046.520) (-1041.259) * [-1040.841] (-1041.851) (-1045.457) (-1050.473) -- 0:00:09
Average standard deviation of split frequencies: 0.006538
970500 -- (-1043.730) (-1049.304) (-1045.564) [-1038.527] * (-1038.510) [-1042.988] (-1040.485) (-1054.752) -- 0:00:09
971000 -- (-1042.479) (-1042.318) (-1041.382) [-1047.346] * [-1040.407] (-1044.926) (-1050.848) (-1060.843) -- 0:00:09
971500 -- [-1038.179] (-1052.213) (-1045.732) (-1043.442) * [-1044.401] (-1050.524) (-1037.385) (-1047.990) -- 0:00:09
972000 -- [-1037.287] (-1058.484) (-1045.617) (-1052.572) * (-1044.127) (-1050.089) (-1045.658) [-1039.382] -- 0:00:09
972500 -- (-1038.521) (-1045.733) [-1039.004] (-1038.874) * [-1043.018] (-1041.884) (-1049.017) (-1041.275) -- 0:00:09
973000 -- [-1048.996] (-1055.764) (-1036.935) (-1043.592) * [-1041.681] (-1056.479) (-1048.171) (-1054.223) -- 0:00:08
973500 -- (-1047.031) (-1046.473) (-1040.796) [-1044.297] * (-1047.161) (-1049.092) (-1052.515) [-1039.483] -- 0:00:08
974000 -- (-1052.698) (-1048.541) (-1040.335) [-1038.490] * (-1062.955) (-1047.532) (-1042.209) [-1041.652] -- 0:00:08
974500 -- (-1046.157) (-1040.440) [-1035.296] (-1045.037) * (-1047.172) (-1038.919) (-1053.991) [-1033.905] -- 0:00:08
975000 -- [-1049.568] (-1049.799) (-1044.027) (-1047.847) * (-1049.501) (-1047.796) (-1051.621) [-1042.262] -- 0:00:08
Average standard deviation of split frequencies: 0.006613
975500 -- (-1046.475) [-1041.791] (-1043.397) (-1054.583) * (-1056.969) (-1051.836) (-1052.063) [-1040.953] -- 0:00:08
976000 -- (-1048.311) (-1045.412) [-1041.240] (-1049.806) * [-1038.150] (-1056.683) (-1059.761) (-1038.494) -- 0:00:07
976500 -- (-1042.044) (-1045.044) [-1039.537] (-1046.117) * (-1044.169) [-1045.697] (-1062.060) (-1044.879) -- 0:00:07
977000 -- [-1040.874] (-1039.541) (-1043.323) (-1046.766) * [-1045.120] (-1048.251) (-1042.405) (-1032.791) -- 0:00:07
977500 -- (-1043.243) [-1041.606] (-1049.744) (-1046.529) * (-1042.391) [-1038.498] (-1036.451) (-1042.846) -- 0:00:07
978000 -- (-1041.750) [-1035.288] (-1049.879) (-1050.709) * (-1042.289) (-1056.576) [-1047.122] (-1054.810) -- 0:00:07
978500 -- (-1041.302) [-1041.033] (-1041.073) (-1041.402) * (-1047.391) (-1041.487) [-1049.837] (-1038.957) -- 0:00:07
979000 -- [-1043.352] (-1042.362) (-1057.711) (-1047.130) * (-1044.883) (-1050.636) (-1042.520) [-1036.993] -- 0:00:06
979500 -- (-1042.682) [-1041.099] (-1062.367) (-1040.195) * (-1046.938) (-1041.189) [-1040.267] (-1051.991) -- 0:00:06
980000 -- (-1042.799) [-1033.330] (-1042.726) (-1048.080) * (-1049.890) (-1041.643) (-1042.728) [-1041.141] -- 0:00:06
Average standard deviation of split frequencies: 0.006582
980500 -- (-1048.877) [-1042.875] (-1044.570) (-1063.522) * (-1041.322) (-1041.970) [-1034.080] (-1056.925) -- 0:00:06
981000 -- (-1054.361) (-1036.776) [-1041.636] (-1050.745) * [-1041.922] (-1044.260) (-1047.427) (-1052.582) -- 0:00:06
981500 -- (-1040.769) (-1045.249) [-1044.593] (-1042.005) * (-1055.674) [-1053.378] (-1039.968) (-1042.881) -- 0:00:06
982000 -- (-1045.413) (-1043.912) [-1044.685] (-1047.170) * (-1051.457) [-1042.019] (-1049.442) (-1056.086) -- 0:00:05
982500 -- (-1049.257) (-1043.333) (-1040.384) [-1044.056] * (-1047.135) (-1055.617) (-1034.637) [-1042.924] -- 0:00:05
983000 -- (-1049.482) (-1045.186) [-1050.962] (-1042.514) * [-1045.648] (-1061.415) (-1043.979) (-1054.754) -- 0:00:05
983500 -- (-1054.368) [-1042.828] (-1037.591) (-1038.882) * (-1045.120) (-1046.011) (-1047.997) [-1044.055] -- 0:00:05
984000 -- [-1043.771] (-1044.659) (-1051.003) (-1044.009) * (-1039.916) [-1035.454] (-1044.571) (-1044.299) -- 0:00:05
984500 -- (-1030.421) [-1035.409] (-1041.906) (-1047.732) * (-1051.488) [-1038.164] (-1041.417) (-1056.415) -- 0:00:05
985000 -- [-1037.430] (-1051.279) (-1064.647) (-1055.617) * (-1052.985) (-1054.652) (-1043.761) [-1044.698] -- 0:00:04
Average standard deviation of split frequencies: 0.006657
985500 -- [-1045.329] (-1051.523) (-1044.073) (-1040.450) * (-1046.757) [-1036.774] (-1065.700) (-1050.807) -- 0:00:04
986000 -- (-1047.199) [-1047.561] (-1034.873) (-1039.885) * (-1052.458) (-1040.231) (-1036.390) [-1044.422] -- 0:00:04
986500 -- (-1039.987) [-1046.553] (-1043.636) (-1049.668) * (-1047.441) (-1046.177) (-1047.948) [-1043.599] -- 0:00:04
987000 -- [-1044.936] (-1041.349) (-1052.998) (-1039.269) * (-1059.644) [-1042.393] (-1042.076) (-1036.957) -- 0:00:04
987500 -- [-1041.093] (-1049.826) (-1050.381) (-1042.393) * (-1047.736) (-1049.892) (-1045.783) [-1051.687] -- 0:00:04
988000 -- (-1059.192) (-1046.876) (-1048.335) [-1042.126] * (-1045.029) [-1042.776] (-1034.453) (-1057.743) -- 0:00:03
988500 -- (-1051.887) (-1050.537) [-1034.531] (-1050.031) * (-1040.351) [-1036.686] (-1041.159) (-1052.810) -- 0:00:03
989000 -- [-1052.630] (-1056.366) (-1039.229) (-1053.991) * [-1038.999] (-1043.509) (-1043.428) (-1039.198) -- 0:00:03
989500 -- (-1041.185) (-1044.832) [-1045.147] (-1048.548) * (-1046.202) (-1054.081) [-1035.890] (-1036.150) -- 0:00:03
990000 -- [-1044.150] (-1039.390) (-1043.599) (-1058.744) * (-1043.209) (-1044.636) [-1043.403] (-1038.151) -- 0:00:03
Average standard deviation of split frequencies: 0.007101
990500 -- [-1043.819] (-1046.770) (-1045.548) (-1045.403) * (-1049.562) [-1053.529] (-1053.755) (-1053.129) -- 0:00:03
991000 -- [-1043.051] (-1052.828) (-1039.766) (-1045.041) * (-1062.355) [-1042.323] (-1048.093) (-1052.054) -- 0:00:02
991500 -- (-1051.601) (-1055.894) [-1041.832] (-1044.441) * (-1042.089) (-1046.650) (-1039.405) [-1046.342] -- 0:00:02
992000 -- (-1052.057) (-1044.865) (-1039.875) [-1039.658] * (-1037.567) [-1047.185] (-1045.452) (-1053.269) -- 0:00:02
992500 -- (-1043.413) (-1043.325) [-1039.140] (-1044.503) * (-1044.000) (-1048.655) (-1050.643) [-1046.871] -- 0:00:02
993000 -- (-1047.092) [-1042.860] (-1038.412) (-1060.007) * [-1036.308] (-1049.737) (-1049.499) (-1036.381) -- 0:00:02
993500 -- (-1040.979) (-1041.979) (-1052.772) [-1036.927] * (-1038.283) (-1047.943) [-1045.458] (-1037.804) -- 0:00:02
994000 -- (-1045.449) (-1042.882) (-1047.361) [-1039.676] * (-1064.273) [-1039.716] (-1047.092) (-1045.401) -- 0:00:01
994500 -- [-1043.723] (-1051.213) (-1052.535) (-1055.005) * (-1055.390) (-1059.162) (-1043.548) [-1037.247] -- 0:00:01
995000 -- (-1057.871) [-1044.494] (-1047.732) (-1042.467) * (-1047.305) [-1047.382] (-1049.962) (-1048.260) -- 0:00:01
Average standard deviation of split frequencies: 0.007063
995500 -- (-1037.813) (-1043.420) [-1045.380] (-1054.167) * (-1040.019) (-1046.532) [-1037.555] (-1049.602) -- 0:00:01
996000 -- (-1045.236) (-1049.394) (-1049.901) [-1039.377] * (-1047.993) [-1043.724] (-1041.937) (-1035.304) -- 0:00:01
996500 -- (-1041.434) [-1057.948] (-1055.703) (-1040.582) * (-1037.052) [-1044.376] (-1056.922) (-1046.751) -- 0:00:01
997000 -- (-1047.095) [-1056.121] (-1060.128) (-1040.956) * (-1041.437) (-1040.733) (-1054.588) [-1046.979] -- 0:00:00
997500 -- (-1047.372) (-1051.030) (-1059.505) [-1039.439] * [-1037.528] (-1045.566) (-1053.662) (-1040.380) -- 0:00:00
998000 -- (-1057.822) (-1064.661) (-1048.223) [-1037.610] * (-1039.138) (-1040.456) [-1043.540] (-1037.171) -- 0:00:00
998500 -- (-1062.915) (-1043.289) [-1041.766] (-1042.838) * [-1039.708] (-1042.136) (-1051.372) (-1036.243) -- 0:00:00
999000 -- (-1044.605) (-1052.795) [-1036.172] (-1043.925) * [-1037.752] (-1045.603) (-1043.516) (-1043.644) -- 0:00:00
999500 -- (-1051.406) [-1042.060] (-1048.480) (-1042.252) * (-1035.392) (-1042.287) [-1036.553] (-1046.283) -- 0:00:00
1000000 -- (-1049.752) (-1043.491) [-1044.127] (-1048.044) * (-1048.950) [-1038.825] (-1037.845) (-1061.763) -- 0:00:00
Average standard deviation of split frequencies: 0.007392
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1049.751709 -- 22.693933
Chain 1 -- -1049.751705 -- 22.693933
Chain 2 -- -1043.490974 -- 23.755325
Chain 2 -- -1043.490975 -- 23.755325
Chain 3 -- -1044.126545 -- 24.504339
Chain 3 -- -1044.126541 -- 24.504339
Chain 4 -- -1048.044412 -- 21.835916
Chain 4 -- -1048.044411 -- 21.835916
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1048.949946 -- 16.854640
Chain 1 -- -1048.949950 -- 16.854640
Chain 2 -- -1038.824899 -- 18.037902
Chain 2 -- -1038.824904 -- 18.037902
Chain 3 -- -1037.845225 -- 22.364167
Chain 3 -- -1037.845219 -- 22.364167
Chain 4 -- -1061.763208 -- 17.522289
Chain 4 -- -1061.763202 -- 17.522289
Analysis completed in 5 mins 28 seconds
Analysis used 328.67 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1026.62
Likelihood of best state for "cold" chain of run 2 was -1026.98
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
50.7 % ( 37 %) Dirichlet(Revmat{all})
65.7 % ( 58 %) Slider(Revmat{all})
31.9 % ( 29 %) Dirichlet(Pi{all})
32.2 % ( 16 %) Slider(Pi{all})
36.5 % ( 22 %) Multiplier(Alpha{1,2})
46.9 % ( 25 %) Multiplier(Alpha{3})
61.9 % ( 36 %) Slider(Pinvar{all})
12.8 % ( 14 %) ExtSPR(Tau{all},V{all})
3.6 % ( 1 %) ExtTBR(Tau{all},V{all})
19.8 % ( 26 %) NNI(Tau{all},V{all})
13.8 % ( 18 %) ParsSPR(Tau{all},V{all})
27.0 % ( 34 %) Multiplier(V{all})
53.7 % ( 57 %) Nodeslider(V{all})
25.8 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
51.5 % ( 40 %) Dirichlet(Revmat{all})
65.9 % ( 48 %) Slider(Revmat{all})
31.9 % ( 20 %) Dirichlet(Pi{all})
32.1 % ( 26 %) Slider(Pi{all})
36.6 % ( 29 %) Multiplier(Alpha{1,2})
46.5 % ( 24 %) Multiplier(Alpha{3})
61.6 % ( 43 %) Slider(Pinvar{all})
12.7 % ( 10 %) ExtSPR(Tau{all},V{all})
3.7 % ( 1 %) ExtTBR(Tau{all},V{all})
19.6 % ( 23 %) NNI(Tau{all},V{all})
14.0 % ( 11 %) ParsSPR(Tau{all},V{all})
27.0 % ( 29 %) Multiplier(V{all})
53.6 % ( 59 %) Nodeslider(V{all})
25.7 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.71 0.47 0.28
2 | 166576 0.72 0.49
3 | 166477 166899 0.74
4 | 166662 166743 166643
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.71 0.47 0.29
2 | 167056 0.72 0.49
3 | 165974 166849 0.74
4 | 166804 167124 166193
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1039.04
| 1 1 |
| 22 1 1 |
| 1 1 2 2 2 2 |
| 1 2 21 12 1 2 1 21 2 |
| 2 2 2 1 2 1 2 2 |
|2 122 22 1 2 1 2 1 11 2 2 1 1 |
| 2 2 11 1 1 * * 122 |
| 1 1 2 2 2 2 1 1111 |
| 2 2 12 1 2 1 2 2 2 |
|1 * 1 1 1 *1 1 21 1 2 *2|
| 2 2 1 1 1 1 2 1 1 |
| 1 2 1 2 2 1|
| 2 2 2 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1044.28
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1034.90 -1053.40
2 -1035.07 -1058.14
--------------------------------------
TOTAL -1034.98 -1057.45
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.863136 0.021989 0.599122 1.171308 0.847059 1227.64 1273.68 1.000
r(A<->C){all} 0.058287 0.000649 0.015551 0.111912 0.054851 539.14 625.23 1.003
r(A<->G){all} 0.159413 0.002739 0.065851 0.261017 0.152574 548.35 590.34 1.000
r(A<->T){all} 0.148576 0.004208 0.029406 0.273836 0.141780 351.68 390.19 1.000
r(C<->G){all} 0.027806 0.000157 0.005802 0.052689 0.026196 885.66 886.53 1.000
r(C<->T){all} 0.563357 0.007302 0.400954 0.724100 0.563382 480.71 486.62 1.000
r(G<->T){all} 0.042561 0.000589 0.004372 0.091429 0.037802 771.67 941.43 1.002
pi(A){all} 0.264085 0.000514 0.221633 0.310340 0.263245 961.17 1032.97 1.000
pi(C){all} 0.320399 0.000584 0.272469 0.368952 0.320476 1075.12 1103.42 1.000
pi(G){all} 0.296258 0.000531 0.249833 0.340095 0.296015 1240.91 1302.34 1.000
pi(T){all} 0.119259 0.000288 0.088493 0.153409 0.118241 922.32 998.44 1.000
alpha{1,2} 0.107837 0.000753 0.061004 0.165277 0.105908 1156.75 1224.56 1.000
alpha{3} 2.155340 0.650239 0.820605 3.719296 2.017830 1007.36 1199.36 1.000
pinvar{all} 0.326241 0.007543 0.147511 0.490026 0.330972 1122.50 1175.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- ......**....
