--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 16 02:29:09 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/241/endos-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1034.72 -1052.43
2 -1034.72 -1057.95
--------------------------------------
TOTAL -1034.72 -1057.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.864909 0.021560 0.606028 1.166137 0.850675 1069.18 1219.70 1.000
r(A<->C){all} 0.059170 0.000645 0.014575 0.109451 0.055984 730.17 756.21 1.000
r(A<->G){all} 0.161766 0.002844 0.068365 0.263594 0.154507 481.83 510.35 1.000
r(A<->T){all} 0.147841 0.004031 0.039627 0.276007 0.139888 526.97 537.51 1.000
r(C<->G){all} 0.027423 0.000152 0.006259 0.052005 0.025608 1111.26 1117.14 1.000
r(C<->T){all} 0.560160 0.007372 0.400017 0.728563 0.558670 368.66 405.90 1.000
r(G<->T){all} 0.043640 0.000607 0.004498 0.091908 0.039432 851.11 898.79 1.000
pi(A){all} 0.263122 0.000539 0.216968 0.305883 0.262279 906.51 945.46 1.000
pi(C){all} 0.320799 0.000553 0.271287 0.365587 0.321433 766.66 1033.94 1.000
pi(G){all} 0.296338 0.000547 0.249027 0.340836 0.296156 1061.71 1100.42 1.000
pi(T){all} 0.119740 0.000274 0.088736 0.153414 0.118758 623.80 807.86 1.000
alpha{1,2} 0.108833 0.000752 0.062121 0.165628 0.106103 1249.72 1375.36 1.000
alpha{3} 2.167137 0.669027 0.897424 3.785750 2.036796 1351.95 1374.40 1.000
pinvar{all} 0.329113 0.007477 0.162861 0.494978 0.333377 1282.45 1317.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -947.477906
Model 2: PositiveSelection -947.477906
Model 0: one-ratio -954.749766
Model 3: discrete -944.892316
Model 7: beta -944.940117
Model 8: beta&w>1 -944.940556
Model 0 vs 1 14.543720000000121
Model 2 vs 1 0.0
Model 8 vs 7 8.780000000569999E-4
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C5
MSSAEENSNSPATTPQDEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGGH
SAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPETV
PARKTSIIQPCNKFPATSo
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQRQKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPETV
PARKTSIIQPCNKFPATSo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=120
C1 MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C2 MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C3 MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C4 MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
C5 MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
C6 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C7 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C8 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C9 MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C10 MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
C11 MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
C12 MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
***:****** ****** *.:*: **************************
C1 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C2 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C3 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C4 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C5 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C6 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C7 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C8 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
C9 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C10 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
C11 HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
C12 HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
**********: *****************.******** .**********
C1 VPARKTSIIQPCNKFPATS-
C2 VPARKTSIIQPCNKFPATS-
C3 VPARKTSIIQPCNKFPATS-
C4 VPARKTSIIQPCNKFPATS-
C5 VPARKTSIIQPCNKFPATSo
C6 VPARKTSIIQPCNKFPATS-
C7 VPARKTSIIQPCNKFPATS-
C8 VPARKTSIIQPCNKFPATS-
C9 VPARKTSIIQPCNKFPATS-
C10 VPARKTSIIQPCNKFPATS-
C11 VPARKTSIIQPCNKFPATS-
C12 VPARKTSIIQPCNKFPATSo
*******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15990]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [15990]--->[15984]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/241/endos-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.608 Mb, Max= 31.022 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C5
MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATSo
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
VPARKTSIIQPCNKFPATSo
FORMAT of file /tmp/tmp4464158264521547281aln Not Supported[FATAL:T-COFFEE]
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C5
MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATSo
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS-
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
VPARKTSIIQPCNKFPATSo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:120 S:99 BS:120
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 98.32 C1 C2 98.32
TOP 1 0 98.32 C2 C1 98.32
BOT 0 2 98.32 C1 C3 98.32
TOP 2 0 98.32 C3 C1 98.32
BOT 0 3 96.64 C1 C4 96.64
TOP 3 0 96.64 C4 C1 96.64
BOT 0 4 97.46 C1 C5 97.46
TOP 4 0 97.46 C5 C1 97.46
BOT 0 5 97.48 C1 C6 97.48
TOP 5 0 97.48 C6 C1 97.48
BOT 0 6 97.48 C1 C7 97.48
TOP 6 0 97.48 C7 C1 97.48
BOT 0 7 96.64 C1 C8 96.64
TOP 7 0 96.64 C8 C1 96.64
BOT 0 8 97.48 C1 C9 97.48
TOP 8 0 97.48 C9 C1 97.48
BOT 0 9 96.64 C1 C10 96.64
TOP 9 0 96.64 C10 C1 96.64
BOT 0 10 95.80 C1 C11 95.80
TOP 10 0 95.80 C11 C1 95.80
BOT 0 11 93.22 C1 C12 93.22
TOP 11 0 93.22 C12 C1 93.22
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 97.48 C2 C4 97.48
TOP 3 1 97.48 C4 C2 97.48
BOT 1 4 97.46 C2 C5 97.46
TOP 4 1 97.46 C5 C2 97.46
BOT 1 5 98.32 C2 C6 98.32
TOP 5 1 98.32 C6 C2 98.32
BOT 1 6 98.32 C2 C7 98.32
TOP 6 1 98.32 C7 C2 98.32
BOT 1 7 97.48 C2 C8 97.48
TOP 7 1 97.48 C8 C2 97.48
BOT 1 8 98.32 C2 C9 98.32
TOP 8 1 98.32 C9 C2 98.32
BOT 1 9 97.48 C2 C10 97.48
TOP 9 1 97.48 C10 C2 97.48
BOT 1 10 96.64 C2 C11 96.64
TOP 10 1 96.64 C11 C2 96.64
BOT 1 11 93.22 C2 C12 93.22
TOP 11 1 93.22 C12 C2 93.22
BOT 2 3 97.48 C3 C4 97.48
TOP 3 2 97.48 C4 C3 97.48
BOT 2 4 97.46 C3 C5 97.46
TOP 4 2 97.46 C5 C3 97.46
BOT 2 5 98.32 C3 C6 98.32
TOP 5 2 98.32 C6 C3 98.32
BOT 2 6 98.32 C3 C7 98.32
TOP 6 2 98.32 C7 C3 98.32
BOT 2 7 97.48 C3 C8 97.48
TOP 7 2 97.48 C8 C3 97.48
BOT 2 8 98.32 C3 C9 98.32
TOP 8 2 98.32 C9 C3 98.32
BOT 2 9 97.48 C3 C10 97.48
TOP 9 2 97.48 C10 C3 97.48
BOT 2 10 96.64 C3 C11 96.64
TOP 10 2 96.64 C11 C3 96.64
BOT 2 11 93.22 C3 C12 93.22
TOP 11 2 93.22 C12 C3 93.22
BOT 3 4 99.15 C4 C5 99.15
TOP 4 3 99.15 C5 C4 99.15
BOT 3 5 99.16 C4 C6 99.16
TOP 5 3 99.16 C6 C4 99.16
BOT 3 6 99.16 C4 C7 99.16
TOP 6 3 99.16 C7 C4 99.16
BOT 3 7 98.32 C4 C8 98.32
TOP 7 3 98.32 C8 C4 98.32
BOT 3 8 99.16 C4 C9 99.16
TOP 8 3 99.16 C9 C4 99.16
BOT 3 9 98.32 C4 C10 98.32
TOP 9 3 98.32 C10 C4 98.32
BOT 3 10 98.32 C4 C11 98.32
TOP 10 3 98.32 C11 C4 98.32
BOT 3 11 94.07 C4 C12 94.07
TOP 11 3 94.07 C12 C4 94.07
BOT 4 5 99.15 C5 C6 99.15
TOP 5 4 99.15 C6 C5 99.15
BOT 4 6 99.15 C5 C7 99.15
TOP 6 4 99.15 C7 C5 99.15
BOT 4 7 98.31 C5 C8 98.31
TOP 7 4 98.31 C8 C5 98.31
BOT 4 8 99.15 C5 C9 99.15
TOP 8 4 99.15 C9 C5 99.15
BOT 4 9 98.31 C5 C10 98.31
TOP 9 4 98.31 C10 C5 98.31
BOT 4 10 99.15 C5 C11 99.15
TOP 10 4 99.15 C11 C5 99.15
BOT 4 11 94.92 C5 C12 94.92
TOP 11 4 94.92 C12 C5 94.92
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 99.16 C6 C8 99.16
TOP 7 5 99.16 C8 C6 99.16
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 99.16 C6 C10 99.16
TOP 9 5 99.16 C10 C6 99.16
BOT 5 10 98.32 C6 C11 98.32
TOP 10 5 98.32 C11 C6 98.32
BOT 5 11 94.07 C6 C12 94.07
TOP 11 5 94.07 C12 C6 94.07
BOT 6 7 99.16 C7 C8 99.16
TOP 7 6 99.16 C8 C7 99.16
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 99.16 C7 C10 99.16
TOP 9 6 99.16 C10 C7 99.16
BOT 6 10 98.32 C7 C11 98.32
TOP 10 6 98.32 C11 C7 98.32
BOT 6 11 94.07 C7 C12 94.07
TOP 11 6 94.07 C12 C7 94.07
BOT 7 8 99.16 C8 C9 99.16
TOP 8 7 99.16 C9 C8 99.16
BOT 7 9 98.32 C8 C10 98.32
TOP 9 7 98.32 C10 C8 98.32
BOT 7 10 97.48 C8 C11 97.48
TOP 10 7 97.48 C11 C8 97.48
BOT 7 11 93.22 C8 C12 93.22
TOP 11 7 93.22 C12 C8 93.22
BOT 8 9 99.16 C9 C10 99.16
TOP 9 8 99.16 C10 C9 99.16
BOT 8 10 98.32 C9 C11 98.32
TOP 10 8 98.32 C11 C9 98.32
BOT 8 11 94.07 C9 C12 94.07
TOP 11 8 94.07 C12 C9 94.07
BOT 9 10 97.48 C10 C11 97.48
TOP 10 9 97.48 C11 C10 97.48
BOT 9 11 93.22 C10 C12 93.22
TOP 11 9 93.22 C12 C10 93.22
BOT 10 11 95.76 C11 C12 95.76
TOP 11 10 95.76 C12 C11 95.76
AVG 0 C1 * 96.86
AVG 1 C2 * 97.55
AVG 2 C3 * 97.55
AVG 3 C4 * 97.93
AVG 4 C5 * 98.15
AVG 5 C6 * 98.47
AVG 6 C7 * 98.47
AVG 7 C8 * 97.70
AVG 8 C9 * 98.47
AVG 9 C10 * 97.70
AVG 10 C11 * 97.48
AVG 11 C12 * 93.91
TOT TOT * 97.52
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C2 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACTCCCCAGGA
C3 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C4 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C5 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C6 ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C7 ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C8 ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C9 ATGAGCTCTGCGGAGGAAAACAGCAATAGCCCGGCTACCACGCCCCAGGA
C10 ATGAGCTCCACGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C11 ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C12 ATGAGTTCCGCGGAGGAAAACAGCAACAGCCAGGCCACCACGCCCCAGGA