14 -- .....***....
15 -- .........***
16 -- .....*******
17 -- ...**.......
18 -- ...*********
19 -- ..........**
20 -- .**.........
21 -- .....***.***
22 -- ........****
23 -- .....****...
24 -- ..**********
25 -- .*.*********
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 2996 0.998001 0.001884 0.996669 0.999334 2
14 2980 0.992672 0.002827 0.990673 0.994670 2
15 2949 0.982345 0.002355 0.980680 0.984011 2
16 2908 0.968688 0.001884 0.967355 0.970020 2
17 2646 0.881412 0.021670 0.866089 0.896736 2
18 2618 0.872085 0.015075 0.861426 0.882745 2
19 2545 0.847768 0.017430 0.835443 0.860093 2
20 2042 0.680213 0.009422 0.673551 0.686875 2
21 1488 0.495670 0.000942 0.495003 0.496336 2
22 884 0.294470 0.007537 0.289141 0.299800 2
23 594 0.197868 0.000942 0.197202 0.198534 2
24 472 0.157229 0.010364 0.149900 0.164557 2
25 448 0.149234 0.003769 0.146569 0.151899 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.028864 0.000213 0.005490 0.057651 0.026305 1.000 2
length{all}[2] 0.011579 0.000072 0.000088 0.028092 0.009536 1.000 2
length{all}[3] 0.005916 0.000039 0.000001 0.017691 0.004034 1.000 2
length{all}[4] 0.044109 0.000427 0.011908 0.084425 0.040467 1.000 2
length{all}[5] 0.049638 0.000453 0.013307 0.091210 0.046154 1.000 2
length{all}[6] 0.034989 0.000314 0.007081 0.071668 0.032207 1.000 2
length{all}[7] 0.011387 0.000105 0.000003 0.031260 0.008724 1.000 2
length{all}[8] 0.044767 0.000404 0.012127 0.087123 0.041355 1.000 2
length{all}[9] 0.124997 0.001557 0.056087 0.202383 0.119603 1.000 2
length{all}[10] 0.119836 0.001702 0.048440 0.201885 0.114755 1.000 2
length{all}[11] 0.068602 0.000914 0.021405 0.132317 0.063379 1.000 2
length{all}[12] 0.102142 0.001363 0.035426 0.171798 0.096334 1.000 2
length{all}[13] 0.030264 0.000260 0.004459 0.061519 0.027642 1.000 2
length{all}[14] 0.025946 0.000264 0.002053 0.056931 0.022872 1.000 2
length{all}[15] 0.046054 0.000655 0.006645 0.096520 0.041710 1.000 2
length{all}[16] 0.024310 0.000238 0.001276 0.054833 0.021146 1.000 2
length{all}[17] 0.019686 0.000188 0.000249 0.047001 0.016627 1.000 2
length{all}[18] 0.018313 0.000165 0.000049 0.042511 0.015679 1.000 2
length{all}[19] 0.036894 0.000600 0.000003 0.083729 0.032179 1.000 2
length{all}[20] 0.011259 0.000083 0.000002 0.028913 0.009165 1.000 2
length{all}[21] 0.013460 0.000147 0.000017 0.036676 0.010198 0.999 2
length{all}[22] 0.012766 0.000155 0.000001 0.039067 0.008630 1.000 2
length{all}[23] 0.008781 0.000088 0.000029 0.027973 0.005376 0.998 2
length{all}[24] 0.005987 0.000036 0.000030 0.018944 0.004355 1.010 2
length{all}[25] 0.005818 0.000038 0.000017 0.016602 0.004245 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007392
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /-------------- C4 (4)
| /--------------------88-------------------+
| | \-------------- C5 (5)
| |
| | /---------------------------- C6 (6)
| | |
|------87-----+ /------99-----+ /-------------- C7 (7)
| | | \-----100-----+
| | | \-------------- C8 (8)
+ | |
| \------97-----+------------------------------------------ C9 (9)
| |
| | /---------------------------- C10 (10)
| | |
| \------98-----+ /-------------- C11 (11)
| \------85-----+
| \-------------- C12 (12)
|
| /-------------- C2 (2)
\---------------------------68--------------------------+
\-------------- C3 (3)
Phylogram (based on average branch lengths):
/--------- C1 (1)
|
| /-------------- C4 (4)
| /-----+
| | \---------------- C5 (5)
| |
| | /----------- C6 (6)
| | |
|----+ /-------+ /-- C7 (7)
| | | \---------+
| | | \-------------- C8 (8)
+ | |
| \------+----------------------------------------- C9 (9)
| |
| | /-------------------------------------- C10 (10)
| | |
| \--------------+ /---------------------- C11 (11)
| \---------+
| \--------------------------------- C12 (12)
|
| /--- C2 (2)
\--+
\- C3 (3)
|---------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (248 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 54 trees
95 % credible set contains 111 trees
99 % credible set contains 218 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 360
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
3 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
3 ambiguity characters in seq. 7
3 ambiguity characters in seq. 8
3 ambiguity characters in seq. 9
3 ambiguity characters in seq. 10
3 ambiguity characters in seq. 11
6 ambiguity characters in seq. 12
3 sites are removed. 18 62 120
codon 38: TCC TCC TCC TCG TCC TCC TCC TCC AGC TCC TCC TCC
Sequences read..
Counting site patterns.. 0:00
85 patterns at 117 / 117 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
82960 bytes for conP
11560 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
373320 bytes for conP, adjusted
0.020714 0.010529 0.021873 0.049032 0.062133 0.026671 0.019356 0.046611 0.021494 0.015650 0.047051 0.161673 0.056281 0.147268 0.023193 0.085246 0.102944 0.005864 0.011044 0.000000 0.300000 1.300000
ntime & nrate & np: 20 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 22
lnL0 = -1175.942267
Iterating by ming2
Initial: fx= 1175.942267
x= 0.02071 0.01053 0.02187 0.04903 0.06213 0.02667 0.01936 0.04661 0.02149 0.01565 0.04705 0.16167 0.05628 0.14727 0.02319 0.08525 0.10294 0.00586 0.01104 0.00000 0.30000 1.30000
1 h-m-p 0.0000 0.0000 275.7947 ++ 1175.941754 m 0.0000 27 | 1/22
2 h-m-p 0.0000 0.0000 6312.0042 ++ 1172.281682 m 0.0000 52 | 2/22
3 h-m-p 0.0001 0.0004 263.0308 +CYYCYCCCC 1163.255175 8 0.0003 91 | 2/22
4 h-m-p 0.0000 0.0001 2107.2088 +YYYCYCCC 1148.657979 7 0.0001 127 | 2/22
5 h-m-p 0.0000 0.0000 3920.2488 +YYYCCC 1139.449446 5 0.0000 160 | 2/22
6 h-m-p 0.0000 0.0001 4381.5229 +YYYYC 1116.341250 4 0.0001 190 | 2/22
7 h-m-p 0.0000 0.0001 5717.1139 +YYCYYCC 1085.706332 6 0.0001 225 | 2/22
8 h-m-p 0.0000 0.0000 21062.7103 ++ 1046.233617 m 0.0000 250 | 2/22
9 h-m-p 0.0000 0.0000 219469.6610
h-m-p: 6.24312438e-23 3.12156219e-22 2.19469661e+05 1046.233617
.. | 2/22
10 h-m-p 0.0000 0.0006 3503.1366 +CYCCC 1033.092758 4 0.0000 305 | 2/22
11 h-m-p 0.0001 0.0006 426.7627 +YYYYCCCCC 987.622733 8 0.0005 343 | 2/22
12 h-m-p 0.0001 0.0006 141.7743 +CYCCC 982.622103 4 0.0005 376 | 2/22
13 h-m-p 0.0001 0.0003 305.0000 ++ 978.197934 m 0.0003 401 | 2/22
14 h-m-p 0.0000 0.0000 1137.5199 +YYCYCC 977.047422 5 0.0000 434 | 2/22
15 h-m-p 0.0000 0.0002 72.4084 YCCCC 976.863285 4 0.0001 466 | 2/22
16 h-m-p 0.0001 0.0017 58.6790 +YCCCC 975.891136 4 0.0009 499 | 2/22
17 h-m-p 0.0006 0.0028 96.3737 CCC 974.982925 2 0.0007 528 | 2/22
18 h-m-p 0.0003 0.0014 71.3519 YCCCC 974.404651 4 0.0006 560 | 2/22
19 h-m-p 0.0004 0.0140 105.3426 +YCCC 971.340812 3 0.0031 591 | 2/22
20 h-m-p 0.0004 0.0021 254.2881 YCCC 969.682940 3 0.0007 621 | 2/22
21 h-m-p 0.0004 0.0018 182.5765 +YCCC 967.520423 3 0.0012 652 | 2/22
22 h-m-p 0.0003 0.0016 230.0427 +YCCC 965.609207 3 0.0009 683 | 2/22
23 h-m-p 0.0002 0.0008 255.4682 +YCC 964.407262 2 0.0005 712 | 2/22
24 h-m-p 0.0008 0.0042 77.2052 CCCCC 963.789906 4 0.0010 745 | 2/22
25 h-m-p 0.0011 0.0056 19.1527 YCC 963.715708 2 0.0007 773 | 1/22
26 h-m-p 0.0004 0.0121 32.9658 CYC 963.674972 2 0.0001 801 | 1/22
27 h-m-p 0.0003 0.0037 10.0125 +YC 963.647163 1 0.0008 828 | 1/22
28 h-m-p 0.0007 0.0034 1.4114 ++ 963.623587 m 0.0034 853 | 1/22
29 h-m-p 0.0018 0.0579 2.6033 +YCCC 963.294397 3 0.0141 884 | 1/22
30 h-m-p 0.0016 0.0120 22.9097 +YCCCC 960.544106 4 0.0090 917 | 1/22
31 h-m-p 0.0007 0.0035 51.7648 YCCCC 959.746148 4 0.0013 949 | 1/22
32 h-m-p 0.1960 4.9938 0.3514 +CYCC 958.517473 3 0.9902 980 | 1/22
33 h-m-p 0.7816 3.9081 0.4151 CYC 957.799204 2 0.8227 1029 | 1/22
34 h-m-p 0.6245 3.1226 0.3445 +YCCC 956.928146 3 1.7102 1081 | 1/22
35 h-m-p 1.6000 8.0000 0.1589 CCC 956.675399 2 1.5677 1131 | 1/22
36 h-m-p 1.6000 8.0000 0.1542 YCCC 956.349563 3 2.5736 1182 | 1/22
37 h-m-p 1.6000 8.0000 0.0746 YCCCC 955.743161 4 3.3860 1235 | 1/22
38 h-m-p 1.0842 5.7382 0.2331 CYCCC 955.072291 4 1.9605 1288 | 1/22
39 h-m-p 0.7796 3.8982 0.5372 YCC 954.939033 2 0.6009 1337 | 1/22
40 h-m-p 1.6000 8.0000 0.0641 YCC 954.880076 2 1.1803 1386 | 1/22
41 h-m-p 1.6000 8.0000 0.0044 CC 954.862794 1 1.7635 1434 | 1/22
42 h-m-p 0.1972 8.0000 0.0397 ++YC 954.847214 1 2.5083 1483 | 1/22
43 h-m-p 1.6000 8.0000 0.0078 CC 954.840582 1 1.4625 1531 | 1/22
44 h-m-p 1.6000 8.0000 0.0021 YC 954.840279 1 0.9749 1578 | 1/22
45 h-m-p 1.6000 8.0000 0.0004 Y 954.840263 0 1.1550 1624 | 1/22
46 h-m-p 1.6000 8.0000 0.0001 Y 954.840262 0 1.0753 1670 | 1/22
47 h-m-p 1.0242 8.0000 0.0001 C 954.840262 0 1.0242 1716 | 1/22
48 h-m-p 1.6000 8.0000 0.0000 -----C 954.840262 0 0.0004 1767
Out..