***** ** .****.*********** ****.*** ***** ********
C1 CACCGAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGG
C2 CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C3 CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C4 CAACGAGGCCGCCGAACAGCCCAACCTCACGGATCTCGAGAAGATCGAGG
C5 C---GAGGCCGCCGAACAGGTCAACCTCACGGATCTGGAGAAGATCGAGG
C6 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C7 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C8 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C9 CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
C10 TAACGAGGCTGCAGAGCAGGCAAACCTCACGGATCTCGAGAAGATTGAGG
C11 CAACGAGGCCGCCGAGCAGGTCAACCTCACGGATCTCGAGAAGATCGAGG
C12 CAACGAGACCGCTGAGAATGTCAACCTCACGGATCTCGAGAAGATCGAGG
*** * .* **..* ************** ******** ****
C1 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C2 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C3 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C4 AGGAGAAACTCAAGTCGAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
C5 AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGT
C6 AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCCGGCGGA
C7 AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCTGGCGGA
C8 AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCCGGCGGG
C9 AGGAGAAGCTCAAGAGCAAGTATCCCAGCGGAATGCGTGTACCCGGTGGA
C10 AGGAGAAGCTGAAGTCCAAGTACCCTAGTGGAATGCGAGTGCCCGGCGGA
C11 AGGAGAAGCTCAAGTCCAAGTACCCCAGTGGAATGCGAGTACCCGGAGGT
C12 AGGAGAAGCTCAAGTCCAAGTATCCCAGTGGAATGCGAGTGCCGGGCGGT
*******.** ***: ***** ** ** **.***** **.** ** **
C1 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C2 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C3 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C4 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAAGGGCAAAAGTTCTTCGA
C5 CATTCGGCCTTCCTTCAGAAGAGGTTGCAGAAGGGGCAAAAGTTCTTCGA
C6 CACTCGGCTTTCCTACAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C7 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C8 CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C9 CACTCGGCCTTTCTGCAAAAAAGGCTCCAGAAGGGGCAAAAATTCTTCGA
C10 CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C11 CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
C12 CACTCGGCCTTCCTCCAAAAAAGGCTGCAGAGG---CAAAAGTTCTTCGA
** ***** ** ** **.**.*** * ****.. *****.********
C1 CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C2 CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C3 CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C4 CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGGGTCAAGCAGG
C5 CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
C6 CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTTAAGCAGG
C7 CTCGGGAGACTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C8 CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
C9 CTCGGGCGATTACCAAATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C10 TTCGGGCGACTATCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
C11 CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
C12 CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
*****.** ** **.********.************.* ** *******
C1 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C2 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C3 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C4 TCTTTGCCAACAAGGTGACCACCGGGGAAGCCATTCCCACGCCCGAAACC
C5 TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C6 TCTTTGCCAACAAGGTTACCACTGGGGAGGCCATTCCCACGCCCGAAACC
C7 TCTTTGCCAACAAGGTTACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C8 TCTTTGCCAACAAGAACACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C9 TCTTTGCCAATAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
C10 TCTTTGCCAACAAGGTGACCACCGGGGAGGCTATTCCCACGCCCGAAACC
C11 TCTTTGCCAACAAGGTGACCACCGGAGAGGCCATTCCCACGCCCGAAACC
C12 TCTTTGCCAACAAGGTGCCCACCGGGGAGGCCATTCCCACGCCCGAAACC
********** ***.: .**** **.**.** ******************
C1 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C2 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C3 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C4 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C5 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C6 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
C7 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
C8 GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
C9 GTGCCGGCGCGCAAGACTTCGATTATCCAACCCTGTAACAAGTTCCCGGC
C10 GTGCCGGCGCGCAAGACCTCGATCATCCAACCATGCAACAAGTTCCCAGC
C11 GTGCCGGCACGAAAGACTTCGATCATCCAACCCTGCAACAAGTTCCCAGC
C12 GTGCCGGCACGCAAGACCTCGATCATCCAACCCTGCAACAAATTCCCAGC
********.**.***** ***** ********.** *****.***** **
C1 GACGAGC---
C2 GACGAGC---
C3 GACGAGC---
C4 GACGAGC---
C5 GACGAGC---
C6 GACGAGC---
C7 GACGAGC---
C8 GACGAGC---
C9 GACGAGC---
C10 GACGAGC---
C11 GACAAGC---
C12 GACGAGC---
***.***
>C1
ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CACCGAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C2
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACTCCCCAGGA
CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C3
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C4
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAACAGCCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAACTCAAGTCGAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAAGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGGGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAAGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C5
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
C---GAGGCCGCCGAACAGGTCAACCTCACGGATCTGGAGAAGATCGAGG
AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGT
CATTCGGCCTTCCTTCAGAAGAGGTTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C6
ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCCGGCGGA
CACTCGGCTTTCCTACAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTTAAGCAGG
TCTTTGCCAACAAGGTTACCACTGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C7
ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCTGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGAGACTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTTACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
GACGAGC---
>C8
ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCCGGCGGG
CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGAACACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC
GACGAGC---
>C9
ATGAGCTCTGCGGAGGAAAACAGCAATAGCCCGGCTACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGAGCAAGTATCCCAGCGGAATGCGTGTACCCGGTGGA
CACTCGGCCTTTCTGCAAAAAAGGCTCCAGAAGGGGCAAAAATTCTTCGA
CTCGGGCGATTACCAAATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAATAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACTTCGATTATCCAACCCTGTAACAAGTTCCCGGC
GACGAGC---
>C10
ATGAGCTCCACGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
TAACGAGGCTGCAGAGCAGGCAAACCTCACGGATCTCGAGAAGATTGAGG
AGGAGAAGCTGAAGTCCAAGTACCCTAGTGGAATGCGAGTGCCCGGCGGA
CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
TTCGGGCGACTATCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGGGAGGCTATTCCCACGCCCGAAACC
GTGCCGGCGCGCAAGACCTCGATCATCCAACCATGCAACAAGTTCCCAGC
GACGAGC---
>C11
ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA
CAACGAGGCCGCCGAGCAGGTCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTACCCCAGTGGAATGCGAGTACCCGGAGGT
CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA
CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
TCTTTGCCAACAAGGTGACCACCGGAGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCACGAAAGACTTCGATCATCCAACCCTGCAACAAGTTCCCAGC
GACAAGC---
>C12
ATGAGTTCCGCGGAGGAAAACAGCAACAGCCAGGCCACCACGCCCCAGGA
CAACGAGACCGCTGAGAATGTCAACCTCACGGATCTCGAGAAGATCGAGG
AGGAGAAGCTCAAGTCCAAGTATCCCAGTGGAATGCGAGTGCCGGGCGGT
CACTCGGCCTTCCTCCAAAAAAGGCTGCAGAGG---CAAAAGTTCTTCGA
CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG
TCTTTGCCAACAAGGTGCCCACCGGGGAGGCCATTCCCACGCCCGAAACC
GTGCCGGCACGCAAGACCTCGATCATCCAACCCTGCAACAAATTCCCAGC
GACGAGC---
>C1
MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C2
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C3
MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C4
MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C5
MSSAEENSNSPATTPQDoEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C6
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C7
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C8
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C9
MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C10
MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C11
MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
VPARKTSIIQPCNKFPATS
>C12
MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
HSAFLQKRLQRoQKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
VPARKTSIIQPCNKFPATS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 360 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479262476
Setting output file names to "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 39730901
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2177714925
Seed = 1618763353
Swapseed = 1479262476
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 17 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 51 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1586.135680 -- -24.979900
Chain 2 -- -1610.803624 -- -24.979900
Chain 3 -- -1597.113750 -- -24.979900