lnL = -954.840262
1768 lfun, 1768 eigenQcodon, 35360 P(t)
Time used: 0:10
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
0.021779 0.010723 0.020437 0.049287 0.060817 0.025835 0.019123 0.046414 0.020702 0.015408 0.046297 0.163024 0.057079 0.148668 0.023494 0.084757 0.102864 0.006000 0.010512 0.000000 3.916033 0.500545 0.139499
ntime & nrate & np: 20 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.106427
np = 23
lnL0 = -1021.718465
Iterating by ming2
Initial: fx= 1021.718465
x= 0.02178 0.01072 0.02044 0.04929 0.06082 0.02584 0.01912 0.04641 0.02070 0.01541 0.04630 0.16302 0.05708 0.14867 0.02349 0.08476 0.10286 0.00600 0.01051 0.00000 3.91603 0.50054 0.13950
1 h-m-p 0.0000 0.0000 244.9141 ++ 1021.717925 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0001 337.0721 ++ 1018.870070 m 0.0001 54 | 1/23
3 h-m-p 0.0000 0.0000 1169.0011 +CYYCC 1014.691240 4 0.0000 87 | 1/23
4 h-m-p 0.0000 0.0000 2551.0465 ++ 998.945716 m 0.0000 113 | 1/23
5 h-m-p -0.0000 -0.0000 33414.0114
h-m-p: -1.31636015e-22 -6.58180073e-22 3.34140114e+04 998.945716
.. | 1/23
6 h-m-p 0.0000 0.0004 4090.3692 YYYYCCC 991.625241 6 0.0000 170 | 1/23
7 h-m-p 0.0001 0.0003 248.3966 ++ 973.338456 m 0.0003 196 | 2/23
8 h-m-p 0.0001 0.0007 286.5091 +YYYYYCCCC 959.806263 8 0.0006 234 | 1/23
9 h-m-p 0.0000 0.0000 10402.4722 +YYYYYC 956.363147 5 0.0000 266 | 1/23
10 h-m-p 0.0000 0.0000 13731.7395 YCCC 953.453820 3 0.0000 297 | 1/23
11 h-m-p 0.0001 0.0007 78.7260 +CYCC 952.003749 3 0.0005 329 | 1/23
12 h-m-p 0.0006 0.0030 49.4933 CCCC 951.461382 3 0.0006 361 | 1/23
13 h-m-p 0.0005 0.0025 31.2164 CCC 951.284861 2 0.0005 391 | 1/23
14 h-m-p 0.0008 0.0039 16.2395 YCC 951.232393 2 0.0005 420 | 1/23
15 h-m-p 0.0009 0.0108 9.7224 YC 951.210076 1 0.0006 447 | 1/23
16 h-m-p 0.0012 0.0070 5.1087 YC 951.198352 1 0.0008 474 | 1/23
17 h-m-p 0.0007 0.0072 6.1811 CC 951.183033 1 0.0008 502 | 1/23
18 h-m-p 0.0011 0.0230 4.5493 +YCC 951.115924 2 0.0030 532 | 1/23
19 h-m-p 0.0006 0.0073 23.3169 YCCC 950.979563 3 0.0010 563 | 1/23
20 h-m-p 0.0008 0.0105 30.0501 +YYC 950.425698 2 0.0026 592 | 1/23
21 h-m-p 0.0009 0.0043 66.0809 CCCC 949.827861 3 0.0012 624 | 1/23
22 h-m-p 0.0006 0.0029 47.8750 CYCCC 949.419685 4 0.0011 657 | 1/23
23 h-m-p 0.0008 0.0041 62.6121 CYC 949.091446 2 0.0007 686 | 1/23
24 h-m-p 0.0026 0.0129 8.4391 CC 949.072032 1 0.0007 714 | 1/23
25 h-m-p 0.0015 0.0584 3.6404 YC 949.065823 1 0.0011 741 | 1/23
26 h-m-p 0.0029 0.1549 1.3145 CC 949.062583 1 0.0025 769 | 1/23
27 h-m-p 0.0189 1.9750 0.1753 ++YCC 948.851949 2 0.2227 800 | 1/23
28 h-m-p 0.0040 0.3473 9.8779 YCCC 948.509552 3 0.0063 853 | 1/23
29 h-m-p 1.2948 7.6062 0.0477 CCC 948.178634 2 1.5120 883 | 1/23
30 h-m-p 1.1052 8.0000 0.0653 CC 948.050408 1 0.9917 933 | 1/23
31 h-m-p 1.4955 8.0000 0.0433 CC 947.986882 1 1.6483 983 | 1/23
32 h-m-p 1.6000 8.0000 0.0082 YC 947.910325 1 3.3076 1032 | 1/23
33 h-m-p 0.5536 8.0000 0.0490 +CCCC 947.716486 3 2.9944 1087 | 1/23
34 h-m-p 1.5188 8.0000 0.0966 CYC 947.618167 2 1.3756 1138 | 1/23
35 h-m-p 1.5265 7.6327 0.0123 YC 947.606711 1 0.8417 1187 | 1/23
36 h-m-p 1.6000 8.0000 0.0055 YC 947.605234 1 1.0861 1236 | 1/23
37 h-m-p 1.5470 8.0000 0.0038 +YC 947.602702 1 4.9135 1286 | 1/23
38 h-m-p 1.6000 8.0000 0.0030 YC 947.593834 1 3.7366 1335 | 1/23
39 h-m-p 1.1365 8.0000 0.0097 CC 947.591652 1 0.9701 1385 | 1/23
40 h-m-p 1.6000 8.0000 0.0028 YC 947.591523 1 0.9891 1434 | 1/23
41 h-m-p 1.6000 8.0000 0.0010 Y 947.591513 0 1.1100 1482 | 1/23
42 h-m-p 1.6000 8.0000 0.0001 Y 947.591513 0 0.9986 1530 | 1/23
43 h-m-p 1.6000 8.0000 0.0000 Y 947.591513 0 0.9604 1578 | 1/23
44 h-m-p 0.7632 8.0000 0.0000 --Y 947.591513 0 0.0119 1628 | 1/23
45 h-m-p 0.3900 8.0000 0.0000 -----------Y 947.591513 0 0.0000 1687
Out..
lnL = -947.591513
1688 lfun, 5064 eigenQcodon, 67520 P(t)
Time used: 0:30
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
initial w for M2:NSpselection reset.
0.021287 0.010626 0.021082 0.049393 0.061771 0.025568 0.019425 0.047052 0.020115 0.016770 0.047286 0.163358 0.057500 0.148358 0.023190 0.084637 0.102002 0.005330 0.009734 0.000000 4.167356 1.302842 0.509198 0.419451 2.107983
ntime & nrate & np: 20 3 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.924872
np = 25
lnL0 = -1047.508597
Iterating by ming2
Initial: fx= 1047.508597
x= 0.02129 0.01063 0.02108 0.04939 0.06177 0.02557 0.01943 0.04705 0.02012 0.01677 0.04729 0.16336 0.05750 0.14836 0.02319 0.08464 0.10200 0.00533 0.00973 0.00000 4.16736 1.30284 0.50920 0.41945 2.10798
1 h-m-p 0.0000 0.0000 202.3664 ++ 1047.508253 m 0.0000 30 | 1/25
2 h-m-p 0.0000 0.0001 156.7873 +YCCCC 1046.956414 4 0.0001 66 | 1/25
3 h-m-p 0.0000 0.0002 143.6800 +YYCCCC 1046.124821 5 0.0001 103 | 1/25
4 h-m-p 0.0001 0.0005 340.4552 ++ 1040.128566 m 0.0005 131 | 1/25
5 h-m-p 0.0000 0.0000 868.2544
h-m-p: 1.72067375e-21 8.60336877e-21 8.68254425e+02 1040.128566
.. | 1/25
6 h-m-p 0.0000 0.0012 912.8536 +YCYCCC 1031.501224 5 0.0001 193 | 1/25
7 h-m-p 0.0003 0.0014 162.5381 ++ 1009.337988 m 0.0014 221 | 1/25
8 h-m-p 0.0000 0.0000 2702.4282 ++ 1008.766039 m 0.0000 249 | 1/25
9 h-m-p -0.0000 -0.0000 953.4293
h-m-p: -4.85497872e-23 -2.42748936e-22 9.53429283e+02 1008.766039
.. | 1/25
10 h-m-p 0.0000 0.0006 591.1531 +++ 999.063845 m 0.0006 303 | 1/25
11 h-m-p 0.0000 0.0000 77.3375
h-m-p: 3.11359513e-20 1.55679757e-19 7.73374789e+01 999.063845
.. | 1/25
12 h-m-p 0.0000 0.0016 89.6374 +++YCYYCCC 990.960581 6 0.0014 369 | 1/25
13 h-m-p 0.0000 0.0001 493.3111 ++ 987.328394 m 0.0001 397 | 1/25
14 h-m-p 0.0000 0.0000 298.8721
h-m-p: 1.15779520e-19 5.78897600e-19 2.98872106e+02 987.328394
.. | 1/25
15 h-m-p 0.0000 0.0072 153.4223 +YYCCC 986.522729 4 0.0001 457 | 1/25
16 h-m-p 0.0000 0.0002 106.4101 +CYC 985.701774 2 0.0002 489 | 1/25
17 h-m-p 0.0002 0.0030 100.1829 ++ 974.070227 m 0.0030 517 | 1/25
18 h-m-p 0.0001 0.0004 198.2717 +YYCCC 972.318544 4 0.0003 552 | 1/25
19 h-m-p 0.0008 0.0041 74.6323 +YYYYYCC 967.656443 6 0.0032 588 | 1/25
20 h-m-p 0.0006 0.0029 66.2117 +YYCCC 965.544700 4 0.0020 623 | 1/25
21 h-m-p 0.0005 0.0026 137.0905 YCYCCC 963.072474 5 0.0014 659 | 1/25
22 h-m-p 0.0006 0.0028 179.0082 YCCCC 960.360256 4 0.0013 694 | 1/25
23 h-m-p 0.0010 0.0048 111.4011 YCCCC 957.814638 4 0.0021 729 | 1/25
24 h-m-p 0.0012 0.0060 105.8807 CCC 956.780509 2 0.0011 761 | 1/25
25 h-m-p 0.0007 0.0034 48.2051 CCCCC 956.345485 4 0.0011 797 | 1/25
26 h-m-p 0.0010 0.0050 13.3785 CCC 956.258431 2 0.0014 829 | 1/25
27 h-m-p 0.0020 0.0269 9.3777 CCC 956.210382 2 0.0017 861 | 1/25
28 h-m-p 0.0038 0.0460 4.2280 CCC 956.158179 2 0.0058 893 | 1/25
29 h-m-p 0.0012 0.0254 20.1464 +CCCC 955.912378 3 0.0056 928 | 1/25
30 h-m-p 0.0013 0.0122 84.1551 +YCCC 955.261762 3 0.0035 962 | 1/25
31 h-m-p 0.0013 0.0066 220.9090 CCCCC 954.295374 4 0.0020 998 | 1/25
32 h-m-p 0.0015 0.0077 141.6250 CCCC 953.789282 3 0.0016 1032 | 1/25
33 h-m-p 0.0028 0.0139 65.0641 YC 953.639073 1 0.0011 1061 | 1/25
34 h-m-p 0.0025 0.0125 15.4537 YC 953.603641 1 0.0011 1090 | 1/25
35 h-m-p 0.0032 0.0430 5.3729 CCC 953.550066 2 0.0040 1122 | 1/25
36 h-m-p 0.0008 0.0234 25.7389 +YCCC 953.102632 3 0.0062 1156 | 1/25
37 h-m-p 0.0010 0.0202 152.8216 +CYCC 951.225149 3 0.0048 1190 | 1/25
38 h-m-p 0.1431 0.7155 0.3678 +YYCYCC 950.108409 5 0.4724 1226 | 1/25
39 h-m-p 0.1781 1.1813 0.9755 +YCCC 948.754618 3 0.5775 1284 | 1/25
40 h-m-p 0.0948 0.4742 0.9808 ++ 947.820952 m 0.4742 1336 | 2/25
41 h-m-p 0.5210 2.6052 0.1185 YC 947.669634 1 0.4126 1389 | 2/25
42 h-m-p 0.3898 3.5472 0.1254 CYC 947.606123 2 0.3826 1443 | 2/25
43 h-m-p 1.3443 6.7216 0.0307 CC 947.594475 1 0.5314 1496 | 2/25
44 h-m-p 1.6000 8.0000 0.0094 CC 947.591774 1 0.6224 1549 | 2/25
45 h-m-p 1.4259 8.0000 0.0041 YC 947.591558 1 0.6758 1601 | 2/25
46 h-m-p 0.8856 8.0000 0.0031 C 947.591518 0 0.8856 1652 | 2/25
47 h-m-p 1.6000 8.0000 0.0008 Y 947.591513 0 0.8025 1703 | 2/25
48 h-m-p 1.6000 8.0000 0.0003 Y 947.591513 0 0.7910 1754 | 2/25
49 h-m-p 1.6000 8.0000 0.0001 C 947.591513 0 0.5520 1805 | 2/25
50 h-m-p 0.8760 8.0000 0.0000 C 947.591513 0 0.7754 1856 | 2/25
51 h-m-p 1.6000 8.0000 0.0000 C 947.591513 0 1.6000 1907 | 2/25
52 h-m-p 1.6000 8.0000 0.0000 Y 947.591513 0 1.6000 1958 | 2/25
53 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/25
54 h-m-p 0.0160 8.0000 0.0007 ------------- | 2/25
55 h-m-p 0.0160 8.0000 0.0007 -------------
Out..