Chain 4 -- -1608.969125 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1610.290852 -- -24.979900
Chain 2 -- -1607.969107 -- -24.979900
Chain 3 -- -1605.632002 -- -24.979900
Chain 4 -- -1598.861846 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1586.136] (-1610.804) (-1597.114) (-1608.969) * [-1610.291] (-1607.969) (-1605.632) (-1598.862)
500 -- (-1080.246) (-1096.178) [-1087.047] (-1083.389) * (-1114.466) (-1093.845) [-1105.312] (-1097.628) -- 0:00:00
1000 -- (-1078.867) (-1074.828) (-1072.551) [-1068.363] * (-1083.607) (-1077.614) (-1086.261) [-1062.960] -- 0:00:00
1500 -- (-1083.175) (-1062.836) (-1063.062) [-1065.611] * (-1088.739) (-1070.769) (-1084.052) [-1053.210] -- 0:00:00
2000 -- (-1062.376) (-1059.672) [-1053.134] (-1072.162) * (-1068.093) (-1063.183) [-1073.759] (-1046.168) -- 0:08:19
2500 -- (-1049.157) [-1044.199] (-1044.028) (-1065.230) * (-1090.245) (-1053.251) (-1057.591) [-1047.736] -- 0:06:39
3000 -- (-1053.135) [-1043.138] (-1044.646) (-1058.201) * (-1067.419) [-1046.290] (-1058.750) (-1051.234) -- 0:05:32
3500 -- (-1050.872) (-1043.024) (-1049.824) [-1044.203] * (-1068.019) [-1046.958] (-1058.653) (-1048.598) -- 0:04:44
4000 -- (-1047.912) [-1038.731] (-1037.485) (-1052.323) * (-1046.976) (-1042.622) [-1036.528] (-1046.687) -- 0:04:09
4500 -- (-1053.000) (-1053.434) [-1043.389] (-1076.812) * (-1077.001) (-1046.414) (-1066.554) [-1045.702] -- 0:03:41
5000 -- (-1045.182) (-1049.296) [-1041.313] (-1051.288) * [-1049.327] (-1039.200) (-1054.059) (-1053.229) -- 0:06:38
Average standard deviation of split frequencies: 0.073946
5500 -- (-1057.311) (-1053.287) [-1040.483] (-1053.796) * (-1045.473) (-1039.403) [-1038.987] (-1036.809) -- 0:06:01
6000 -- (-1057.343) [-1046.714] (-1044.324) (-1048.543) * (-1038.452) (-1043.126) (-1057.873) [-1041.157] -- 0:05:31
6500 -- (-1044.960) (-1044.868) (-1043.335) [-1043.893] * (-1051.220) [-1043.368] (-1044.447) (-1036.670) -- 0:05:05
7000 -- (-1050.648) [-1055.461] (-1042.902) (-1047.105) * (-1047.151) (-1045.345) (-1046.212) [-1036.957] -- 0:04:43
7500 -- [-1039.264] (-1053.247) (-1051.763) (-1045.698) * (-1049.800) (-1049.814) (-1055.049) [-1045.550] -- 0:04:24
8000 -- (-1056.053) [-1045.029] (-1054.714) (-1048.694) * [-1033.936] (-1033.607) (-1051.125) (-1046.160) -- 0:06:12
8500 -- (-1053.026) [-1043.451] (-1048.579) (-1046.906) * (-1047.649) [-1040.293] (-1061.206) (-1040.391) -- 0:05:49
9000 -- (-1052.604) [-1039.585] (-1040.683) (-1045.572) * (-1057.670) (-1047.135) [-1039.105] (-1036.656) -- 0:05:30
9500 -- [-1048.868] (-1047.653) (-1042.835) (-1039.297) * (-1041.768) [-1036.982] (-1042.579) (-1055.352) -- 0:05:12
10000 -- [-1038.656] (-1052.898) (-1050.057) (-1038.752) * (-1060.432) [-1043.280] (-1045.271) (-1055.358) -- 0:04:57
Average standard deviation of split frequencies: 0.076603
10500 -- (-1040.475) (-1051.067) (-1042.320) [-1042.709] * (-1049.538) [-1038.136] (-1045.286) (-1043.136) -- 0:04:42
11000 -- (-1040.282) (-1048.455) [-1052.180] (-1045.294) * [-1044.217] (-1053.261) (-1043.774) (-1043.819) -- 0:05:59
11500 -- (-1044.130) [-1041.103] (-1048.972) (-1047.227) * [-1040.218] (-1056.824) (-1047.441) (-1040.735) -- 0:05:43
12000 -- (-1052.311) (-1050.313) [-1035.919] (-1049.802) * [-1041.248] (-1039.562) (-1053.352) (-1054.267) -- 0:05:29
12500 -- (-1050.119) (-1048.591) [-1044.181] (-1039.783) * [-1037.658] (-1053.337) (-1045.374) (-1046.262) -- 0:05:16
13000 -- (-1047.944) (-1046.593) (-1049.523) [-1037.768] * (-1041.294) (-1045.485) [-1046.727] (-1057.093) -- 0:05:03
13500 -- [-1041.648] (-1060.963) (-1048.399) (-1037.736) * [-1039.153] (-1048.646) (-1050.741) (-1049.651) -- 0:04:52
14000 -- (-1035.998) [-1041.738] (-1046.452) (-1041.939) * (-1035.610) (-1042.724) (-1048.463) [-1049.396] -- 0:05:52
14500 -- (-1046.936) [-1034.351] (-1045.629) (-1060.097) * (-1036.275) (-1046.104) [-1044.044] (-1051.663) -- 0:05:39
15000 -- (-1048.541) [-1036.014] (-1048.766) (-1054.999) * [-1036.932] (-1063.816) (-1044.747) (-1042.614) -- 0:05:28
Average standard deviation of split frequencies: 0.053033
15500 -- (-1044.729) (-1047.918) (-1039.424) [-1041.387] * (-1042.968) [-1040.411] (-1041.889) (-1046.287) -- 0:05:17
16000 -- [-1043.581] (-1042.756) (-1041.302) (-1039.023) * (-1057.602) (-1052.668) [-1042.124] (-1056.378) -- 0:05:07
16500 -- (-1042.826) (-1043.279) [-1039.135] (-1049.164) * (-1048.164) [-1053.529] (-1042.756) (-1058.248) -- 0:04:58
17000 -- (-1041.137) [-1042.982] (-1033.390) (-1054.076) * (-1050.992) (-1052.438) (-1034.325) [-1052.064] -- 0:05:46
17500 -- (-1055.656) [-1037.599] (-1050.473) (-1051.208) * (-1047.467) (-1036.525) [-1034.883] (-1048.337) -- 0:05:36
18000 -- (-1044.685) (-1040.039) (-1044.520) [-1035.611] * [-1036.533] (-1040.295) (-1043.811) (-1048.444) -- 0:05:27
18500 -- (-1054.694) [-1041.177] (-1039.923) (-1048.487) * (-1041.368) (-1062.604) [-1041.507] (-1045.994) -- 0:05:18
19000 -- [-1050.734] (-1043.640) (-1038.396) (-1043.044) * [-1036.308] (-1048.802) (-1043.425) (-1045.656) -- 0:05:09
19500 -- (-1065.870) [-1041.014] (-1042.092) (-1041.319) * (-1047.635) [-1041.540] (-1062.468) (-1044.411) -- 0:05:01
20000 -- (-1050.556) (-1041.206) (-1038.476) [-1037.203] * [-1036.583] (-1044.855) (-1038.724) (-1031.419) -- 0:04:54
Average standard deviation of split frequencies: 0.033455
20500 -- (-1049.664) [-1034.226] (-1043.740) (-1049.963) * (-1039.371) [-1033.031] (-1039.054) (-1043.303) -- 0:05:34
21000 -- (-1056.576) (-1039.213) [-1039.142] (-1041.592) * (-1045.282) (-1044.653) (-1036.864) [-1042.445] -- 0:05:26
21500 -- (-1046.020) (-1044.056) [-1045.857] (-1045.453) * (-1032.629) (-1041.418) [-1038.055] (-1043.943) -- 0:05:18
22000 -- (-1056.511) (-1049.126) [-1037.039] (-1045.020) * [-1041.339] (-1049.649) (-1042.909) (-1050.036) -- 0:05:11
22500 -- (-1047.894) (-1043.829) [-1045.453] (-1048.578) * (-1039.585) (-1044.338) [-1039.346] (-1044.260) -- 0:05:04
23000 -- [-1036.326] (-1049.235) (-1049.957) (-1055.584) * (-1045.415) (-1051.852) (-1050.221) [-1045.836] -- 0:04:57
23500 -- (-1046.603) (-1047.529) (-1040.822) [-1037.435] * (-1044.496) (-1052.743) [-1043.814] (-1046.042) -- 0:05:32
24000 -- (-1048.506) (-1047.129) (-1035.695) [-1038.075] * [-1041.386] (-1051.164) (-1057.944) (-1046.056) -- 0:05:25
24500 -- [-1043.561] (-1043.601) (-1053.514) (-1039.198) * [-1046.175] (-1055.417) (-1041.108) (-1043.163) -- 0:05:18
25000 -- (-1050.688) (-1041.010) (-1044.010) [-1038.762] * [-1035.938] (-1041.905) (-1041.357) (-1035.293) -- 0:05:12
Average standard deviation of split frequencies: 0.021757
25500 -- (-1038.787) (-1044.863) (-1053.557) [-1044.392] * (-1053.907) (-1049.760) (-1058.521) [-1043.786] -- 0:05:05
26000 -- (-1051.007) (-1074.525) (-1053.729) [-1040.528] * [-1037.328] (-1047.431) (-1051.317) (-1049.597) -- 0:04:59
26500 -- [-1047.674] (-1053.238) (-1047.984) (-1043.401) * (-1038.563) (-1054.842) [-1038.958] (-1046.863) -- 0:05:30
27000 -- [-1049.156] (-1047.040) (-1041.336) (-1046.902) * (-1038.044) [-1043.357] (-1039.313) (-1049.146) -- 0:05:24
27500 -- (-1050.277) [-1046.460] (-1039.286) (-1047.506) * (-1047.077) (-1040.628) [-1047.786] (-1045.944) -- 0:05:18
28000 -- (-1051.959) [-1033.023] (-1042.023) (-1049.116) * (-1049.350) [-1041.917] (-1044.271) (-1046.348) -- 0:05:12
28500 -- (-1043.673) (-1061.994) (-1047.786) [-1048.873] * (-1050.104) (-1043.287) [-1053.708] (-1044.285) -- 0:05:06
29000 -- (-1045.445) [-1042.183] (-1045.339) (-1050.918) * (-1044.254) (-1049.465) (-1052.401) [-1040.969] -- 0:05:01
29500 -- (-1044.029) (-1050.300) (-1057.346) [-1036.541] * (-1049.583) [-1043.493] (-1038.047) (-1047.987) -- 0:05:28
30000 -- [-1046.244] (-1043.957) (-1047.773) (-1037.643) * (-1042.330) (-1050.644) (-1044.858) [-1035.917] -- 0:05:23
Average standard deviation of split frequencies: 0.028694
30500 -- (-1038.771) [-1036.803] (-1051.424) (-1054.857) * [-1042.112] (-1049.866) (-1039.644) (-1055.955) -- 0:05:17
31000 -- (-1040.779) (-1041.470) (-1044.021) [-1052.106] * (-1042.115) (-1054.112) (-1045.692) [-1045.947] -- 0:05:12
31500 -- (-1044.644) (-1040.729) (-1041.934) [-1041.192] * (-1041.989) [-1046.575] (-1054.065) (-1047.997) -- 0:05:07
32000 -- (-1039.655) (-1038.268) (-1046.035) [-1041.896] * (-1042.876) (-1040.224) [-1039.678] (-1048.893) -- 0:05:02
32500 -- (-1049.545) (-1044.228) (-1047.296) [-1034.302] * [-1047.570] (-1042.461) (-1047.121) (-1056.140) -- 0:05:27
33000 -- (-1038.436) (-1040.670) [-1040.490] (-1051.673) * (-1052.888) (-1044.811) (-1052.798) [-1042.753] -- 0:05:22
33500 -- (-1044.619) (-1055.449) [-1033.119] (-1044.611) * (-1057.455) (-1049.280) [-1040.798] (-1045.875) -- 0:05:17
34000 -- (-1049.337) (-1043.044) (-1044.375) [-1034.563] * (-1042.732) [-1038.039] (-1038.597) (-1055.024) -- 0:05:12
34500 -- (-1033.622) [-1038.518] (-1057.985) (-1043.054) * (-1039.790) [-1038.807] (-1037.125) (-1044.543) -- 0:05:07
35000 -- (-1038.370) (-1034.677) (-1052.432) [-1037.461] * (-1049.947) (-1037.075) (-1052.118) [-1042.532] -- 0:05:03
Average standard deviation of split frequencies: 0.022448
35500 -- (-1052.825) (-1043.163) [-1045.056] (-1042.208) * (-1048.008) (-1040.653) (-1043.141) [-1043.771] -- 0:05:26
36000 -- (-1053.779) (-1036.592) [-1039.673] (-1048.744) * (-1063.674) [-1040.991] (-1038.480) (-1038.556) -- 0:05:21
36500 -- [-1045.071] (-1047.314) (-1041.298) (-1044.331) * (-1048.108) (-1044.095) [-1039.828] (-1048.492) -- 0:05:16
37000 -- (-1055.510) (-1039.068) [-1041.748] (-1042.075) * (-1048.838) (-1044.827) (-1039.131) [-1042.243] -- 0:05:12
37500 -- (-1044.207) [-1047.394] (-1048.316) (-1060.617) * [-1041.922] (-1046.248) (-1044.350) (-1045.942) -- 0:05:08
38000 -- (-1044.553) (-1047.102) [-1038.359] (-1061.529) * (-1056.457) [-1034.464] (-1051.247) (-1039.011) -- 0:05:03
38500 -- (-1052.811) (-1040.480) [-1039.457] (-1057.730) * (-1046.620) [-1039.897] (-1051.875) (-1049.464) -- 0:04:59
39000 -- (-1049.127) (-1038.735) [-1049.437] (-1068.034) * (-1042.631) [-1038.037] (-1060.817) (-1054.465) -- 0:05:20
39500 -- [-1039.191] (-1041.996) (-1043.126) (-1054.527) * (-1039.112) (-1054.009) (-1042.605) [-1039.627] -- 0:05:16
40000 -- (-1054.594) [-1036.816] (-1051.786) (-1035.276) * (-1052.453) (-1042.850) (-1036.842) [-1041.716] -- 0:05:12
Average standard deviation of split frequencies: 0.015732
40500 -- (-1051.179) (-1038.174) (-1043.928) [-1042.093] * (-1052.787) (-1040.547) (-1045.267) [-1040.093] -- 0:05:07
41000 -- (-1042.893) (-1054.321) [-1043.998] (-1045.883) * (-1053.629) (-1051.737) (-1044.673) [-1035.087] -- 0:05:04
41500 -- (-1044.088) (-1044.575) (-1048.600) [-1043.448] * (-1056.372) (-1036.640) [-1041.719] (-1050.460) -- 0:05:00
42000 -- (-1045.406) [-1044.748] (-1067.484) (-1049.972) * (-1056.121) (-1039.701) [-1035.504] (-1054.892) -- 0:05:19
42500 -- (-1045.488) (-1042.702) (-1061.671) [-1048.230] * (-1057.312) (-1041.859) [-1035.517] (-1064.772) -- 0:05:15
43000 -- [-1042.164] (-1049.086) (-1050.378) (-1040.039) * (-1054.006) (-1061.303) [-1031.349] (-1044.356) -- 0:05:11
43500 -- (-1042.101) [-1033.812] (-1045.148) (-1040.472) * [-1045.282] (-1042.851) (-1037.808) (-1038.168) -- 0:05:07
44000 -- (-1037.153) [-1039.859] (-1053.480) (-1046.105) * (-1053.903) [-1044.565] (-1044.622) (-1043.026) -- 0:05:04
44500 -- [-1047.062] (-1047.031) (-1046.908) (-1052.973) * (-1050.490) [-1041.390] (-1063.829) (-1034.314) -- 0:05:00
45000 -- [-1047.386] (-1040.141) (-1047.585) (-1055.488) * [-1044.985] (-1047.589) (-1047.059) (-1042.012) -- 0:05:18
Average standard deviation of split frequencies: 0.020496
45500 -- [-1037.986] (-1048.469) (-1047.271) (-1054.706) * [-1041.004] (-1055.228) (-1046.831) (-1039.256) -- 0:05:14
46000 -- (-1051.639) (-1035.897) (-1053.801) [-1034.352] * (-1039.744) (-1048.354) (-1052.117) [-1036.390] -- 0:05:11
46500 -- [-1041.283] (-1044.068) (-1048.351) (-1036.521) * [-1037.130] (-1056.056) (-1037.132) (-1034.703) -- 0:05:07
47000 -- (-1050.038) [-1047.094] (-1040.320) (-1036.795) * [-1035.431] (-1042.695) (-1029.739) (-1044.897) -- 0:05:04
47500 -- [-1036.752] (-1055.232) (-1048.903) (-1048.239) * (-1044.273) (-1045.211) [-1048.278] (-1052.077) -- 0:05:00
48000 -- [-1035.967] (-1052.965) (-1047.721) (-1039.128) * (-1043.508) (-1045.000) [-1041.619] (-1045.766) -- 0:05:17
48500 -- (-1058.040) (-1047.433) (-1037.358) [-1035.771] * [-1041.857] (-1055.062) (-1037.836) (-1046.693) -- 0:05:13
49000 -- [-1046.887] (-1053.293) (-1037.499) (-1039.067) * (-1051.234) (-1051.953) [-1035.592] (-1050.201) -- 0:05:10
49500 -- (-1043.021) [-1042.820] (-1042.398) (-1046.068) * (-1055.438) (-1049.054) [-1047.718] (-1049.653) -- 0:05:07
50000 -- (-1041.036) [-1043.361] (-1043.141) (-1054.579) * (-1045.045) (-1051.296) (-1046.942) [-1040.269] -- 0:05:04
Average standard deviation of split frequencies: 0.022596
50500 -- (-1049.148) (-1057.016) [-1041.636] (-1041.291) * (-1050.159) (-1043.172) [-1048.873] (-1046.233) -- 0:05:00
51000 -- (-1052.783) (-1049.365) [-1037.304] (-1037.339) * (-1045.538) (-1049.337) [-1040.235] (-1047.474) -- 0:05:16
51500 -- (-1051.105) (-1040.549) (-1048.573) [-1039.102] * (-1046.319) (-1047.984) (-1037.110) [-1033.370] -- 0:05:13
52000 -- [-1037.381] (-1043.737) (-1040.434) (-1042.402) * (-1041.764) (-1040.682) [-1044.494] (-1049.212) -- 0:05:09
52500 -- (-1039.044) (-1044.044) [-1041.650] (-1046.935) * (-1037.635) (-1071.125) (-1039.864) [-1048.970] -- 0:05:06
53000 -- (-1043.934) (-1042.121) (-1069.964) [-1033.913] * (-1044.966) (-1051.878) (-1046.461) [-1036.370] -- 0:05:03
53500 -- [-1043.990] (-1047.670) (-1047.207) (-1041.147) * (-1044.460) (-1048.266) (-1053.328) [-1051.486] -- 0:05:00
54000 -- (-1050.593) [-1039.834] (-1050.740) (-1042.500) * (-1058.676) (-1055.351) (-1047.874) [-1057.830] -- 0:05:15
54500 -- (-1057.564) (-1038.793) (-1039.577) [-1041.163] * (-1052.990) (-1055.710) [-1040.521] (-1040.111) -- 0:05:12
55000 -- (-1044.958) [-1035.005] (-1044.472) (-1047.586) * (-1054.057) (-1045.562) [-1042.455] (-1041.338) -- 0:05:09
Average standard deviation of split frequencies: 0.016235
55500 -- (-1041.296) (-1039.116) (-1049.276) [-1043.902] * (-1042.814) [-1039.689] (-1047.216) (-1049.673) -- 0:05:06
56000 -- [-1032.307] (-1038.543) (-1041.626) (-1032.649) * (-1056.029) (-1049.142) [-1042.300] (-1035.032) -- 0:05:03
56500 -- (-1043.415) [-1049.771] (-1051.245) (-1043.104) * (-1054.694) (-1054.705) [-1048.125] (-1047.134) -- 0:05:00
57000 -- (-1044.606) [-1044.951] (-1043.680) (-1060.768) * (-1047.911) (-1048.377) [-1038.612] (-1044.193) -- 0:05:14
57500 -- (-1047.074) (-1048.871) [-1039.713] (-1053.876) * (-1057.706) (-1049.261) (-1039.954) [-1037.815] -- 0:05:11
58000 -- (-1045.429) (-1048.088) (-1039.317) [-1039.869] * (-1060.151) (-1060.505) (-1041.215) [-1036.146] -- 0:05:08
58500 -- (-1043.571) (-1037.201) (-1043.570) [-1034.472] * (-1047.037) (-1049.200) [-1041.189] (-1044.836) -- 0:05:05
59000 -- (-1045.896) (-1041.586) [-1047.741] (-1046.657) * (-1053.451) (-1049.290) [-1044.918] (-1036.177) -- 0:05:03
59500 -- (-1058.322) [-1036.636] (-1034.970) (-1053.629) * (-1064.049) [-1037.965] (-1047.157) (-1038.971) -- 0:05:00
60000 -- (-1063.075) (-1050.203) (-1053.120) [-1048.160] * (-1061.478) (-1048.369) [-1038.395] (-1045.229) -- 0:05:13
Average standard deviation of split frequencies: 0.020536
60500 -- (-1050.899) (-1049.366) [-1041.475] (-1054.463) * (-1067.668) (-1040.186) [-1041.004] (-1045.616) -- 0:05:10
61000 -- (-1050.774) (-1049.655) [-1037.339] (-1046.688) * (-1046.125) (-1041.879) (-1043.466) [-1042.182] -- 0:05:07
61500 -- (-1041.999) (-1045.098) [-1048.145] (-1049.176) * [-1043.595] (-1041.195) (-1041.665) (-1037.716) -- 0:05:05
62000 -- (-1042.410) [-1045.047] (-1039.945) (-1049.006) * (-1044.195) (-1047.466) [-1035.017] (-1043.053) -- 0:05:02
62500 -- (-1035.807) (-1040.018) (-1048.337) [-1041.356] * (-1037.989) (-1042.552) (-1042.502) [-1042.786] -- 0:05:00
63000 -- (-1046.436) (-1042.756) (-1043.806) [-1038.222] * (-1044.454) (-1047.610) (-1044.973) [-1038.776] -- 0:05:12
63500 -- (-1053.663) [-1037.524] (-1048.263) (-1040.484) * (-1035.138) (-1057.510) (-1048.173) [-1039.167] -- 0:05:09
64000 -- [-1051.557] (-1042.142) (-1064.205) (-1049.371) * (-1046.780) (-1051.629) [-1040.110] (-1034.972) -- 0:05:07
64500 -- (-1060.634) [-1050.974] (-1058.989) (-1052.746) * (-1044.303) [-1044.742] (-1047.892) (-1039.443) -- 0:05:04
65000 -- (-1042.356) (-1039.425) (-1056.054) [-1045.133] * [-1034.168] (-1041.014) (-1050.236) (-1039.659) -- 0:05:02
Average standard deviation of split frequencies: 0.021904
65500 -- (-1039.584) [-1050.061] (-1040.824) (-1045.041) * (-1040.720) (-1049.010) [-1043.330] (-1050.222) -- 0:04:59
66000 -- (-1045.244) [-1033.648] (-1050.593) (-1050.739) * (-1045.089) [-1048.040] (-1045.851) (-1044.812) -- 0:05:11
66500 -- [-1037.265] (-1041.211) (-1044.917) (-1036.587) * (-1048.885) (-1056.368) [-1044.825] (-1035.907) -- 0:05:08
67000 -- (-1036.280) (-1045.449) (-1039.293) [-1038.440] * (-1054.646) (-1050.735) (-1042.506) [-1044.920] -- 0:05:06
67500 -- (-1046.784) (-1045.380) (-1053.790) [-1034.927] * (-1041.836) (-1054.265) (-1046.368) [-1038.914] -- 0:05:03
68000 -- [-1036.707] (-1056.948) (-1042.509) (-1045.443) * [-1034.352] (-1037.782) (-1041.450) (-1047.072) -- 0:05:01
68500 -- [-1047.782] (-1048.252) (-1048.769) (-1049.421) * [-1045.513] (-1042.168) (-1041.821) (-1041.775) -- 0:04:59
69000 -- [-1038.896] (-1044.670) (-1045.204) (-1048.463) * (-1049.765) (-1038.859) (-1053.728) [-1040.985] -- 0:05:10
69500 -- (-1050.218) (-1049.749) (-1046.659) [-1041.664] * (-1047.412) (-1059.282) [-1038.879] (-1061.037) -- 0:05:07
70000 -- [-1039.279] (-1051.190) (-1050.201) (-1047.175) * (-1049.983) (-1054.442) [-1041.022] (-1050.826) -- 0:05:05
Average standard deviation of split frequencies: 0.018583
70500 -- [-1041.125] (-1048.438) (-1041.152) (-1033.705) * (-1063.739) [-1047.782] (-1036.132) (-1044.870) -- 0:05:03
71000 -- (-1046.778) (-1037.391) (-1049.147) [-1031.765] * (-1051.948) (-1039.122) (-1044.311) [-1039.456] -- 0:05:00
71500 -- (-1051.093) (-1041.575) (-1054.129) [-1036.879] * (-1054.895) (-1050.899) (-1045.624) [-1042.522] -- 0:04:58
72000 -- [-1036.528] (-1044.948) (-1053.983) (-1049.862) * (-1049.083) [-1036.254] (-1045.711) (-1043.090) -- 0:04:56
72500 -- [-1033.179] (-1061.447) (-1052.468) (-1041.706) * (-1045.895) (-1038.253) (-1052.430) [-1042.288] -- 0:05:07
73000 -- (-1041.135) (-1060.417) [-1048.709] (-1049.229) * (-1055.482) [-1036.257] (-1050.123) (-1055.946) -- 0:05:04
73500 -- [-1041.360] (-1059.563) (-1051.773) (-1045.175) * (-1048.043) [-1039.416] (-1053.038) (-1045.525) -- 0:05:02