lnL = -947.591513
2148 lfun, 8592 eigenQcodon, 128880 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -964.502095 S = -931.259158 -25.163139
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 85 patterns 1:07
did 20 / 85 patterns 1:07
did 30 / 85 patterns 1:07
did 40 / 85 patterns 1:07
did 50 / 85 patterns 1:07
did 60 / 85 patterns 1:07
did 70 / 85 patterns 1:07
did 80 / 85 patterns 1:07
did 85 / 85 patterns 1:07
Time used: 1:07
Model 3: discrete
TREE # 1
(1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
0.021145 0.010633 0.021259 0.050067 0.061724 0.025587 0.019098 0.046844 0.020059 0.015833 0.046857 0.162871 0.057207 0.148550 0.022961 0.084780 0.102786 0.006094 0.010664 0.000000 4.167360 0.446685 0.067456 0.017500 0.045045 0.062071
ntime & nrate & np: 20 4 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.632294
np = 26
lnL0 = -956.551120
Iterating by ming2
Initial: fx= 956.551120
x= 0.02114 0.01063 0.02126 0.05007 0.06172 0.02559 0.01910 0.04684 0.02006 0.01583 0.04686 0.16287 0.05721 0.14855 0.02296 0.08478 0.10279 0.00609 0.01066 0.00000 4.16736 0.44668 0.06746 0.01750 0.04504 0.06207
1 h-m-p 0.0000 0.0000 200.1105 ++ 956.550531 m 0.0000 57 | 1/26
2 h-m-p 0.0000 0.0001 338.0958 ++ 953.529773 m 0.0001 112 | 2/26
3 h-m-p 0.0000 0.0001 269.7415 +YYCCC 952.245118 4 0.0001 173 | 2/26
4 h-m-p 0.0001 0.0003 223.4532 ++ 949.746443 m 0.0003 226 | 2/26
5 h-m-p 0.0000 0.0002 259.9979 ++ 947.484425 m 0.0002 279 | 3/26
6 h-m-p 0.0003 0.0016 40.0027 CCC 947.181481 2 0.0004 336 | 3/26
7 h-m-p 0.0002 0.0009 23.5085 CYCCC 947.109719 4 0.0002 395 | 3/26
8 h-m-p 0.0001 0.0043 39.5867 +YYC 946.946169 2 0.0005 450 | 3/26
9 h-m-p 0.0012 0.0112 15.2646 YC 946.898064 1 0.0007 503 | 3/26
10 h-m-p 0.0010 0.0152 10.7626 CC 946.867221 1 0.0009 557 | 3/26
11 h-m-p 0.0012 0.0077 7.5526 YCC 946.849605 2 0.0008 612 | 3/26
12 h-m-p 0.0005 0.0108 12.6028 YC 946.816278 1 0.0011 665 | 3/26
13 h-m-p 0.0010 0.0225 13.3213 C 946.787560 0 0.0011 717 | 3/26
14 h-m-p 0.0011 0.0091 13.1216 YCC 946.771763 2 0.0007 772 | 3/26
15 h-m-p 0.0009 0.0281 10.9043 YC 946.743791 1 0.0019 825 | 3/26
16 h-m-p 0.0008 0.0356 26.7188 +CCC 946.588121 2 0.0045 882 | 3/26
17 h-m-p 0.0008 0.0102 150.4332 +CCCC 945.872066 3 0.0035 941 | 3/26
18 h-m-p 0.0009 0.0047 196.5663 CYC 945.632342 2 0.0010 996 | 3/26
19 h-m-p 0.0029 0.0147 52.5279 YC 945.539274 1 0.0015 1049 | 3/26
20 h-m-p 0.0052 0.0260 3.3695 YC 945.536841 1 0.0008 1102 | 2/26
21 h-m-p 0.0004 0.0390 7.1136 YC 945.535630 1 0.0001 1155 | 2/26
22 h-m-p 0.0020 0.9865 0.5196 +YC 945.534304 1 0.0050 1210 | 2/26
23 h-m-p 0.0027 0.0708 0.9638 +YC 945.529246 1 0.0085 1265 | 2/26
24 h-m-p 0.0018 0.0364 4.4993 +++ 945.366355 m 0.0364 1319 | 3/26
25 h-m-p 0.0131 0.0734 12.5375 CC 945.345718 1 0.0026 1374 | 3/26
26 h-m-p 0.1986 5.9566 0.1648 +CCCC 945.168096 3 1.1975 1433 | 2/26
27 h-m-p 0.1418 3.0809 1.3917 ----YC 945.168021 1 0.0001 1490 | 2/26
28 h-m-p 0.0160 8.0000 0.1833 +++YCCC 945.072358 3 1.9283 1551 | 1/26
29 h-m-p 0.0024 0.0346 145.9192 -YC 945.068277 1 0.0001 1606 | 1/26
30 h-m-p 0.1021 8.0000 0.1513 ++CCC 945.010184 2 1.9773 1666 | 1/26
31 h-m-p 1.6000 8.0000 0.1753 YCC 944.988838 2 1.1559 1723 | 1/26
32 h-m-p 1.6000 8.0000 0.0376 YC 944.983749 1 0.9323 1778 | 1/26
33 h-m-p 1.6000 8.0000 0.0208 CC 944.982260 1 2.1769 1834 | 1/26
34 h-m-p 1.6000 8.0000 0.0086 CC 944.981015 1 2.0498 1890 | 1/26
35 h-m-p 1.6000 8.0000 0.0106 C 944.980732 0 1.8049 1944 | 1/26
36 h-m-p 1.6000 8.0000 0.0054 YC 944.980201 1 3.9081 1999 | 1/26
37 h-m-p 1.6000 8.0000 0.0086 CC 944.979812 1 1.9659 2055 | 1/26
38 h-m-p 1.6000 8.0000 0.0045 CC 944.979457 1 2.1884 2111 | 1/26
39 h-m-p 0.7514 8.0000 0.0131 C 944.979346 0 1.0074 2165 | 1/26
40 h-m-p 1.6000 8.0000 0.0018 Y 944.979339 0 1.0772 2219 | 1/26
41 h-m-p 1.6000 8.0000 0.0006 Y 944.979338 0 1.0797 2273 | 1/26
42 h-m-p 1.6000 8.0000 0.0001 Y 944.979338 0 1.1267 2327 | 1/26
43 h-m-p 1.6000 8.0000 0.0000 C 944.979338 0 1.6000 2381 | 1/26
44 h-m-p 0.4421 8.0000 0.0000 ----------------.. | 1/26
45 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -944.979338
2515 lfun, 10060 eigenQcodon, 150900 P(t)
Time used: 1:50
Model 7: beta
TREE # 1
(1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
0.021919 0.010518 0.020817 0.050198 0.061374 0.025030 0.019036 0.047155 0.019908 0.015676 0.046567 0.163344 0.056455 0.148258 0.023369 0.084786 0.102557 0.005563 0.009857 0.000000 3.949230 1.051152 1.246982
ntime & nrate & np: 20 1 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 4.779547
np = 23
lnL0 = -1015.362205
Iterating by ming2
Initial: fx= 1015.362205
x= 0.02192 0.01052 0.02082 0.05020 0.06137 0.02503 0.01904 0.04716 0.01991 0.01568 0.04657 0.16334 0.05645 0.14826 0.02337 0.08479 0.10256 0.00556 0.00986 0.00000 3.94923 1.05115 1.24698
1 h-m-p 0.0000 0.0000 169.1334 ++ 1015.361745 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0001 118.8301 +YCYCCC 1014.958891 5 0.0001 109 | 1/23
3 h-m-p 0.0000 0.0002 117.3653 YCYCCC 1014.494516 5 0.0001 165 | 1/23
4 h-m-p 0.0001 0.0005 202.9904 +YCYCCC 1012.054282 5 0.0004 222 | 1/23
5 h-m-p 0.0001 0.0009 693.3007 +YYCYCCCC 1005.313625 7 0.0006 282 | 1/23
6 h-m-p 0.0000 0.0002 1764.5824 ++ 993.614687 m 0.0002 330 | 1/23
7 h-m-p 0.0000 0.0002 2876.7883 +YCYCCC 983.850774 5 0.0001 387 | 1/23
8 h-m-p 0.0000 0.0001 548.9036 +YC 983.008216 1 0.0001 437 | 1/23
9 h-m-p 0.0000 0.0001 119.0258 ++ 982.718131 m 0.0001 485 | 1/23
10 h-m-p -0.0000 -0.0000 26727.2895
h-m-p: -1.17150220e-23 -5.85751102e-23 2.67272895e+04 982.718131
.. | 1/23
11 h-m-p 0.0000 0.0012 260.7627 +++CYCCC 972.732042 4 0.0005 588 | 1/23
12 h-m-p 0.0001 0.0006 161.3900 ++ 963.981661 m 0.0006 636 | 1/23
13 h-m-p 0.0001 0.0004 163.0214 +CYCCC 960.863019 4 0.0003 692 | 1/23
14 h-m-p 0.0000 0.0001 391.9124 ++ 957.952764 m 0.0001 740 | 1/23
15 h-m-p 0.0000 0.0002 602.3383 +YCCCC 954.766664 4 0.0001 796 | 1/23
16 h-m-p 0.0001 0.0006 183.5745 YCCC 953.372347 3 0.0003 849 | 1/23
17 h-m-p 0.0000 0.0002 340.5687 YCCCC 952.340964 4 0.0001 904 | 1/23
18 h-m-p 0.0004 0.0019 77.3393 +CYCC 950.015902 3 0.0014 958 | 1/23
19 h-m-p 0.0003 0.0013 172.5997 CCCCC 949.052800 4 0.0003 1014 | 1/23
20 h-m-p 0.0004 0.0021 48.2692 YCCC 948.643355 3 0.0007 1067 | 1/23
21 h-m-p 0.0007 0.0037 22.1012 YCC 948.559718 2 0.0005 1118 | 1/23
22 h-m-p 0.0015 0.0116 7.4840 YC 948.538382 1 0.0008 1167 | 1/23
23 h-m-p 0.0013 0.0291 4.7306 YC 948.528731 1 0.0009 1216 | 1/23
24 h-m-p 0.0023 0.0657 1.8097 YC 948.508265 1 0.0039 1265 | 1/23
25 h-m-p 0.0008 0.0468 9.2530 +CCC 948.381318 2 0.0041 1318 | 1/23
26 h-m-p 0.0009 0.0258 40.2959 +CYC 947.849471 2 0.0038 1370 | 1/23
27 h-m-p 0.0014 0.0070 52.3526 CCCC 947.378831 3 0.0024 1424 | 1/23
28 h-m-p 0.0011 0.0091 112.8526 CCC 946.798085 2 0.0014 1476 | 1/23
29 h-m-p 0.0038 0.0189 6.5940 YCC 946.787206 2 0.0007 1527 | 1/23
30 h-m-p 0.0102 0.6829 0.4629 YCC 946.764412 2 0.0168 1578 | 1/23
31 h-m-p 0.0058 0.0807 1.3510 +YYYYCCCC 946.323845 7 0.0240 1637 | 1/23
32 h-m-p 0.0007 0.0033 37.1015 CCCCC 945.873556 4 0.0008 1693 | 1/23
33 h-m-p 0.1061 1.4309 0.2966 +YCCCC 945.217037 4 0.7124 1749 | 1/23
34 h-m-p 0.9665 4.8327 0.0624 YYC 945.058818 2 0.8565 1799 | 1/23
35 h-m-p 1.0023 6.1574 0.0534 YCC 945.034702 2 0.6309 1850 | 1/23
36 h-m-p 0.8812 8.0000 0.0382 CC 945.029616 1 0.7474 1900 | 1/23
37 h-m-p 1.6000 8.0000 0.0164 YC 945.028352 1 1.0372 1949 | 1/23
38 h-m-p 1.6000 8.0000 0.0010 YC 945.027923 1 0.8654 1998 | 1/23
39 h-m-p 0.1408 8.0000 0.0060 ++YC 945.027607 1 1.4104 2049 | 1/23
40 h-m-p 1.6000 8.0000 0.0008 YC 945.027436 1 1.2028 2098 | 1/23
41 h-m-p 0.3378 8.0000 0.0030 +Y 945.027419 0 0.8843 2147 | 1/23
42 h-m-p 1.6000 8.0000 0.0001 Y 945.027418 0 0.9916 2195 | 1/23
43 h-m-p 0.5897 8.0000 0.0002 C 945.027418 0 0.8638 2243 | 1/23
44 h-m-p 1.6000 8.0000 0.0000 Y 945.027418 0 0.9103 2291 | 1/23
45 h-m-p 1.3210 8.0000 0.0000 Y 945.027418 0 0.7760 2339 | 1/23
46 h-m-p 1.6000 8.0000 0.0000 ---Y 945.027418 0 0.0063 2390
Out..
lnL = -945.027418
2391 lfun, 26301 eigenQcodon, 478200 P(t)
Time used: 4:07
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
initial w for M8:NSbetaw>1 reset.
0.022539 0.010423 0.021914 0.048790 0.060472 0.025526 0.020664 0.047581 0.020423 0.016452 0.047704 0.162819 0.056368 0.148009 0.023854 0.084299 0.103212 0.005473 0.011811 0.000000 3.941374 0.900000 0.607855 1.105757 2.513519
ntime & nrate & np: 20 2 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.086590
np = 25
lnL0 = -1014.381246
Iterating by ming2
Initial: fx= 1014.381246
x= 0.02254 0.01042 0.02191 0.04879 0.06047 0.02553 0.02066 0.04758 0.02042 0.01645 0.04770 0.16282 0.05637 0.14801 0.02385 0.08430 0.10321 0.00547 0.01181 0.00000 3.94137 0.90000 0.60785 1.10576 2.51352
1 h-m-p 0.0000 0.0000 267.2571 ++ 1014.379912 m 0.0000 55 | 1/25
2 h-m-p 0.0000 0.0000 508.0172 ++ 1010.845875 m 0.0000 108 | 1/25
3 h-m-p 0.0000 0.0001 785.0696 ++ 999.458986 m 0.0001 160 | 1/25
4 h-m-p 0.0000 0.0000 7131.1793 ++ 997.353814 m 0.0000 212 | 2/25
5 h-m-p 0.0000 0.0001 1437.0896 +YYYYCCC 994.847429 6 0.0000 273 | 2/25
6 h-m-p 0.0000 0.0002 408.6582 +YYCCC 992.260568 4 0.0001 331 | 2/25
7 h-m-p 0.0001 0.0004 386.0860 +YYYYCC 985.534596 5 0.0003 389 | 2/25
8 h-m-p 0.0000 0.0000 3422.6986 +YYCCC 983.099370 4 0.0000 447 | 2/25
9 h-m-p 0.0000 0.0000 2902.2628 ++ 981.273263 m 0.0000 498 | 2/25
10 h-m-p 0.0000 0.0000 11802.7277
h-m-p: 3.31381439e-22 1.65690719e-21 1.18027277e+04 981.273263
.. | 2/25
11 h-m-p 0.0000 0.0015 834.2455 +YCYCCC 969.832225 5 0.0001 606 | 2/25
12 h-m-p 0.0001 0.0006 144.4360 ++ 961.109567 m 0.0006 657 | 2/25
13 h-m-p 0.0000 0.0002 341.0027 ++ 956.518815 m 0.0002 708 | 2/25
14 h-m-p 0.0001 0.0004 436.7382 +YYCCCCC 948.952341 6 0.0003 770 | 2/25
15 h-m-p 0.0001 0.0005 107.1185 YCCCC 947.960423 4 0.0003 828 | 1/25
16 h-m-p 0.0001 0.0004 115.6239 CC 947.532544 1 0.0001 881 | 1/25
17 h-m-p 0.0003 0.0013 21.2872 CCCC 947.479790 3 0.0003 939 | 1/25
18 h-m-p 0.0002 0.0014 39.4159 +YCC 947.328027 2 0.0006 995 | 1/25
19 h-m-p 0.0001 0.0005 48.8358 ++ 947.150815 m 0.0005 1047 | 2/25
20 h-m-p 0.0013 0.0090 19.9491 YCC 947.074143 2 0.0009 1102 | 2/25
21 h-m-p 0.0010 0.0072 18.1322 CCC 947.001196 2 0.0011 1157 | 2/25
22 h-m-p 0.0010 0.0085 19.6489 CC 946.938716 1 0.0010 1210 | 2/25
23 h-m-p 0.0006 0.0141 31.9576 +CCCC 946.591056 3 0.0036 1268 | 2/25
24 h-m-p 0.0012 0.0059 63.7528 CCCC 946.332582 3 0.0014 1325 | 2/25
25 h-m-p 0.0014 0.0071 18.2466 YCC 946.288765 2 0.0010 1379 | 2/25
26 h-m-p 0.0028 0.0234 6.4634 CC 946.277703 1 0.0010 1432 | 2/25
27 h-m-p 0.0030 0.0293 2.0684 YC 946.274033 1 0.0014 1484 | 2/25
28 h-m-p 0.0025 0.1804 1.1867 YC 946.262586 1 0.0053 1536 | 2/25
29 h-m-p 0.0010 0.0452 5.9977 ++YCC 946.091582 2 0.0123 1592 | 2/25
30 h-m-p 0.0014 0.0100 54.4053 CCC 945.852103 2 0.0019 1647 | 2/25
31 h-m-p 0.0014 0.0069 30.2742 YC 945.678521 1 0.0025 1699 | 2/25
32 h-m-p 0.0055 0.0275 1.8911 -YC 945.677472 1 0.0006 1752 | 2/25
33 h-m-p 0.0126 3.4726 0.0880 ++YCC 945.578539 2 0.3945 1808 | 2/25
34 h-m-p 0.0011 0.0168 31.2234 CCC 945.433444 2 0.0017 1863 | 2/25
35 h-m-p 1.0422 5.7063 0.0502 CCCCC 945.181929 4 1.4003 1922 | 2/25
36 h-m-p 1.2113 6.0565 0.0470 CCCC 945.087278 3 1.3442 1979 | 2/25
37 h-m-p 1.1624 8.0000 0.0544 CYC 945.061672 2 1.1338 2033 | 2/25
38 h-m-p 1.1551 8.0000 0.0534 CCC 945.048178 2 1.2369 2088 | 2/25
39 h-m-p 1.1171 8.0000 0.0591 YCC 945.034474 2 1.8885 2142 | 2/25
40 h-m-p 1.6000 8.0000 0.0521 YC 945.028975 1 1.0077 2194 | 2/25
41 h-m-p 1.6000 8.0000 0.0071 YC 945.028574 1 0.7817 2246 | 2/25
42 h-m-p 1.6000 8.0000 0.0014 YC 945.028557 1 0.8584 2298 | 2/25
43 h-m-p 1.6000 8.0000 0.0006 Y 945.028556 0 0.8339 2349 | 2/25
44 h-m-p 1.6000 8.0000 0.0001 Y 945.028556 0 1.1169 2400 | 2/25
45 h-m-p 1.5705 8.0000 0.0001 C 945.028556 0 1.5705 2451 | 2/25
46 h-m-p 0.8286 8.0000 0.0001 ++ 945.028556 m 8.0000 2502 | 2/25
47 h-m-p 1.4660 8.0000 0.0006 ++ 945.028556 m 8.0000 2553 | 2/25
48 h-m-p 0.1854 8.0000 0.0257 ++C 945.028553 0 3.9246 2606 | 2/25
49 h-m-p 1.2690 8.0000 0.0794 ++ 945.028485 m 8.0000 2657 | 2/25
50 h-m-p 0.6959 8.0000 0.9123 ----------Y 945.028485 0 0.0000 2718 | 2/25
51 h-m-p 0.0107 5.3637 0.2015 ++++C 945.028401 0 3.2125 2773 | 2/25
52 h-m-p 1.5390 7.6951 0.0563 C 945.028393 0 1.2914 2824 | 2/25
53 h-m-p 1.0202 5.1009 0.0707 +Y 945.028387 0 3.0351 2876 | 2/25
54 h-m-p 0.1746 0.8731 0.1673 +C 945.028385 0 0.6985 2928 | 2/25
55 h-m-p 1.6000 8.0000 0.0011 C 945.028377 0 2.4824 2979 | 2/25
56 h-m-p 0.0665 0.7728 0.0399 ++ 945.028368 m 0.7728 3030 | 3/25
57 h-m-p 0.0197 8.0000 0.0297 +++YC 945.027865 1 0.9117 3085 | 3/25
58 h-m-p 1.6000 8.0000 0.0004 Y 945.027860 0 0.7799 3135 | 3/25
59 h-m-p 1.6000 8.0000 0.0000 Y 945.027860 0 0.9986 3185 | 3/25
60 h-m-p 1.6000 8.0000 0.0000 Y 945.027860 0 0.4000 3235 | 3/25
61 h-m-p 0.5066 8.0000 0.0000 -------C 945.027860 0 0.0000 3292
Out..