74000 -- (-1035.555) (-1063.427) (-1047.023) [-1040.722] * (-1043.336) [-1036.988] (-1041.520) (-1046.235) -- 0:05:00
74500 -- (-1043.532) (-1055.039) (-1040.544) [-1038.027] * (-1053.303) [-1044.582] (-1038.553) (-1041.479) -- 0:04:58
75000 -- [-1038.933] (-1046.572) (-1051.300) (-1041.158) * (-1048.019) [-1046.286] (-1042.869) (-1042.457) -- 0:04:56
Average standard deviation of split frequencies: 0.018608
75500 -- [-1040.999] (-1058.488) (-1048.011) (-1045.587) * (-1043.098) (-1047.197) [-1043.495] (-1038.405) -- 0:05:06
76000 -- (-1040.876) (-1040.807) (-1056.126) [-1038.444] * [-1041.804] (-1043.397) (-1040.846) (-1069.645) -- 0:05:03
76500 -- [-1032.240] (-1044.870) (-1051.423) (-1042.992) * (-1053.898) (-1045.326) [-1035.665] (-1057.891) -- 0:05:01
77000 -- (-1039.134) [-1047.128] (-1040.946) (-1041.940) * (-1054.485) (-1041.071) [-1036.435] (-1040.471) -- 0:04:59
77500 -- (-1039.449) (-1051.844) (-1042.634) [-1042.444] * [-1043.997] (-1051.477) (-1040.531) (-1036.418) -- 0:04:57
78000 -- (-1030.880) (-1057.265) [-1051.658] (-1043.645) * [-1040.549] (-1048.083) (-1041.592) (-1040.626) -- 0:04:55
78500 -- (-1040.793) (-1048.982) (-1058.982) [-1036.371] * [-1034.201] (-1044.141) (-1042.585) (-1059.023) -- 0:05:05
79000 -- (-1048.724) (-1060.582) [-1037.558] (-1041.250) * (-1037.309) (-1040.301) [-1042.975] (-1046.952) -- 0:05:03
79500 -- (-1052.376) (-1062.497) [-1040.313] (-1046.565) * [-1038.485] (-1052.384) (-1052.676) (-1044.438) -- 0:05:01
80000 -- (-1053.564) (-1060.769) [-1042.598] (-1048.057) * [-1044.099] (-1048.667) (-1038.518) (-1046.848) -- 0:04:59
Average standard deviation of split frequencies: 0.017981
80500 -- (-1044.476) (-1064.042) (-1039.027) [-1041.020] * (-1040.922) (-1052.405) [-1037.243] (-1048.019) -- 0:04:56
81000 -- (-1043.075) (-1049.198) (-1044.392) [-1038.723] * (-1038.739) (-1040.236) [-1042.831] (-1057.283) -- 0:04:54
81500 -- [-1035.634] (-1044.145) (-1049.597) (-1038.069) * (-1043.111) [-1034.402] (-1045.081) (-1042.589) -- 0:05:04
82000 -- (-1041.733) (-1046.592) (-1040.778) [-1043.651] * [-1049.168] (-1041.730) (-1051.264) (-1041.789) -- 0:05:02
82500 -- (-1047.069) (-1045.636) (-1055.267) [-1047.182] * (-1044.671) (-1047.078) [-1033.083] (-1045.890) -- 0:05:00
83000 -- (-1052.066) (-1039.574) (-1060.075) [-1044.145] * [-1041.122] (-1044.829) (-1040.615) (-1050.445) -- 0:04:58
83500 -- (-1051.413) (-1049.631) (-1036.599) [-1039.959] * (-1036.344) (-1052.170) (-1054.004) [-1040.317] -- 0:04:56
84000 -- (-1039.450) (-1050.370) (-1040.343) [-1040.414] * [-1047.293] (-1040.944) (-1038.203) (-1043.991) -- 0:04:54
84500 -- [-1042.522] (-1053.617) (-1042.425) (-1056.433) * [-1043.250] (-1044.630) (-1042.030) (-1050.064) -- 0:05:03
85000 -- (-1054.011) [-1050.755] (-1043.586) (-1046.206) * [-1038.465] (-1053.180) (-1034.673) (-1043.379) -- 0:05:01
Average standard deviation of split frequencies: 0.019968
85500 -- (-1042.270) (-1058.020) [-1046.115] (-1033.552) * (-1052.102) (-1060.872) (-1037.680) [-1042.768] -- 0:04:59
86000 -- [-1038.342] (-1059.717) (-1044.372) (-1030.565) * [-1043.820] (-1055.490) (-1048.165) (-1050.552) -- 0:04:57
86500 -- [-1036.549] (-1042.690) (-1046.734) (-1050.752) * (-1047.347) (-1047.438) (-1040.256) [-1043.027] -- 0:04:55
87000 -- (-1047.289) [-1038.100] (-1042.179) (-1048.056) * [-1045.682] (-1048.956) (-1053.649) (-1036.313) -- 0:04:53
87500 -- (-1047.186) [-1036.159] (-1046.913) (-1046.835) * (-1042.150) (-1060.619) [-1046.438] (-1044.270) -- 0:04:52
88000 -- (-1061.121) [-1037.871] (-1046.895) (-1040.693) * (-1051.703) [-1044.029] (-1042.713) (-1051.708) -- 0:05:00
88500 -- (-1065.377) [-1036.970] (-1057.026) (-1038.056) * (-1040.425) [-1039.045] (-1039.334) (-1054.119) -- 0:04:58
89000 -- (-1040.193) (-1048.744) [-1035.252] (-1040.241) * (-1047.518) [-1041.427] (-1047.030) (-1047.876) -- 0:04:56
89500 -- (-1047.455) [-1042.488] (-1044.368) (-1042.888) * (-1049.808) (-1037.744) (-1039.216) [-1036.499] -- 0:04:55
90000 -- (-1050.185) [-1042.777] (-1035.156) (-1055.306) * (-1061.527) [-1035.958] (-1050.256) (-1047.481) -- 0:04:53
Average standard deviation of split frequencies: 0.021169
90500 -- (-1056.370) (-1052.486) [-1040.227] (-1051.559) * (-1056.291) [-1042.013] (-1047.071) (-1039.477) -- 0:04:51
91000 -- (-1044.623) (-1046.984) [-1046.024] (-1054.447) * (-1047.350) (-1050.147) (-1053.479) [-1035.786] -- 0:04:59
91500 -- [-1048.111] (-1046.940) (-1059.642) (-1057.198) * (-1052.477) (-1046.022) (-1052.171) [-1039.132] -- 0:04:57
92000 -- (-1051.361) (-1051.205) (-1041.609) [-1042.215] * (-1042.108) [-1041.392] (-1049.859) (-1049.674) -- 0:04:56
92500 -- [-1046.109] (-1045.060) (-1048.703) (-1046.209) * (-1057.266) [-1034.556] (-1049.875) (-1039.948) -- 0:04:54
93000 -- (-1041.599) (-1046.268) [-1039.325] (-1036.613) * (-1049.659) (-1035.795) (-1046.767) [-1047.945] -- 0:04:52
93500 -- [-1046.402] (-1042.932) (-1058.565) (-1053.218) * (-1049.901) (-1039.859) [-1048.804] (-1047.709) -- 0:04:50
94000 -- [-1043.701] (-1053.595) (-1057.504) (-1047.358) * [-1053.867] (-1042.791) (-1048.219) (-1073.779) -- 0:04:58
94500 -- (-1049.053) (-1045.033) [-1047.945] (-1047.827) * (-1048.391) [-1038.813] (-1042.227) (-1053.919) -- 0:04:57
95000 -- (-1044.264) (-1050.205) (-1037.333) [-1037.582] * [-1041.629] (-1042.312) (-1048.510) (-1037.351) -- 0:04:55
Average standard deviation of split frequencies: 0.023041
95500 -- (-1053.711) (-1040.996) (-1058.911) [-1040.632] * (-1041.665) (-1051.895) (-1045.724) [-1034.851] -- 0:04:53
96000 -- (-1043.821) (-1038.822) [-1045.678] (-1045.891) * (-1043.827) [-1043.232] (-1044.717) (-1059.138) -- 0:04:51
96500 -- (-1048.712) (-1040.947) [-1043.017] (-1043.766) * (-1053.051) (-1043.227) [-1034.094] (-1044.008) -- 0:04:50
97000 -- (-1045.273) [-1038.043] (-1046.038) (-1046.660) * (-1056.400) (-1044.522) [-1045.151] (-1061.253) -- 0:04:57
97500 -- (-1044.489) [-1037.763] (-1053.637) (-1052.256) * (-1051.907) [-1044.578] (-1045.780) (-1039.563) -- 0:04:56
98000 -- (-1042.573) [-1031.878] (-1046.946) (-1035.214) * (-1041.120) (-1043.154) (-1050.008) [-1037.909] -- 0:04:54
98500 -- (-1043.687) [-1039.677] (-1048.126) (-1043.480) * [-1037.870] (-1047.336) (-1051.637) (-1045.421) -- 0:04:52
99000 -- [-1041.000] (-1040.763) (-1056.300) (-1052.901) * (-1035.645) (-1061.052) [-1042.961] (-1050.382) -- 0:04:51
99500 -- (-1041.969) (-1040.543) (-1041.813) [-1040.263] * (-1044.757) (-1051.174) [-1047.684] (-1042.112) -- 0:04:49
100000 -- (-1046.112) (-1042.028) [-1042.074] (-1044.718) * [-1033.854] (-1044.898) (-1048.015) (-1061.665) -- 0:04:57
Average standard deviation of split frequencies: 0.021973
100500 -- (-1038.022) [-1043.667] (-1055.623) (-1048.113) * (-1044.084) (-1043.962) [-1045.140] (-1049.187) -- 0:04:55
101000 -- (-1049.204) (-1048.963) (-1053.382) [-1044.441] * (-1043.927) [-1043.544] (-1042.162) (-1042.233) -- 0:04:53
101500 -- [-1044.193] (-1038.740) (-1054.221) (-1041.381) * [-1041.356] (-1044.639) (-1042.130) (-1047.608) -- 0:04:52
102000 -- (-1043.259) (-1045.887) (-1052.617) [-1043.575] * [-1034.832] (-1046.276) (-1038.636) (-1045.950) -- 0:04:50
102500 -- [-1046.148] (-1048.233) (-1047.611) (-1053.121) * (-1046.479) (-1044.688) (-1039.013) [-1047.442] -- 0:04:48
103000 -- (-1053.906) (-1048.019) (-1046.362) [-1036.669] * (-1042.872) (-1049.920) (-1049.580) [-1041.899] -- 0:04:56
103500 -- (-1062.713) [-1044.828] (-1049.781) (-1041.044) * (-1052.228) (-1048.822) [-1037.829] (-1052.559) -- 0:04:54
104000 -- (-1048.990) [-1036.622] (-1057.362) (-1038.455) * (-1055.111) [-1042.309] (-1048.155) (-1052.866) -- 0:04:52
104500 -- (-1047.574) (-1041.731) (-1051.767) [-1036.216] * (-1051.101) [-1037.858] (-1038.074) (-1042.181) -- 0:04:51
105000 -- (-1050.203) [-1035.347] (-1048.755) (-1047.074) * [-1035.366] (-1046.181) (-1043.580) (-1038.381) -- 0:04:49
Average standard deviation of split frequencies: 0.022236
105500 -- (-1059.367) (-1050.206) [-1039.504] (-1053.277) * (-1046.919) (-1040.164) [-1038.245] (-1050.850) -- 0:04:48
106000 -- (-1049.552) [-1046.172] (-1039.778) (-1056.646) * (-1046.048) (-1039.107) (-1044.356) [-1038.573] -- 0:04:55
106500 -- (-1059.396) (-1064.763) [-1043.979] (-1049.301) * (-1055.765) [-1045.928] (-1039.403) (-1058.744) -- 0:04:53
107000 -- (-1053.765) [-1043.983] (-1040.795) (-1044.002) * [-1038.925] (-1034.033) (-1055.666) (-1040.594) -- 0:04:52
107500 -- (-1042.647) (-1053.176) [-1041.267] (-1038.719) * (-1062.384) (-1047.059) [-1041.746] (-1051.826) -- 0:04:50
108000 -- (-1053.045) [-1043.083] (-1050.154) (-1047.623) * (-1045.528) [-1039.120] (-1045.777) (-1062.402) -- 0:04:49
108500 -- (-1042.705) (-1052.474) [-1044.894] (-1041.176) * (-1040.492) [-1043.078] (-1048.375) (-1054.681) -- 0:04:47
109000 -- [-1042.443] (-1053.325) (-1043.549) (-1053.785) * (-1042.183) [-1039.224] (-1047.230) (-1056.361) -- 0:04:54
109500 -- (-1055.861) [-1048.707] (-1044.104) (-1053.230) * (-1054.018) [-1036.489] (-1037.515) (-1053.550) -- 0:04:52
110000 -- (-1037.102) (-1047.164) [-1044.000] (-1037.541) * (-1035.799) (-1048.483) (-1048.953) [-1038.374] -- 0:04:51
Average standard deviation of split frequencies: 0.019660
110500 -- (-1049.959) (-1047.658) [-1032.800] (-1047.523) * (-1042.142) (-1043.196) [-1037.897] (-1041.024) -- 0:04:49