lnL = -945.027860
3293 lfun, 39516 eigenQcodon, 724460 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -968.811246 S = -932.968462 -28.714524
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 85 patterns 7:34
did 20 / 85 patterns 7:34
did 30 / 85 patterns 7:34
did 40 / 85 patterns 7:34
did 50 / 85 patterns 7:34
did 60 / 85 patterns 7:35
did 70 / 85 patterns 7:35
did 80 / 85 patterns 7:35
did 85 / 85 patterns 7:35
Time used: 7:35
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=120
D_melanogaster_endos-PB MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_sechellia_endos-PB MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_simulans_endos-PB MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_yakuba_endos-PB MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
D_erecta_endos-PB MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
D_takahashii_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_biarmipes_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_suzukii_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_eugracilis_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_ficusphila_endos-PB MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_rhopaloa_endos-PB MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
D_elegans_endos-PB MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
***:****** ****** *.:*: **************************
D_melanogaster_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_sechellia_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_simulans_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_yakuba_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_erecta_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_takahashii_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_biarmipes_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_suzukii_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
D_eugracilis_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_ficusphila_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_rhopaloa_endos-PB HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
D_elegans_endos-PB HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
**********: *****************.******** .**********
D_melanogaster_endos-PB VPARKTSIIQPCNKFPATS-
D_sechellia_endos-PB VPARKTSIIQPCNKFPATS-
D_simulans_endos-PB VPARKTSIIQPCNKFPATS-
D_yakuba_endos-PB VPARKTSIIQPCNKFPATS-
D_erecta_endos-PB VPARKTSIIQPCNKFPATSo
D_takahashii_endos-PB VPARKTSIIQPCNKFPATS-
D_biarmipes_endos-PB VPARKTSIIQPCNKFPATS-
D_suzukii_endos-PB VPARKTSIIQPCNKFPATS-
D_eugracilis_endos-PB VPARKTSIIQPCNKFPATS-
D_ficusphila_endos-PB VPARKTSIIQPCNKFPATS-
D_rhopaloa_endos-PB VPARKTSIIQPCNKFPATS-
D_elegans_endos-PB VPARKTSIIQPCNKFPATSo
*******************
>D_melanogaster_endos-PB ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CACCGAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_sechellia_endos-PB ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACTCCCCAGGA CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_simulans_endos-PB ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_yakuba_endos-PB ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAACAGCCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCGAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAAGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGGGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAAGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_erecta_endos-PB ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA C---GAGGCCGCCGAACAGGTCAACCTCACGGATCTGGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGT CATTCGGCCTTCCTTCAGAAGAGGTTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_takahashii_endos-PB ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCCGGCGGA CACTCGGCTTTCCTACAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTTAAGCAGG TCTTTGCCAACAAGGTTACCACTGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_biarmipes_endos-PB ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCTGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGAGACTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTTACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC GACGAGC--- >D_suzukii_endos-PB ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCCGGCGGG CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGAACACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC GACGAGC--- >D_eugracilis_endos-PB ATGAGCTCTGCGGAGGAAAACAGCAATAGCCCGGCTACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGAGCAAGTATCCCAGCGGAATGCGTGTACCCGGTGGA CACTCGGCCTTTCTGCAAAAAAGGCTCCAGAAGGGGCAAAAATTCTTCGA CTCGGGCGATTACCAAATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAATAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATTATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_ficusphila_endos-PB ATGAGCTCCACGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA TAACGAGGCTGCAGAGCAGGCAAACCTCACGGATCTCGAGAAGATTGAGG AGGAGAAGCTGAAGTCCAAGTACCCTAGTGGAATGCGAGTGCCCGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA TTCGGGCGACTATCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCTATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACCTCGATCATCCAACCATGCAACAAGTTCCCAGC GACGAGC--- >D_rhopaloa_endos-PB ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGTCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTACCCCAGTGGAATGCGAGTACCCGGAGGT CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG TCTTTGCCAACAAGGTGACCACCGGAGAGGCCATTCCCACGCCCGAAACC GTGCCGGCACGAAAGACTTCGATCATCCAACCCTGCAACAAGTTCCCAGC GACAAGC--- >D_elegans_endos-PB ATGAGTTCCGCGGAGGAAAACAGCAACAGCCAGGCCACCACGCCCCAGGA CAACGAGACCGCTGAGAATGTCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGTGGAATGCGAGTGCCGGGCGGT CACTCGGCCTTCCTCCAAAAAAGGCTGCAGAGG---CAAAAGTTCTTCGA CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG TCTTTGCCAACAAGGTGCCCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCACGCAAGACCTCGATCATCCAACCCTGCAACAAATTCCCAGC GACGAGC---
>D_melanogaster_endos-PB MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_sechellia_endos-PB MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_simulans_endos-PB MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_yakuba_endos-PB MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_erecta_endos-PB MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_takahashii_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_biarmipes_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_suzukii_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_eugracilis_endos-PB MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_ficusphila_endos-PB MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_rhopaloa_endos-PB MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_elegans_endos-PB MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET VPARKTSIIQPCNKFPATS
#NEXUS
[ID: 2721711406]
begin taxa;
dimensions ntax=12;
taxlabels
D_melanogaster_endos-PB
D_sechellia_endos-PB
D_simulans_endos-PB
D_yakuba_endos-PB
D_erecta_endos-PB
D_takahashii_endos-PB
D_biarmipes_endos-PB
D_suzukii_endos-PB
D_eugracilis_endos-PB
D_ficusphila_endos-PB
D_rhopaloa_endos-PB
D_elegans_endos-PB
;
end;
begin trees;
translate
1 D_melanogaster_endos-PB,
2 D_sechellia_endos-PB,
3 D_simulans_endos-PB,
4 D_yakuba_endos-PB,
5 D_erecta_endos-PB,
6 D_takahashii_endos-PB,
7 D_biarmipes_endos-PB,
8 D_suzukii_endos-PB,
9 D_eugracilis_endos-PB,
10 D_ficusphila_endos-PB,
11 D_rhopaloa_endos-PB,
12 D_elegans_endos-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02630485,((4:0.0404674,5:0.04615435)0.881:0.01662658,((6:0.03220696,(7:0.008723933,8:0.04135454)0.998:0.02764249)0.993:0.02287249,9:0.119603,(10:0.1147552,(11:0.06337856,12:0.09633418)0.848:0.03217926)0.982:0.04171026)0.969:0.02114635)0.872:0.0156792,(2:0.009536292,3:0.00403446)0.680:0.009164611);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02630485,((4:0.0404674,5:0.04615435):0.01662658,((6:0.03220696,(7:0.008723933,8:0.04135454):0.02764249):0.02287249,9:0.119603,(10:0.1147552,(11:0.06337856,12:0.09633418):0.03217926):0.04171026):0.02114635):0.0156792,(2:0.009536292,3:0.00403446):0.009164611);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1034.90 -1053.40
2 -1035.07 -1058.14
--------------------------------------
TOTAL -1034.98 -1057.45
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/241/endos-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.863136 0.021989 0.599122 1.171308 0.847059 1227.64 1273.68 1.000
r(A<->C){all} 0.058287 0.000649 0.015551 0.111912 0.054851 539.14 625.23 1.003
r(A<->G){all} 0.159413 0.002739 0.065851 0.261017 0.152574 548.35 590.34 1.000
r(A<->T){all} 0.148576 0.004208 0.029406 0.273836 0.141780 351.68 390.19 1.000
r(C<->G){all} 0.027806 0.000157 0.005802 0.052689 0.026196 885.66 886.53 1.000
r(C<->T){all} 0.563357 0.007302 0.400954 0.724100 0.563382 480.71 486.62 1.000
r(G<->T){all} 0.042561 0.000589 0.004372 0.091429 0.037802 771.67 941.43 1.002
pi(A){all} 0.264085 0.000514 0.221633 0.310340 0.263245 961.17 1032.97 1.000
pi(C){all} 0.320399 0.000584 0.272469 0.368952 0.320476 1075.12 1103.42 1.000
pi(G){all} 0.296258 0.000531 0.249833 0.340095 0.296015 1240.91 1302.34 1.000
pi(T){all} 0.119259 0.000288 0.088493 0.153409 0.118241 922.32 998.44 1.000
alpha{1,2} 0.107837 0.000753 0.061004 0.165277 0.105908 1156.75 1224.56 1.000
alpha{3} 2.155340 0.650239 0.820605 3.719296 2.017830 1007.36 1199.36 1.000
pinvar{all} 0.326241 0.007543 0.147511 0.490026 0.330972 1122.50 1175.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/241/endos-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 117
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 2 2 2 1 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 1 0 | TCG 3 3 3 4 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 1 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 1 0 | Arg CGT 0 0 0 0 0 0
CTC 4 4 4 4 2 3 | CCC 5 6 6 6 5 6 | CAC 1 1 1 1 0 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 1 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 4 4 4 4 4 3 | CAG 7 7 7 7 7 7 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 2 1 1 1 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 6 5 5 4 4 3 | AAC 5 5 5 5 5 5 | AGC 5 5 5 5 5 5
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 4 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 4 3 4 4 4 4 | AAG 11 11 11 9 11 11 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 2 | Ala GCT 1 0 0 0 0 1 | Asp GAT 2 2 2 2 2 1 | Gly GGT 1 1 1 1 2 1
GTC 2 2 2 2 3 1 | GCC 5 6 6 7 7 7 | GAC 2 2 2 2 2 3 | GGC 4 4 4 3 4 3
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 3 2 2 4 3 2 | GGA 2 2 2 2 1 3
GTG 3 3 3 3 3 2 | GCG 3 3 3 3 3 3 | GAG 7 8 8 6 7 8 | GGG 1 1 1 2 1 1
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 2 2 1 2 1 | Ser TCT 0 0 1 0 0 0 | Tyr TAT 1 1 1 1 0 1 | Cys TGT 1 1 1 0 0 0
TTC 4 3 3 4 3 4 | TCC 1 1 0 2 2 2 | TAC 1 1 1 1 2 1 | TGC 0 0 0 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 0 0 1 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 1 0 0 0
CTC 4 4 4 3 4 4 | CCC 6 7 6 4 6 6 | CAC 1 1 1 1 1 1 | CGC 2 2 1 1 0 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 2 1 1 | Gln CAA 2 2 4 2 2 3 | CGA 0 0 0 1 2 1
CTG 1 1 1 2 1 1 | CCG 2 2 3 2 2 2 | CAG 7 7 5 7 7 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 2 2 1 1 | Thr ACT 1 1 1 0 1 0 | Asn AAT 0 0 2 0 0 1 | Ser AGT 0 0 0 1 1 2
ATC 3 3 2 2 3 3 | ACC 4 4 4 5 4 5 | AAC 5 6 3 5 5 5 | AGC 5 5 6 4 5 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 1 0 | Lys AAA 1 2 2 1 1 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 5 3 4 | AAG 12 11 11 12 12 10 | AGG 1 1 1 1 1 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 0 0 0 1 1 | Ala GCT 0 0 1 2 0 1 | Asp GAT 1 1 2 3 1 1 | Gly GGT 1 1 2 1 2 2
GTC 2 2 2 2 2 2 | GCC 8 8 7 4 7 5 | GAC 3 3 2 1 3 3 | GGC 3 3 3 4 2 3
GTA 0 0 1 0 1 0 | GCA 0 0 0 2 1 1 | Glu GAA 2 2 2 2 3 2 | GGA 2 1 2 2 3 1
GTG 2 2 2 3 2 3 | GCG 3 3 3 2 2 2 | GAG 8 8 8 8 7 8 | GGG 2 3 1 1 0 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_endos-PB
position 1: T:0.11111 C:0.22222 A:0.35897 G:0.30769
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.43590 A:0.07692 G:0.41026
Average T:0.12536 C:0.31624 A:0.27066 G:0.28775
#2: D_sechellia_endos-PB
position 1: T:0.11111 C:0.23077 A:0.35043 G:0.30769
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.44444 A:0.06838 G:0.41026
Average T:0.12536 C:0.32194 A:0.26496 G:0.28775
#3: D_simulans_endos-PB
position 1: T:0.11111 C:0.23077 A:0.35043 G:0.30769
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.06838 C:0.44444 A:0.06838 G:0.41880
Average T:0.12251 C:0.32194 A:0.26496 G:0.29060
#4: D_yakuba_endos-PB
position 1: T:0.11111 C:0.23077 A:0.34188 G:0.31624
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.06838 C:0.42735 A:0.10256 G:0.40171
Average T:0.12251 C:0.31624 A:0.27350 G:0.28775
#5: D_erecta_endos-PB
position 1: T:0.11966 C:0.21368 A:0.34188 G:0.32479
position 2: T:0.19658 C:0.28205 A:0.37607 G:0.14530
position 3: T:0.09402 C:0.41880 A:0.06838 G:0.41880
Average T:0.13675 C:0.30484 A:0.26211 G:0.29630
#6: D_takahashii_endos-PB
position 1: T:0.11111 C:0.22222 A:0.34188 G:0.32479
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.09402 C:0.41880 A:0.08547 G:0.40171
Average T:0.13105 C:0.31054 A:0.26781 G:0.29060
#7: D_biarmipes_endos-PB
position 1: T:0.11111 C:0.22222 A:0.34188 G:0.32479
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.44444 A:0.06838 G:0.41026
Average T:0.12536 C:0.31909 A:0.26211 G:0.29345
#8: D_suzukii_endos-PB
position 1: T:0.11111 C:0.22222 A:0.35043 G:0.31624
position 2: T:0.17949 C:0.29060 A:0.38462 G:0.14530
position 3: T:0.06838 C:0.45299 A:0.06838 G:0.41026
Average T:0.11966 C:0.32194 A:0.26781 G:0.29060
#9: D_eugracilis_endos-PB
position 1: T:0.10256 C:0.22222 A:0.35043 G:0.32479
position 2: T:0.18803 C:0.28205 A:0.37607 G:0.15385
position 3: T:0.13675 C:0.38462 A:0.09402 G:0.38462
Average T:0.14245 C:0.29630 A:0.27350 G:0.28775
#10: D_ficusphila_endos-PB
position 1: T:0.11111 C:0.22222 A:0.35043 G:0.31624
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.10256 C:0.37607 A:0.10256 G:0.41880
Average T:0.13390 C:0.29630 A:0.27635 G:0.29345
#11: D_rhopaloa_endos-PB
position 1: T:0.11111 C:0.22222 A:0.35043 G:0.31624
position 2: T:0.19658 C:0.28205 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.42735 A:0.12821 G:0.36752
Average T:0.12821 C:0.31054 A:0.28490 G:0.27635
#12: D_elegans_endos-PB
position 1: T:0.11111 C:0.22222 A:0.35897 G:0.30769
position 2: T:0.19658 C:0.27350 A:0.37607 G:0.15385
position 3: T:0.09402 C:0.42735 A:0.09402 G:0.38462
Average T:0.13390 C:0.30769 A:0.27635 G:0.28205
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 15 | Ser S TCT 1 | Tyr Y TAT 11 | Cys C TGT 9
TTC 45 | TCC 19 | TAC 13 | TGC 3
Leu L TTA 0 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 1 | TCG 37 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 2 | His H CAT 1 | Arg R CGT 1
CTC 44 | CCC 69 | CAC 11 | CGC 19
CTA 1 | CCA 4 | Gln Q CAA 27 | CGA 4
CTG 13 | CCG 36 | CAG 81 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 14 | Thr T ACT 12 | Asn N AAT 3 | Ser S AGT 4
ATC 34 | ACC 53 | AAC 59 | AGC 59
ATA 0 | ACA 1 | Lys K AAA 23 | Arg R AGA 0
Met M ATG 36 | ACG 47 | AAG 132 | AGG 13
------------------------------------------------------------------------------
Val V GTT 5 | Ala A GCT 6 | Asp D GAT 20 | Gly G GGT 16
GTC 24 | GCC 77 | GAC 28 | GGC 40
GTA 2 | GCA 4 | Glu E GAA 29 | GGA 23
GTG 31 | GCG 33 | GAG 91 | GGG 15
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11111 C:0.22365 A:0.34900 G:0.31624
position 2: T:0.18946 C:0.28704 A:0.37678 G:0.14672
position 3: T:0.08618 C:0.42521 A:0.08547 G:0.40313
Average T:0.12892 C:0.31197 A:0.27042 G:0.28870
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_endos-PB
D_sechellia_endos-PB 0.0948 (0.0037 0.0389)
D_simulans_endos-PB 0.1435 (0.0037 0.0257)-1.0000 (0.0000 0.0127)
D_yakuba_endos-PB 0.1025 (0.0111 0.1085) 0.1182 (0.0111 0.0940) 0.1392 (0.0111 0.0799)
D_erecta_endos-PB 0.0801 (0.0111 0.1387) 0.0899 (0.0111 0.1236) 0.1021 (0.0111 0.1088) 0.0533 (0.0074 0.1386)
D_takahashii_endos-PB 0.0438 (0.0074 0.1688) 0.0483 (0.0074 0.1532) 0.0536 (0.0074 0.1379) 0.0184 (0.0037 0.2010) 0.0169 (0.0037 0.2183)
D_biarmipes_endos-PB 0.0535 (0.0074 0.1382) 0.0600 (0.0074 0.1232) 0.0682 (0.0074 0.1084) 0.0183 (0.0037 0.2014) 0.0156 (0.0037 0.2359)-1.0000 (0.0000 0.1228)
D_suzukii_endos-PB 0.0989 (0.0173 0.1754) 0.1087 (0.0173 0.1596) 0.1204 (0.0173 0.1440) 0.0654 (0.0136 0.2081) 0.0602 (0.0136 0.2257) 0.0534 (0.0074 0.1385) 0.1116 (0.0074 0.0662)
D_eugracilis_endos-PB 0.0545 (0.0148 0.2724) 0.0584 (0.0148 0.2543) 0.0627 (0.0148 0.2367) 0.0383 (0.0130 0.3389) 0.0424 (0.0148 0.3501) 0.0225 (0.0074 0.3281) 0.0239 (0.0074 0.3094) 0.0580 (0.0173 0.2985)
D_ficusphila_endos-PB 0.0342 (0.0111 0.3254) 0.0342 (0.0111 0.3254) 0.0364 (0.0111 0.3063) 0.0173 (0.0074 0.4290) 0.0155 (0.0074 0.4767) 0.0096 (0.0037 0.3846) 0.0107 (0.0037 0.3446) 0.0364 (0.0136 0.3740) 0.0201 (0.0111 0.5535)
D_rhopaloa_endos-PB 0.0550 (0.0149 0.2705) 0.0515 (0.0149 0.2888) 0.0550 (0.0149 0.2705) 0.0345 (0.0130 0.3770) 0.0095 (0.0037 0.3888) 0.0242 (0.0074 0.3065) 0.0241 (0.0074 0.3072) 0.0625 (0.0174 0.2778) 0.0381 (0.0148 0.3899) 0.0323 (0.0111 0.3444)
D_elegans_endos-PB 0.1266 (0.0300 0.2369) 0.1539 (0.0338 0.2197) 0.1667 (0.0338 0.2028) 0.1190 (0.0357 0.3003) 0.0841 (0.0261 0.3108) 0.1104 (0.0300 0.2717) 0.1180 (0.0300 0.2542) 0.1436 (0.0402 0.2800) 0.0906 (0.0376 0.4151) 0.1170 (0.0339 0.2893) 0.1105 (0.0224 0.2025)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
lnL(ntime: 20 np: 22): -954.840262 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 16..9 16..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3
0.024648 0.025293 0.008361 0.047555 0.069783 0.022403 0.029816 0.038329 0.033031 0.017307 0.052324 0.176780 0.062710 0.154021 0.063345 0.077430 0.133443 0.006791 0.009414 0.000004 3.916033 0.034999
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.05279
(1: 0.024648, ((4: 0.047555, 5: 0.069783): 0.008361, ((6: 0.038329, (7: 0.017307, 8: 0.052324): 0.033031): 0.029816, 9: 0.176780, (10: 0.154021, (11: 0.077430, 12: 0.133443): 0.063345): 0.062710): 0.022403): 0.025293, (2: 0.009414, 3: 0.000004): 0.006791);
(D_melanogaster_endos-PB: 0.024648, ((D_yakuba_endos-PB: 0.047555, D_erecta_endos-PB: 0.069783): 0.008361, ((D_takahashii_endos-PB: 0.038329, (D_biarmipes_endos-PB: 0.017307, D_suzukii_endos-PB: 0.052324): 0.033031): 0.029816, D_eugracilis_endos-PB: 0.176780, (D_ficusphila_endos-PB: 0.154021, (D_rhopaloa_endos-PB: 0.077430, D_elegans_endos-PB: 0.133443): 0.063345): 0.062710): 0.022403): 0.025293, (D_sechellia_endos-PB: 0.009414, D_simulans_endos-PB: 0.000004): 0.006791);
Detailed output identifying parameters
kappa (ts/tv) = 3.91603
omega (dN/dS) = 0.03500
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0350 0.0015 0.0417 0.4 2.5
13..14 0.025 292.0 59.0 0.0350 0.0015 0.0428 0.4 2.5
14..15 0.008 292.0 59.0 0.0350 0.0005 0.0141 0.1 0.8
15..4 0.048 292.0 59.0 0.0350 0.0028 0.0804 0.8 4.7
15..5 0.070 292.0 59.0 0.0350 0.0041 0.1180 1.2 7.0
14..16 0.022 292.0 59.0 0.0350 0.0013 0.0379 0.4 2.2
16..17 0.030 292.0 59.0 0.0350 0.0018 0.0504 0.5 3.0
17..6 0.038 292.0 59.0 0.0350 0.0023 0.0648 0.7 3.8
17..18 0.033 292.0 59.0 0.0350 0.0020 0.0559 0.6 3.3
18..7 0.017 292.0 59.0 0.0350 0.0010 0.0293 0.3 1.7
18..8 0.052 292.0 59.0 0.0350 0.0031 0.0885 0.9 5.2
16..9 0.177 292.0 59.0 0.0350 0.0105 0.2989 3.1 17.6
16..19 0.063 292.0 59.0 0.0350 0.0037 0.1060 1.1 6.3
19..10 0.154 292.0 59.0 0.0350 0.0091 0.2604 2.7 15.4
19..20 0.063 292.0 59.0 0.0350 0.0037 0.1071 1.1 6.3
20..11 0.077 292.0 59.0 0.0350 0.0046 0.1309 1.3 7.7
20..12 0.133 292.0 59.0 0.0350 0.0079 0.2256 2.3 13.3
13..21 0.007 292.0 59.0 0.0350 0.0004 0.0115 0.1 0.7
21..2 0.009 292.0 59.0 0.0350 0.0006 0.0159 0.2 0.9
21..3 0.000 292.0 59.0 0.0350 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0623
tree length for dS: 1.7801
Time used: 0:10
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
lnL(ntime: 20 np: 23): -947.591513 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 16..9 16..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3
0.025182 0.024985 0.008896 0.048466 0.069548 0.022484 0.029707 0.039243 0.033453 0.017673 0.052584 0.182365 0.064163 0.161353 0.058672 0.080927 0.133422 0.006791 0.009486 0.000004 4.167356 0.953520 0.013585
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06940
(1: 0.025182, ((4: 0.048466, 5: 0.069548): 0.008896, ((6: 0.039243, (7: 0.017673, 8: 0.052584): 0.033453): 0.029707, 9: 0.182365, (10: 0.161353, (11: 0.080927, 12: 0.133422): 0.058672): 0.064163): 0.022484): 0.024985, (2: 0.009486, 3: 0.000004): 0.006791);
(D_melanogaster_endos-PB: 0.025182, ((D_yakuba_endos-PB: 0.048466, D_erecta_endos-PB: 0.069548): 0.008896, ((D_takahashii_endos-PB: 0.039243, (D_biarmipes_endos-PB: 0.017673, D_suzukii_endos-PB: 0.052584): 0.033453): 0.029707, D_eugracilis_endos-PB: 0.182365, (D_ficusphila_endos-PB: 0.161353, (D_rhopaloa_endos-PB: 0.080927, D_elegans_endos-PB: 0.133422): 0.058672): 0.064163): 0.022484): 0.024985, (D_sechellia_endos-PB: 0.009486, D_simulans_endos-PB: 0.000004): 0.006791);
Detailed output identifying parameters
kappa (ts/tv) = 4.16736
dN/dS (w) for site classes (K=2)
p: 0.95352 0.04648
w: 0.01359 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 291.7 59.3 0.0594 0.0023 0.0385 0.7 2.3
13..14 0.025 291.7 59.3 0.0594 0.0023 0.0382 0.7 2.3
14..15 0.009 291.7 59.3 0.0594 0.0008 0.0136 0.2 0.8
15..4 0.048 291.7 59.3 0.0594 0.0044 0.0740 1.3 4.4
15..5 0.070 291.7 59.3 0.0594 0.0063 0.1062 1.8 6.3
14..16 0.022 291.7 59.3 0.0594 0.0020 0.0343 0.6 2.0
16..17 0.030 291.7 59.3 0.0594 0.0027 0.0454 0.8 2.7
17..6 0.039 291.7 59.3 0.0594 0.0036 0.0599 1.0 3.6
17..18 0.033 291.7 59.3 0.0594 0.0030 0.0511 0.9 3.0
18..7 0.018 291.7 59.3 0.0594 0.0016 0.0270 0.5 1.6
18..8 0.053 291.7 59.3 0.0594 0.0048 0.0803 1.4 4.8
16..9 0.182 291.7 59.3 0.0594 0.0166 0.2785 4.8 16.5
16..19 0.064 291.7 59.3 0.0594 0.0058 0.0980 1.7 5.8
19..10 0.161 291.7 59.3 0.0594 0.0146 0.2464 4.3 14.6
19..20 0.059 291.7 59.3 0.0594 0.0053 0.0896 1.6 5.3
20..11 0.081 291.7 59.3 0.0594 0.0073 0.1236 2.1 7.3
20..12 0.133 291.7 59.3 0.0594 0.0121 0.2038 3.5 12.1
13..21 0.007 291.7 59.3 0.0594 0.0006 0.0104 0.2 0.6
21..2 0.009 291.7 59.3 0.0594 0.0009 0.0145 0.3 0.9
21..3 0.000 291.7 59.3 0.0594 0.0000 0.0000 0.0 0.0
Time used: 0:30
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
check convergence..
lnL(ntime: 20 np: 25): -947.591513 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 16..9 16..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3
0.025182 0.024986 0.008896 0.048466 0.069548 0.022484 0.029707 0.039243 0.033453 0.017673 0.052584 0.182365 0.064163 0.161353 0.058672 0.080926 0.133422 0.006791 0.009486 0.000004 4.167360 0.953520 0.037365 0.013585 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06940
(1: 0.025182, ((4: 0.048466, 5: 0.069548): 0.008896, ((6: 0.039243, (7: 0.017673, 8: 0.052584): 0.033453): 0.029707, 9: 0.182365, (10: 0.161353, (11: 0.080926, 12: 0.133422): 0.058672): 0.064163): 0.022484): 0.024986, (2: 0.009486, 3: 0.000004): 0.006791);
(D_melanogaster_endos-PB: 0.025182, ((D_yakuba_endos-PB: 0.048466, D_erecta_endos-PB: 0.069548): 0.008896, ((D_takahashii_endos-PB: 0.039243, (D_biarmipes_endos-PB: 0.017673, D_suzukii_endos-PB: 0.052584): 0.033453): 0.029707, D_eugracilis_endos-PB: 0.182365, (D_ficusphila_endos-PB: 0.161353, (D_rhopaloa_endos-PB: 0.080926, D_elegans_endos-PB: 0.133422): 0.058672): 0.064163): 0.022484): 0.024986, (D_sechellia_endos-PB: 0.009486, D_simulans_endos-PB: 0.000004): 0.006791);
Detailed output identifying parameters
kappa (ts/tv) = 4.16736
dN/dS (w) for site classes (K=3)
p: 0.95352 0.03736 0.00911
w: 0.01359 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 291.7 59.3 0.0594 0.0023 0.0385 0.7 2.3
13..14 0.025 291.7 59.3 0.0594 0.0023 0.0382 0.7 2.3
14..15 0.009 291.7 59.3 0.0594 0.0008 0.0136 0.2 0.8
15..4 0.048 291.7 59.3 0.0594 0.0044 0.0740 1.3 4.4
15..5 0.070 291.7 59.3 0.0594 0.0063 0.1062 1.8 6.3
14..16 0.022 291.7 59.3 0.0594 0.0020 0.0343 0.6 2.0
16..17 0.030 291.7 59.3 0.0594 0.0027 0.0454 0.8 2.7
17..6 0.039 291.7 59.3 0.0594 0.0036 0.0599 1.0 3.6
17..18 0.033 291.7 59.3 0.0594 0.0030 0.0511 0.9 3.0
18..7 0.018 291.7 59.3 0.0594 0.0016 0.0270 0.5 1.6
18..8 0.053 291.7 59.3 0.0594 0.0048 0.0803 1.4 4.8
16..9 0.182 291.7 59.3 0.0594 0.0166 0.2785 4.8 16.5
16..19 0.064 291.7 59.3 0.0594 0.0058 0.0980 1.7 5.8
19..10 0.161 291.7 59.3 0.0594 0.0146 0.2464 4.3 14.6
19..20 0.059 291.7 59.3 0.0594 0.0053 0.0896 1.6 5.3
20..11 0.081 291.7 59.3 0.0594 0.0073 0.1236 2.1 7.3
20..12 0.133 291.7 59.3 0.0594 0.0121 0.2038 3.5 12.1
13..21 0.007 291.7 59.3 0.0594 0.0006 0.0104 0.2 0.6
21..2 0.009 291.7 59.3 0.0594 0.0009 0.0145 0.3 0.9
21..3 0.000 291.7 59.3 0.0594 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_endos-PB)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.325 0.100 0.076 0.072 0.071 0.071 0.071 0.071 0.071 0.071
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.995
sum of density on p0-p1 = 1.000000
Time used: 1:07
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
check convergence..