111000 -- (-1043.607) (-1049.762) [-1037.748] (-1053.246) * (-1036.790) (-1047.948) [-1035.270] (-1039.828) -- 0:04:48
111500 -- (-1042.272) (-1052.949) [-1035.482] (-1044.701) * (-1038.214) (-1040.208) [-1039.377] (-1044.680) -- 0:04:46
112000 -- (-1040.693) (-1046.501) (-1042.438) [-1040.847] * (-1046.780) [-1037.167] (-1054.138) (-1043.150) -- 0:04:45
112500 -- (-1041.293) (-1051.450) (-1039.129) [-1039.759] * (-1061.126) (-1050.462) (-1040.947) [-1040.537] -- 0:04:51
113000 -- [-1040.514] (-1048.387) (-1049.190) (-1045.643) * (-1068.868) [-1049.629] (-1039.675) (-1041.890) -- 0:04:50
113500 -- [-1035.841] (-1051.242) (-1038.963) (-1044.797) * [-1035.744] (-1043.930) (-1036.379) (-1055.779) -- 0:04:48
114000 -- [-1039.287] (-1042.807) (-1049.481) (-1045.307) * [-1038.493] (-1043.684) (-1038.712) (-1054.890) -- 0:04:47
114500 -- [-1035.979] (-1045.095) (-1047.945) (-1040.558) * (-1059.420) (-1048.298) [-1035.016] (-1059.777) -- 0:04:46
115000 -- (-1046.542) [-1039.092] (-1041.655) (-1043.201) * [-1049.436] (-1039.882) (-1035.902) (-1058.630) -- 0:04:44
Average standard deviation of split frequencies: 0.021570
115500 -- (-1069.770) (-1049.369) (-1048.996) [-1041.767] * (-1043.525) (-1042.221) (-1046.599) [-1038.288] -- 0:04:51
116000 -- (-1046.053) (-1061.822) [-1039.191] (-1043.845) * (-1067.840) [-1044.508] (-1037.182) (-1039.489) -- 0:04:49
116500 -- [-1040.454] (-1054.295) (-1047.638) (-1038.757) * (-1046.228) (-1043.704) [-1040.572] (-1042.370) -- 0:04:48
117000 -- (-1051.727) [-1046.600] (-1042.878) (-1043.927) * (-1050.340) [-1042.136] (-1043.162) (-1051.027) -- 0:04:46
117500 -- (-1055.161) [-1048.853] (-1053.484) (-1041.068) * [-1043.884] (-1044.192) (-1038.490) (-1045.042) -- 0:04:45
118000 -- (-1050.155) (-1043.410) (-1036.943) [-1049.314] * (-1050.535) [-1044.627] (-1032.812) (-1049.568) -- 0:04:44
118500 -- (-1051.752) (-1043.859) (-1045.568) [-1041.411] * (-1045.530) (-1045.402) [-1037.837] (-1046.610) -- 0:04:50
119000 -- (-1047.827) (-1044.023) [-1051.070] (-1037.570) * (-1048.546) (-1052.019) [-1044.888] (-1049.267) -- 0:04:48
119500 -- (-1039.591) [-1042.861] (-1048.948) (-1049.942) * (-1051.441) [-1048.108] (-1047.944) (-1040.657) -- 0:04:47
120000 -- (-1049.951) (-1046.654) (-1046.999) [-1041.377] * [-1046.799] (-1043.922) (-1052.074) (-1049.434) -- 0:04:46
Average standard deviation of split frequencies: 0.019233
120500 -- [-1037.326] (-1048.601) (-1062.138) (-1044.637) * (-1047.199) (-1048.607) (-1044.375) [-1047.785] -- 0:04:44
121000 -- [-1039.344] (-1065.564) (-1044.426) (-1057.655) * [-1039.252] (-1052.861) (-1041.279) (-1040.809) -- 0:04:43
121500 -- (-1053.741) (-1053.505) [-1038.096] (-1039.960) * (-1050.054) (-1055.151) (-1048.869) [-1034.884] -- 0:04:49
122000 -- (-1052.608) (-1045.869) (-1043.679) [-1041.234] * (-1050.931) (-1051.269) [-1037.745] (-1045.019) -- 0:04:47
122500 -- (-1048.427) (-1052.292) [-1036.844] (-1062.266) * (-1039.411) (-1058.424) [-1038.593] (-1045.781) -- 0:04:46
123000 -- (-1059.666) [-1047.236] (-1054.744) (-1053.235) * (-1045.814) (-1040.667) [-1045.600] (-1048.467) -- 0:04:45
123500 -- (-1046.903) (-1041.038) [-1041.952] (-1049.989) * [-1040.753] (-1054.836) (-1038.281) (-1037.673) -- 0:04:43
124000 -- (-1045.850) [-1039.762] (-1049.416) (-1054.827) * (-1051.435) (-1040.567) [-1046.191] (-1041.193) -- 0:04:42
124500 -- (-1043.619) (-1043.708) (-1046.607) [-1045.450] * (-1052.469) [-1042.506] (-1049.446) (-1043.467) -- 0:04:41
125000 -- [-1043.823] (-1047.407) (-1052.081) (-1046.274) * (-1056.631) (-1046.055) (-1049.247) [-1042.845] -- 0:04:47
Average standard deviation of split frequencies: 0.018419
125500 -- (-1041.481) (-1041.154) [-1044.268] (-1040.073) * (-1055.887) (-1039.749) (-1034.527) [-1045.940] -- 0:04:45
126000 -- (-1032.906) (-1052.884) [-1045.673] (-1052.105) * (-1050.588) [-1038.981] (-1055.001) (-1039.763) -- 0:04:44
126500 -- [-1034.206] (-1061.279) (-1050.903) (-1053.268) * (-1047.051) (-1040.363) (-1037.797) [-1039.006] -- 0:04:43
127000 -- (-1046.714) (-1048.083) [-1036.200] (-1047.150) * (-1049.724) [-1043.400] (-1053.154) (-1051.239) -- 0:04:41
127500 -- [-1045.410] (-1062.554) (-1045.859) (-1051.112) * (-1042.851) [-1036.922] (-1044.828) (-1051.849) -- 0:04:40
128000 -- (-1044.371) (-1050.903) [-1036.574] (-1050.473) * (-1052.674) [-1041.759] (-1061.110) (-1043.952) -- 0:04:46
128500 -- (-1050.785) (-1041.870) [-1036.629] (-1062.131) * (-1042.627) [-1050.323] (-1056.287) (-1050.907) -- 0:04:44
129000 -- (-1047.681) (-1043.153) [-1031.670] (-1040.105) * (-1035.165) [-1049.425] (-1055.446) (-1052.239) -- 0:04:43
129500 -- (-1050.633) [-1033.482] (-1040.563) (-1034.075) * [-1035.728] (-1037.308) (-1054.483) (-1038.520) -- 0:04:42
130000 -- (-1051.514) (-1037.160) (-1041.287) [-1040.718] * [-1036.301] (-1048.117) (-1057.429) (-1050.304) -- 0:04:41
Average standard deviation of split frequencies: 0.019426
130500 -- (-1042.187) [-1042.151] (-1035.720) (-1037.731) * (-1047.553) (-1041.594) [-1041.291] (-1062.246) -- 0:04:39
131000 -- (-1039.211) [-1036.058] (-1046.789) (-1043.999) * [-1046.998] (-1052.802) (-1059.850) (-1053.455) -- 0:04:45
131500 -- [-1038.417] (-1038.886) (-1050.454) (-1039.551) * (-1043.525) (-1042.760) (-1046.018) [-1044.186] -- 0:04:43
132000 -- (-1044.696) (-1042.719) [-1041.507] (-1051.433) * (-1044.246) [-1044.888] (-1041.950) (-1049.061) -- 0:04:42
132500 -- [-1036.687] (-1045.042) (-1047.042) (-1051.268) * (-1037.539) [-1038.973] (-1045.215) (-1050.143) -- 0:04:41
133000 -- [-1045.600] (-1043.905) (-1039.866) (-1052.468) * [-1031.373] (-1050.069) (-1040.818) (-1053.099) -- 0:04:40
133500 -- (-1039.705) (-1045.394) [-1039.963] (-1048.548) * [-1039.209] (-1043.303) (-1053.301) (-1053.590) -- 0:04:39
134000 -- (-1050.001) (-1052.790) [-1037.479] (-1046.794) * (-1042.185) [-1032.849] (-1044.678) (-1038.872) -- 0:04:44
134500 -- (-1049.019) (-1046.755) (-1043.432) [-1043.196] * (-1044.497) (-1047.890) (-1036.635) [-1047.582] -- 0:04:43
135000 -- (-1049.687) (-1043.298) (-1043.255) [-1043.204] * (-1045.617) (-1050.532) [-1048.418] (-1037.336) -- 0:04:41
Average standard deviation of split frequencies: 0.017064
135500 -- [-1040.269] (-1035.728) (-1044.844) (-1054.452) * (-1047.790) (-1038.356) (-1043.575) [-1042.281] -- 0:04:40
136000 -- (-1058.117) (-1051.080) [-1038.665] (-1054.447) * [-1034.540] (-1044.226) (-1048.681) (-1053.792) -- 0:04:39
136500 -- (-1054.842) (-1037.231) (-1046.686) [-1033.425] * (-1052.923) [-1038.356] (-1044.859) (-1044.201) -- 0:04:38
137000 -- (-1042.292) (-1051.829) (-1046.714) [-1040.331] * (-1035.184) [-1039.285] (-1041.949) (-1041.624) -- 0:04:43
137500 -- [-1034.389] (-1032.629) (-1048.661) (-1047.249) * [-1039.448] (-1042.322) (-1054.192) (-1052.693) -- 0:04:42
138000 -- (-1048.112) (-1035.655) (-1044.801) [-1041.303] * [-1038.136] (-1051.192) (-1045.824) (-1044.140) -- 0:04:41
138500 -- (-1049.711) (-1048.729) (-1041.575) [-1030.003] * (-1043.603) [-1040.829] (-1056.377) (-1036.502) -- 0:04:39
139000 -- (-1047.106) (-1044.921) [-1036.163] (-1050.413) * [-1041.922] (-1044.419) (-1049.179) (-1050.718) -- 0:04:38
139500 -- (-1054.097) (-1056.576) [-1042.249] (-1046.282) * [-1043.395] (-1058.055) (-1043.987) (-1039.317) -- 0:04:37
140000 -- (-1046.827) (-1048.816) (-1032.558) [-1043.151] * (-1047.600) [-1052.832] (-1037.079) (-1054.652) -- 0:04:36
Average standard deviation of split frequencies: 0.016756
140500 -- (-1041.465) (-1050.619) [-1037.443] (-1040.169) * (-1046.695) (-1044.166) [-1036.579] (-1054.126) -- 0:04:41
141000 -- [-1037.373] (-1060.546) (-1036.760) (-1047.100) * (-1037.711) (-1054.748) [-1055.908] (-1044.714) -- 0:04:40
141500 -- (-1044.269) (-1056.287) (-1046.619) [-1046.097] * (-1048.443) (-1053.229) (-1043.292) [-1043.651] -- 0:04:39
142000 -- (-1043.989) (-1051.041) [-1047.817] (-1042.283) * [-1041.784] (-1049.805) (-1040.773) (-1035.155) -- 0:04:37
142500 -- [-1038.716] (-1037.681) (-1040.439) (-1043.882) * [-1052.790] (-1059.152) (-1035.439) (-1048.363) -- 0:04:36
143000 -- (-1034.365) (-1049.104) (-1042.993) [-1042.207] * (-1063.159) (-1051.690) (-1052.884) [-1063.099] -- 0:04:35
143500 -- (-1043.272) (-1048.385) [-1044.286] (-1041.520) * (-1058.972) (-1051.464) (-1038.370) [-1041.657] -- 0:04:40
144000 -- [-1034.841] (-1047.880) (-1047.804) (-1066.874) * (-1064.598) (-1057.740) [-1042.248] (-1056.370) -- 0:04:39
144500 -- [-1044.054] (-1044.010) (-1042.843) (-1049.796) * (-1052.378) (-1040.382) [-1036.821] (-1040.535) -- 0:04:38
145000 -- (-1050.147) (-1045.057) (-1048.592) [-1046.364] * (-1046.642) (-1056.683) [-1038.063] (-1045.447) -- 0:04:37
Average standard deviation of split frequencies: 0.018628
145500 -- [-1035.651] (-1055.159) (-1033.543) (-1053.612) * (-1041.556) (-1041.182) (-1042.213) [-1063.712] -- 0:04:36
146000 -- (-1047.165) (-1052.752) (-1053.424) [-1039.004] * (-1040.439) (-1040.184) (-1041.898) [-1039.397] -- 0:04:34
146500 -- (-1040.593) (-1046.831) (-1051.042) [-1038.853] * [-1035.645] (-1046.676) (-1040.114) (-1047.060) -- 0:04:39
147000 -- (-1043.297) (-1048.797) [-1039.918] (-1044.291) * (-1036.209) (-1039.902) [-1044.584] (-1046.953) -- 0:04:38
147500 -- (-1047.352) (-1057.208) [-1045.368] (-1040.818) * (-1044.680) (-1046.916) [-1049.016] (-1046.024) -- 0:04:37
148000 -- (-1036.670) (-1060.844) [-1048.809] (-1035.434) * (-1045.389) (-1055.080) (-1050.436) [-1038.899] -- 0:04:36
148500 -- (-1045.758) (-1048.833) [-1037.957] (-1044.709) * (-1041.625) (-1050.184) [-1041.931] (-1045.867) -- 0:04:35
149000 -- (-1041.355) (-1055.166) [-1032.421] (-1046.645) * (-1053.355) (-1041.859) [-1032.862] (-1043.548) -- 0:04:34
149500 -- (-1038.257) (-1055.714) (-1049.018) [-1048.882] * (-1051.540) (-1054.465) [-1051.579] (-1050.619) -- 0:04:38
150000 -- (-1050.991) (-1052.108) [-1038.815] (-1041.076) * (-1044.154) (-1043.568) (-1042.046) [-1038.402] -- 0:04:37
Average standard deviation of split frequencies: 0.016847
150500 -- [-1048.342] (-1064.888) (-1049.747) (-1042.853) * [-1035.448] (-1049.122) (-1047.577) (-1042.506) -- 0:04:36
151000 -- [-1035.476] (-1053.148) (-1040.171) (-1050.341) * (-1038.733) (-1044.309) [-1044.759] (-1044.213) -- 0:04:35
151500 -- (-1052.989) (-1047.100) [-1043.609] (-1052.335) * (-1051.044) (-1050.500) (-1048.689) [-1044.539] -- 0:04:34
152000 -- [-1043.299] (-1044.147) (-1040.757) (-1067.545) * (-1041.361) (-1077.434) (-1052.994) [-1047.340] -- 0:04:33
152500 -- (-1066.629) (-1049.049) [-1038.610] (-1064.155) * (-1037.039) (-1046.324) [-1043.031] (-1049.454) -- 0:04:37
153000 -- (-1047.566) (-1046.241) [-1040.899] (-1063.819) * (-1054.818) (-1050.240) (-1042.748) [-1036.903] -- 0:04:36
153500 -- (-1043.757) (-1048.815) [-1041.175] (-1050.160) * (-1040.464) (-1056.841) [-1044.640] (-1052.609) -- 0:04:35
154000 -- [-1042.493] (-1056.335) (-1043.808) (-1053.111) * [-1036.254] (-1048.924) (-1048.628) (-1054.437) -- 0:04:34
154500 -- (-1041.648) (-1044.065) [-1037.634] (-1055.766) * (-1031.737) [-1036.673] (-1059.745) (-1054.356) -- 0:04:33
155000 -- [-1033.829] (-1055.937) (-1038.249) (-1044.596) * (-1039.530) (-1044.874) (-1047.694) [-1036.354] -- 0:04:32
Average standard deviation of split frequencies: 0.019293
155500 -- (-1046.500) (-1053.830) [-1041.080] (-1050.681) * [-1041.367] (-1054.555) (-1048.100) (-1033.602) -- 0:04:36
156000 -- [-1040.569] (-1060.139) (-1049.814) (-1054.903) * (-1047.168) (-1050.131) (-1049.695) [-1038.221] -- 0:04:35
156500 -- [-1042.670] (-1047.534) (-1052.076) (-1047.967) * [-1045.703] (-1046.707) (-1058.049) (-1043.370) -- 0:04:34
157000 -- (-1044.129) (-1042.746) (-1052.840) [-1039.271] * (-1055.285) (-1046.152) (-1053.490) [-1037.313] -- 0:04:33
157500 -- (-1045.394) [-1039.540] (-1052.802) (-1038.207) * (-1040.684) (-1042.459) (-1052.521) [-1033.782] -- 0:04:32
158000 -- [-1041.503] (-1052.662) (-1049.266) (-1047.794) * (-1047.717) (-1042.336) (-1042.230) [-1043.558] -- 0:04:31
158500 -- (-1037.013) (-1049.946) (-1050.967) [-1046.728] * (-1048.467) (-1046.565) (-1045.436) [-1034.189] -- 0:04:30
159000 -- (-1045.866) [-1047.400] (-1047.257) (-1048.764) * (-1039.970) (-1053.930) [-1041.653] (-1052.433) -- 0:04:35
159500 -- (-1050.010) (-1041.734) [-1035.842] (-1037.874) * (-1048.722) (-1041.377) [-1044.855] (-1041.489) -- 0:04:34
160000 -- (-1053.975) [-1045.961] (-1040.461) (-1039.532) * (-1039.581) (-1043.994) [-1038.164] (-1038.460) -- 0:04:33
Average standard deviation of split frequencies: 0.020990
160500 -- (-1045.596) (-1056.069) [-1042.119] (-1047.231) * (-1061.696) (-1051.414) [-1046.775] (-1040.744) -- 0:04:31
161000 -- (-1049.442) (-1044.760) [-1036.441] (-1058.420) * (-1045.243) (-1044.626) [-1048.236] (-1038.974) -- 0:04:30
161500 -- [-1043.069] (-1041.970) (-1049.262) (-1049.030) * [-1040.445] (-1049.301) (-1050.026) (-1053.096) -- 0:04:29
162000 -- (-1046.579) (-1042.311) [-1044.253] (-1051.991) * [-1039.593] (-1047.011) (-1044.034) (-1067.370) -- 0:04:34
162500 -- (-1040.235) (-1044.191) (-1047.701) [-1039.141] * (-1040.469) (-1044.935) (-1055.718) [-1039.361] -- 0:04:33
163000 -- [-1046.851] (-1049.544) (-1044.769) (-1050.727) * (-1037.354) (-1044.826) [-1047.037] (-1051.374) -- 0:04:32
163500 -- (-1035.789) (-1068.206) (-1053.391) [-1038.725] * [-1035.239] (-1039.726) (-1037.327) (-1038.952) -- 0:04:31
164000 -- (-1047.859) (-1050.778) (-1039.145) [-1044.403] * [-1035.512] (-1047.921) (-1041.761) (-1049.435) -- 0:04:30
164500 -- [-1040.975] (-1052.965) (-1047.900) (-1043.329) * (-1037.371) (-1042.420) [-1060.051] (-1052.652) -- 0:04:29
165000 -- (-1041.270) (-1045.874) [-1041.674] (-1047.642) * [-1036.345] (-1038.913) (-1043.605) (-1057.773) -- 0:04:33
Average standard deviation of split frequencies: 0.023155
165500 -- (-1038.858) (-1049.119) (-1058.204) [-1048.326] * [-1042.479] (-1043.386) (-1047.058) (-1046.811) -- 0:04:32
166000 -- (-1041.911) [-1039.976] (-1053.219) (-1038.204) * (-1041.857) [-1040.788] (-1055.074) (-1040.453) -- 0:04:31
166500 -- (-1045.808) (-1057.898) (-1046.355) [-1042.755] * [-1037.702] (-1035.418) (-1053.372) (-1044.081) -- 0:04:30
167000 -- (-1049.271) [-1033.236] (-1048.106) (-1041.764) * (-1036.197) [-1037.160] (-1052.536) (-1045.747) -- 0:04:29
167500 -- (-1051.233) [-1042.632] (-1053.008) (-1055.878) * (-1050.963) [-1039.210] (-1045.248) (-1037.167) -- 0:04:28
168000 -- [-1037.395] (-1037.474) (-1046.298) (-1048.245) * [-1047.488] (-1036.750) (-1039.815) (-1043.239) -- 0:04:32
168500 -- (-1051.632) (-1039.489) (-1057.570) [-1047.947] * [-1048.214] (-1037.613) (-1051.903) (-1038.557) -- 0:04:31
169000 -- (-1043.651) (-1045.964) (-1052.951) [-1042.771] * (-1039.910) (-1042.485) (-1051.167) [-1053.272] -- 0:04:30
169500 -- (-1044.753) (-1041.202) [-1054.336] (-1050.776) * (-1042.694) (-1041.573) [-1045.125] (-1034.311) -- 0:04:29
170000 -- [-1044.001] (-1039.008) (-1062.866) (-1042.144) * (-1058.321) [-1035.489] (-1046.728) (-1039.883) -- 0:04:28
Average standard deviation of split frequencies: 0.020185
170500 -- [-1039.508] (-1036.041) (-1049.350) (-1052.153) * (-1042.868) (-1044.884) [-1049.001] (-1043.108) -- 0:04:27
171000 -- [-1052.346] (-1059.223) (-1053.003) (-1046.887) * (-1051.147) (-1062.765) [-1041.486] (-1048.434) -- 0:04:31
171500 -- (-1043.963) (-1050.000) (-1062.179) [-1043.354] * (-1049.030) (-1036.916) [-1043.380] (-1039.277) -- 0:04:30
172000 -- (-1048.511) [-1041.139] (-1049.726) (-1048.910) * (-1044.339) [-1033.410] (-1038.147) (-1036.509) -- 0:04:29
172500 -- (-1038.610) (-1041.090) [-1049.650] (-1048.568) * (-1047.187) (-1041.213) [-1039.791] (-1054.077) -- 0:04:28
173000 -- (-1046.984) (-1043.257) [-1038.190] (-1041.919) * [-1041.754] (-1038.007) (-1034.032) (-1044.420) -- 0:04:27
173500 -- (-1048.909) (-1049.436) (-1048.079) [-1040.926] * (-1041.384) (-1045.228) (-1035.050) [-1044.044] -- 0:04:26
174000 -- (-1045.971) (-1058.313) [-1044.293] (-1038.223) * (-1043.940) (-1035.878) (-1049.176) [-1051.161] -- 0:04:25
174500 -- [-1039.467] (-1048.247) (-1051.545) (-1037.028) * [-1033.628] (-1041.256) (-1048.775) (-1056.260) -- 0:04:29
175000 -- (-1041.348) (-1046.129) [-1046.421] (-1043.058) * (-1048.663) [-1046.854] (-1041.756) (-1049.980) -- 0:04:28
Average standard deviation of split frequencies: 0.019779
175500 -- (-1040.240) [-1043.344] (-1040.886) (-1050.823) * (-1060.267) (-1056.887) (-1039.075) [-1041.586] -- 0:04:27
176000 -- [-1050.151] (-1043.133) (-1055.546) (-1044.961) * (-1040.563) [-1038.764] (-1045.606) (-1046.105) -- 0:04:26
176500 -- (-1040.126) (-1047.480) (-1045.046) [-1038.883] * (-1050.113) (-1048.656) (-1048.379) [-1034.796] -- 0:04:25
177000 -- (-1054.620) [-1037.276] (-1046.193) (-1049.511) * (-1039.917) [-1047.713] (-1040.270) (-1042.478) -- 0:04:25
177500 -- (-1042.289) [-1041.735] (-1047.259) (-1037.921) * (-1043.672) [-1033.704] (-1038.462) (-1045.335) -- 0:04:28
178000 -- (-1052.777) [-1036.026] (-1039.372) (-1031.574) * (-1060.592) [-1034.587] (-1031.456) (-1039.384) -- 0:04:27
178500 -- (-1043.108) (-1037.347) (-1050.675) [-1037.775] * (-1049.304) (-1046.480) (-1041.995) [-1044.629] -- 0:04:26
179000 -- [-1043.353] (-1044.192) (-1041.772) (-1042.320) * [-1045.889] (-1049.773) (-1047.419) (-1043.556) -- 0:04:26
179500 -- (-1047.033) [-1048.686] (-1042.377) (-1054.967) * (-1034.555) [-1038.078] (-1050.353) (-1056.797) -- 0:04:25
180000 -- (-1060.350) (-1039.159) (-1046.881) [-1045.236] * (-1034.702) [-1041.491] (-1045.111) (-1048.203) -- 0:04:24
Average standard deviation of split frequencies: 0.020473
180500 -- (-1056.819) [-1039.392] (-1047.825) (-1048.473) * (-1052.496) (-1041.566) [-1043.161] (-1047.457) -- 0:04:27
181000 -- (-1047.221) [-1038.184] (-1058.171) (-1043.374) * (-1040.365) (-1047.470) [-1042.816] (-1061.156) -- 0:04:26
181500 -- [-1051.982] (-1043.754) (-1044.099) (-1055.410) * [-1036.830] (-1050.040) (-1041.346) (-1043.310) -- 0:04:26
182000 -- (-1052.031) [-1036.772] (-1038.329) (-1041.385) * (-1046.800) (-1057.727) [-1039.792] (-1047.420) -- 0:04:25
182500 -- (-1055.037) [-1056.995] (-1039.953) (-1045.352) * (-1041.814) (-1050.068) [-1045.902] (-1048.976) -- 0:04:24
183000 -- (-1053.114) (-1055.212) [-1040.400] (-1037.514) * (-1045.301) (-1039.663) [-1052.436] (-1064.449) -- 0:04:23
183500 -- (-1056.286) (-1049.201) (-1047.173) [-1044.019] * (-1054.215) (-1046.154) (-1042.627) [-1038.088] -- 0:04:26
184000 -- [-1046.558] (-1043.337) (-1045.711) (-1062.884) * (-1052.648) (-1047.885) [-1046.821] (-1050.973) -- 0:04:26
184500 -- (-1040.234) (-1056.642) [-1042.460] (-1043.808) * [-1039.184] (-1050.679) (-1044.348) (-1049.397) -- 0:04:25