lnL(ntime: 20 np: 26): -944.979338 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 16..9 16..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3
0.024944 0.025268 0.008520 0.048093 0.069965 0.022506 0.029992 0.038783 0.033449 0.017491 0.052735 0.179330 0.064387 0.158396 0.061603 0.079621 0.135444 0.006810 0.009465 0.000004 3.949230 0.357061 0.543746 0.005453 0.005454 0.334894
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06681
(1: 0.024944, ((4: 0.048093, 5: 0.069965): 0.008520, ((6: 0.038783, (7: 0.017491, 8: 0.052735): 0.033449): 0.029992, 9: 0.179330, (10: 0.158396, (11: 0.079621, 12: 0.135444): 0.061603): 0.064387): 0.022506): 0.025268, (2: 0.009465, 3: 0.000004): 0.006810);
(D_melanogaster_endos-PB: 0.024944, ((D_yakuba_endos-PB: 0.048093, D_erecta_endos-PB: 0.069965): 0.008520, ((D_takahashii_endos-PB: 0.038783, (D_biarmipes_endos-PB: 0.017491, D_suzukii_endos-PB: 0.052735): 0.033449): 0.029992, D_eugracilis_endos-PB: 0.179330, (D_ficusphila_endos-PB: 0.158396, (D_rhopaloa_endos-PB: 0.079621, D_elegans_endos-PB: 0.135444): 0.061603): 0.064387): 0.022506): 0.025268, (D_sechellia_endos-PB: 0.009465, D_simulans_endos-PB: 0.000004): 0.006810);
Detailed output identifying parameters
kappa (ts/tv) = 3.94923
dN/dS (w) for site classes (K=3)
p: 0.35706 0.54375 0.09919
w: 0.00545 0.00545 0.33489
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0381 0.0016 0.0416 0.5 2.5
13..14 0.025 292.0 59.0 0.0381 0.0016 0.0421 0.5 2.5
14..15 0.009 292.0 59.0 0.0381 0.0005 0.0142 0.2 0.8
15..4 0.048 292.0 59.0 0.0381 0.0031 0.0802 0.9 4.7
15..5 0.070 292.0 59.0 0.0381 0.0044 0.1167 1.3 6.9
14..16 0.023 292.0 59.0 0.0381 0.0014 0.0375 0.4 2.2
16..17 0.030 292.0 59.0 0.0381 0.0019 0.0500 0.6 3.0
17..6 0.039 292.0 59.0 0.0381 0.0025 0.0647 0.7 3.8
17..18 0.033 292.0 59.0 0.0381 0.0021 0.0558 0.6 3.3
18..7 0.017 292.0 59.0 0.0381 0.0011 0.0292 0.3 1.7
18..8 0.053 292.0 59.0 0.0381 0.0034 0.0880 1.0 5.2
16..9 0.179 292.0 59.0 0.0381 0.0114 0.2991 3.3 17.7
16..19 0.064 292.0 59.0 0.0381 0.0041 0.1074 1.2 6.3
19..10 0.158 292.0 59.0 0.0381 0.0101 0.2642 2.9 15.6
19..20 0.062 292.0 59.0 0.0381 0.0039 0.1027 1.1 6.1
20..11 0.080 292.0 59.0 0.0381 0.0051 0.1328 1.5 7.8
20..12 0.135 292.0 59.0 0.0381 0.0086 0.2259 2.5 13.3
13..21 0.007 292.0 59.0 0.0381 0.0004 0.0114 0.1 0.7
21..2 0.009 292.0 59.0 0.0381 0.0006 0.0158 0.2 0.9
21..3 0.000 292.0 59.0 0.0381 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 1:50
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
lnL(ntime: 20 np: 23): -945.027418 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 16..9 16..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3
0.024906 0.025225 0.008514 0.048030 0.069866 0.022477 0.029937 0.038698 0.033368 0.017454 0.052641 0.178946 0.064336 0.158124 0.061497 0.079540 0.135343 0.006800 0.009450 0.000004 3.941374 0.059576 1.260825
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06515
(1: 0.024906, ((4: 0.048030, 5: 0.069866): 0.008514, ((6: 0.038698, (7: 0.017454, 8: 0.052641): 0.033368): 0.029937, 9: 0.178946, (10: 0.158124, (11: 0.079540, 12: 0.135343): 0.061497): 0.064336): 0.022477): 0.025225, (2: 0.009450, 3: 0.000004): 0.006800);
(D_melanogaster_endos-PB: 0.024906, ((D_yakuba_endos-PB: 0.048030, D_erecta_endos-PB: 0.069866): 0.008514, ((D_takahashii_endos-PB: 0.038698, (D_biarmipes_endos-PB: 0.017454, D_suzukii_endos-PB: 0.052641): 0.033368): 0.029937, D_eugracilis_endos-PB: 0.178946, (D_ficusphila_endos-PB: 0.158124, (D_rhopaloa_endos-PB: 0.079540, D_elegans_endos-PB: 0.135343): 0.061497): 0.064336): 0.022477): 0.025225, (D_sechellia_endos-PB: 0.009450, D_simulans_endos-PB: 0.000004): 0.006800);
Detailed output identifying parameters
kappa (ts/tv) = 3.94137
Parameters in M7 (beta):
p = 0.05958 q = 1.26082
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00051 0.00565 0.04661 0.32477
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0378 0.0016 0.0416 0.5 2.5
13..14 0.025 292.0 59.0 0.0378 0.0016 0.0421 0.5 2.5
14..15 0.009 292.0 59.0 0.0378 0.0005 0.0142 0.2 0.8
15..4 0.048 292.0 59.0 0.0378 0.0030 0.0802 0.9 4.7
15..5 0.070 292.0 59.0 0.0378 0.0044 0.1167 1.3 6.9
14..16 0.022 292.0 59.0 0.0378 0.0014 0.0376 0.4 2.2
16..17 0.030 292.0 59.0 0.0378 0.0019 0.0500 0.6 3.0
17..6 0.039 292.0 59.0 0.0378 0.0024 0.0647 0.7 3.8
17..18 0.033 292.0 59.0 0.0378 0.0021 0.0557 0.6 3.3
18..7 0.017 292.0 59.0 0.0378 0.0011 0.0292 0.3 1.7
18..8 0.053 292.0 59.0 0.0378 0.0033 0.0879 1.0 5.2
16..9 0.179 292.0 59.0 0.0378 0.0113 0.2990 3.3 17.6
16..19 0.064 292.0 59.0 0.0378 0.0041 0.1075 1.2 6.3
19..10 0.158 292.0 59.0 0.0378 0.0100 0.2642 2.9 15.6
19..20 0.061 292.0 59.0 0.0378 0.0039 0.1027 1.1 6.1
20..11 0.080 292.0 59.0 0.0378 0.0050 0.1329 1.5 7.8
20..12 0.135 292.0 59.0 0.0378 0.0085 0.2261 2.5 13.3
13..21 0.007 292.0 59.0 0.0378 0.0004 0.0114 0.1 0.7
21..2 0.009 292.0 59.0 0.0378 0.0006 0.0158 0.2 0.9
21..3 0.000 292.0 59.0 0.0378 0.0000 0.0000 0.0 0.0
Time used: 4:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((6, (7, 8)), 9, (10, (11, 12)))), (2, 3)); MP score: 96
lnL(ntime: 20 np: 25): -945.027860 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..6 17..18 18..7 18..8 16..9 16..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3
0.024906 0.025225 0.008514 0.048031 0.069867 0.022477 0.029938 0.038698 0.033369 0.017454 0.052642 0.178950 0.064337 0.158126 0.061497 0.079542 0.135345 0.006800 0.009451 0.000004 3.941402 0.999990 0.059576 1.260898 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06517
(1: 0.024906, ((4: 0.048031, 5: 0.069867): 0.008514, ((6: 0.038698, (7: 0.017454, 8: 0.052642): 0.033369): 0.029938, 9: 0.178950, (10: 0.158126, (11: 0.079542, 12: 0.135345): 0.061497): 0.064337): 0.022477): 0.025225, (2: 0.009451, 3: 0.000004): 0.006800);
(D_melanogaster_endos-PB: 0.024906, ((D_yakuba_endos-PB: 0.048031, D_erecta_endos-PB: 0.069867): 0.008514, ((D_takahashii_endos-PB: 0.038698, (D_biarmipes_endos-PB: 0.017454, D_suzukii_endos-PB: 0.052642): 0.033369): 0.029938, D_eugracilis_endos-PB: 0.178950, (D_ficusphila_endos-PB: 0.158126, (D_rhopaloa_endos-PB: 0.079542, D_elegans_endos-PB: 0.135345): 0.061497): 0.064337): 0.022477): 0.025225, (D_sechellia_endos-PB: 0.009451, D_simulans_endos-PB: 0.000004): 0.006800);
Detailed output identifying parameters
kappa (ts/tv) = 3.94140
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.05958 q = 1.26090
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00051 0.00564 0.04661 0.32475 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0378 0.0016 0.0416 0.5 2.5
13..14 0.025 292.0 59.0 0.0378 0.0016 0.0421 0.5 2.5
14..15 0.009 292.0 59.0 0.0378 0.0005 0.0142 0.2 0.8
15..4 0.048 292.0 59.0 0.0378 0.0030 0.0802 0.9 4.7
15..5 0.070 292.0 59.0 0.0378 0.0044 0.1167 1.3 6.9
14..16 0.022 292.0 59.0 0.0378 0.0014 0.0376 0.4 2.2
16..17 0.030 292.0 59.0 0.0378 0.0019 0.0500 0.6 3.0
17..6 0.039 292.0 59.0 0.0378 0.0024 0.0647 0.7 3.8
17..18 0.033 292.0 59.0 0.0378 0.0021 0.0557 0.6 3.3
18..7 0.017 292.0 59.0 0.0378 0.0011 0.0292 0.3 1.7
18..8 0.053 292.0 59.0 0.0378 0.0033 0.0879 1.0 5.2
16..9 0.179 292.0 59.0 0.0378 0.0113 0.2990 3.3 17.6
16..19 0.064 292.0 59.0 0.0378 0.0041 0.1075 1.2 6.3
19..10 0.158 292.0 59.0 0.0378 0.0100 0.2642 2.9 15.6
19..20 0.061 292.0 59.0 0.0378 0.0039 0.1027 1.1 6.1
20..11 0.080 292.0 59.0 0.0378 0.0050 0.1329 1.5 7.8
20..12 0.135 292.0 59.0 0.0378 0.0085 0.2261 2.5 13.3
13..21 0.007 292.0 59.0 0.0378 0.0004 0.0114 0.1 0.7
21..2 0.009 292.0 59.0 0.0378 0.0006 0.0158 0.2 0.9
21..3 0.000 292.0 59.0 0.0378 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_endos-PB)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.003 0.016 0.057 0.145 0.289 0.490
ws: 0.243 0.100 0.085 0.082 0.082 0.082 0.082 0.082 0.082 0.082
Time used: 7:35
Model 1: NearlyNeutral -947.591513 Model 2: PositiveSelection -947.591513 Model 0: one-ratio -954.840262 Model 3: discrete -944.979338 Model 7: beta -945.027418 Model 8: beta&w>1 -945.02786 Model 0 vs 1 14.497498000000178 Model 2 vs 1 0.0 Model 8 vs 7 8.840000000418513E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