185000 -- (-1052.624) [-1050.966] (-1046.345) (-1049.466) * (-1042.543) (-1037.749) (-1064.221) [-1039.159] -- 0:04:24
Average standard deviation of split frequencies: 0.018716
185500 -- (-1050.490) (-1043.189) (-1048.507) [-1030.925] * (-1047.049) (-1044.667) (-1052.993) [-1039.580] -- 0:04:23
186000 -- [-1046.678] (-1056.642) (-1043.912) (-1038.546) * (-1043.347) [-1048.038] (-1043.021) (-1053.832) -- 0:04:22
186500 -- [-1040.420] (-1054.325) (-1060.155) (-1037.500) * [-1039.253] (-1044.438) (-1049.000) (-1045.626) -- 0:04:26
187000 -- (-1048.340) (-1047.365) (-1045.764) [-1046.385] * (-1040.217) (-1047.024) [-1040.963] (-1048.228) -- 0:04:25
187500 -- [-1044.459] (-1044.806) (-1034.959) (-1047.149) * (-1049.908) (-1045.720) [-1040.054] (-1044.450) -- 0:04:24
188000 -- (-1040.507) (-1040.373) [-1041.391] (-1048.466) * (-1058.546) (-1053.001) (-1043.036) [-1037.221] -- 0:04:23
188500 -- (-1035.828) [-1035.718] (-1042.892) (-1039.818) * (-1044.587) (-1035.278) [-1041.852] (-1050.571) -- 0:04:22
189000 -- (-1040.698) (-1050.809) (-1053.889) [-1037.898] * [-1041.294] (-1042.178) (-1052.869) (-1042.962) -- 0:04:21
189500 -- (-1050.734) (-1044.736) [-1041.766] (-1045.580) * [-1043.939] (-1053.625) (-1054.017) (-1056.272) -- 0:04:20
190000 -- (-1052.800) [-1041.481] (-1055.065) (-1052.674) * [-1042.632] (-1051.356) (-1061.104) (-1044.390) -- 0:04:24
Average standard deviation of split frequencies: 0.018448
190500 -- (-1040.624) [-1044.868] (-1063.545) (-1056.015) * (-1047.047) [-1034.227] (-1041.581) (-1050.634) -- 0:04:23
191000 -- (-1050.632) (-1042.866) (-1046.627) [-1045.720] * (-1042.908) [-1038.950] (-1044.034) (-1047.257) -- 0:04:22
191500 -- (-1066.493) (-1056.499) [-1044.130] (-1043.947) * [-1041.399] (-1054.488) (-1049.017) (-1059.378) -- 0:04:21
192000 -- (-1038.339) (-1038.603) (-1047.075) [-1043.228] * (-1042.398) [-1040.067] (-1039.437) (-1050.196) -- 0:04:20
192500 -- [-1042.233] (-1049.084) (-1048.191) (-1061.054) * [-1041.884] (-1045.256) (-1036.608) (-1044.456) -- 0:04:20
193000 -- [-1040.440] (-1045.765) (-1045.741) (-1047.326) * (-1042.896) (-1041.888) [-1034.116] (-1051.801) -- 0:04:23
193500 -- (-1043.675) [-1045.967] (-1039.526) (-1047.138) * (-1050.852) (-1042.267) [-1037.176] (-1042.570) -- 0:04:22
194000 -- (-1043.455) [-1046.423] (-1047.049) (-1044.259) * (-1058.223) (-1047.978) [-1048.152] (-1046.368) -- 0:04:21
194500 -- [-1039.255] (-1057.058) (-1044.615) (-1061.440) * (-1055.717) [-1037.848] (-1040.221) (-1035.951) -- 0:04:20
195000 -- (-1034.256) (-1067.944) (-1039.071) [-1044.639] * (-1049.500) [-1042.025] (-1043.030) (-1049.686) -- 0:04:20
Average standard deviation of split frequencies: 0.019056
195500 -- (-1048.227) (-1046.144) (-1035.471) [-1042.141] * (-1042.286) (-1048.176) [-1047.258] (-1053.011) -- 0:04:19
196000 -- (-1042.957) [-1046.312] (-1044.827) (-1040.648) * (-1058.242) (-1067.665) (-1040.776) [-1039.737] -- 0:04:22
196500 -- [-1036.577] (-1045.000) (-1044.661) (-1043.897) * (-1043.930) (-1043.822) (-1043.157) [-1041.443] -- 0:04:21
197000 -- (-1037.304) (-1044.206) (-1041.613) [-1036.390] * (-1055.788) (-1038.425) (-1046.398) [-1036.606] -- 0:04:20
197500 -- (-1045.939) (-1046.484) [-1032.889] (-1042.522) * (-1052.359) [-1050.035] (-1036.556) (-1047.928) -- 0:04:20
198000 -- (-1043.488) (-1039.604) [-1039.923] (-1042.207) * (-1037.567) (-1044.408) [-1038.137] (-1043.134) -- 0:04:19
198500 -- (-1044.358) (-1045.106) [-1038.218] (-1045.780) * (-1056.744) [-1044.831] (-1043.152) (-1043.702) -- 0:04:18
199000 -- (-1048.092) (-1038.947) [-1042.715] (-1037.154) * (-1054.885) (-1045.811) [-1047.872] (-1044.242) -- 0:04:21
199500 -- (-1036.118) (-1039.930) [-1043.359] (-1033.952) * (-1050.994) (-1053.113) [-1039.894] (-1057.911) -- 0:04:20
200000 -- (-1045.707) [-1046.198] (-1040.524) (-1040.336) * (-1048.963) (-1040.287) [-1038.791] (-1064.453) -- 0:04:20
Average standard deviation of split frequencies: 0.019155
200500 -- [-1045.282] (-1045.085) (-1043.463) (-1038.557) * (-1053.675) [-1041.726] (-1048.134) (-1049.160) -- 0:04:19
201000 -- (-1040.060) [-1042.718] (-1049.007) (-1037.696) * (-1052.213) [-1041.315] (-1040.334) (-1052.014) -- 0:04:18
201500 -- [-1048.863] (-1040.785) (-1057.175) (-1037.871) * (-1043.849) [-1036.733] (-1045.073) (-1050.808) -- 0:04:17
202000 -- [-1048.509] (-1045.379) (-1059.653) (-1045.162) * (-1050.381) (-1043.347) [-1040.833] (-1040.629) -- 0:04:20
202500 -- (-1058.968) [-1039.155] (-1048.437) (-1037.410) * (-1036.837) [-1035.989] (-1043.480) (-1038.951) -- 0:04:19
203000 -- (-1046.091) [-1037.362] (-1059.033) (-1044.492) * (-1038.124) (-1044.771) [-1045.697] (-1050.497) -- 0:04:19
203500 -- [-1041.747] (-1042.820) (-1037.576) (-1049.015) * (-1060.996) (-1043.402) [-1037.275] (-1055.491) -- 0:04:18
204000 -- (-1048.221) (-1053.611) [-1038.695] (-1050.164) * [-1056.172] (-1039.406) (-1047.243) (-1053.414) -- 0:04:17
204500 -- (-1056.289) (-1046.292) [-1034.602] (-1040.045) * (-1047.460) (-1043.855) [-1041.798] (-1040.897) -- 0:04:16
205000 -- (-1045.190) (-1051.400) [-1037.886] (-1040.245) * [-1045.405] (-1038.312) (-1053.452) (-1042.172) -- 0:04:15
Average standard deviation of split frequencies: 0.018659
205500 -- (-1047.540) (-1044.743) [-1040.363] (-1045.764) * (-1046.383) (-1050.128) [-1041.692] (-1032.881) -- 0:04:19
206000 -- (-1050.776) (-1064.491) (-1058.814) [-1038.785] * (-1044.372) (-1041.051) [-1039.637] (-1041.151) -- 0:04:18
206500 -- (-1054.424) [-1044.969] (-1038.486) (-1048.010) * (-1035.560) (-1042.360) [-1051.543] (-1047.963) -- 0:04:17
207000 -- (-1045.220) [-1044.791] (-1042.582) (-1046.844) * (-1042.982) (-1047.125) [-1044.290] (-1058.345) -- 0:04:16
207500 -- (-1049.807) [-1047.795] (-1069.409) (-1048.968) * (-1046.978) (-1042.509) (-1041.148) [-1040.249] -- 0:04:15
208000 -- (-1042.570) [-1033.753] (-1048.384) (-1042.687) * [-1036.361] (-1052.340) (-1044.247) (-1039.814) -- 0:04:15
208500 -- (-1048.329) [-1035.561] (-1044.151) (-1046.552) * (-1039.140) [-1049.109] (-1044.577) (-1040.479) -- 0:04:18
209000 -- [-1046.447] (-1037.879) (-1042.238) (-1043.474) * (-1035.877) (-1047.178) [-1044.380] (-1043.122) -- 0:04:17
209500 -- (-1052.886) [-1037.554] (-1049.243) (-1043.591) * (-1034.426) (-1056.924) (-1045.929) [-1032.606] -- 0:04:16
210000 -- (-1049.805) (-1049.780) [-1042.262] (-1042.780) * (-1040.689) (-1055.419) (-1044.155) [-1036.551] -- 0:04:15
Average standard deviation of split frequencies: 0.017901
210500 -- [-1042.821] (-1043.113) (-1046.857) (-1047.350) * (-1050.055) (-1055.317) (-1066.656) [-1033.317] -- 0:04:15
211000 -- (-1056.854) [-1041.553] (-1043.024) (-1040.295) * (-1037.830) [-1052.352] (-1053.170) (-1043.356) -- 0:04:14
211500 -- (-1045.570) (-1045.421) [-1051.993] (-1056.438) * [-1043.055] (-1055.343) (-1044.373) (-1052.573) -- 0:04:17
212000 -- (-1044.454) (-1057.109) [-1041.019] (-1048.094) * (-1043.182) [-1043.632] (-1070.237) (-1045.471) -- 0:04:16
212500 -- (-1049.681) (-1050.124) [-1037.267] (-1044.751) * [-1044.231] (-1049.028) (-1051.920) (-1047.802) -- 0:04:15
213000 -- (-1040.350) (-1042.485) [-1048.248] (-1046.866) * [-1033.133] (-1056.868) (-1061.940) (-1038.490) -- 0:04:14
213500 -- [-1035.052] (-1055.608) (-1049.283) (-1046.023) * (-1039.825) (-1049.346) (-1042.056) [-1046.173] -- 0:04:14
214000 -- (-1048.035) (-1043.120) (-1036.723) [-1038.697] * (-1043.653) (-1048.961) [-1039.913] (-1041.245) -- 0:04:13
214500 -- (-1041.953) [-1040.555] (-1043.086) (-1043.013) * (-1042.140) (-1045.616) (-1052.664) [-1043.253] -- 0:04:16
215000 -- [-1040.758] (-1044.941) (-1038.868) (-1043.871) * [-1038.228] (-1046.653) (-1044.422) (-1061.831) -- 0:04:15
Average standard deviation of split frequencies: 0.019810
215500 -- (-1042.962) [-1047.276] (-1044.142) (-1044.840) * (-1048.107) (-1048.411) [-1045.042] (-1041.217) -- 0:04:14
216000 -- (-1049.602) (-1046.834) (-1047.721) [-1041.434] * (-1050.181) (-1050.796) (-1041.422) [-1039.122] -- 0:04:14
216500 -- (-1058.315) (-1050.890) [-1044.277] (-1042.255) * [-1035.678] (-1034.734) (-1039.206) (-1042.529) -- 0:04:13
217000 -- (-1044.991) (-1044.772) [-1038.498] (-1042.570) * [-1031.281] (-1048.944) (-1041.204) (-1038.144) -- 0:04:12
217500 -- (-1040.455) (-1046.314) [-1042.257] (-1043.725) * (-1044.996) (-1050.611) [-1038.629] (-1037.940) -- 0:04:15
218000 -- (-1047.459) (-1046.603) (-1040.706) [-1036.353] * (-1042.760) (-1040.995) [-1040.636] (-1048.105) -- 0:04:14
218500 -- [-1046.000] (-1045.208) (-1047.344) (-1051.120) * (-1057.025) [-1044.240] (-1050.094) (-1051.931) -- 0:04:13
219000 -- [-1035.755] (-1054.645) (-1056.421) (-1054.998) * (-1038.899) (-1056.381) [-1040.281] (-1050.990) -- 0:04:13
219500 -- (-1053.473) (-1045.550) (-1054.186) [-1044.078] * (-1041.536) (-1041.971) (-1038.441) [-1046.889] -- 0:04:12
220000 -- (-1045.084) (-1039.717) [-1037.345] (-1055.329) * (-1048.047) (-1045.509) (-1045.647) [-1049.027] -- 0:04:11
Average standard deviation of split frequencies: 0.018898
220500 -- (-1048.292) (-1042.524) [-1034.017] (-1052.666) * [-1040.283] (-1050.209) (-1049.362) (-1047.297) -- 0:04:14
221000 -- (-1035.253) [-1039.072] (-1042.231) (-1070.688) * (-1052.575) (-1046.458) (-1043.398) [-1047.876] -- 0:04:13
221500 -- (-1038.672) (-1043.283) [-1039.291] (-1049.357) * (-1054.532) (-1049.306) [-1041.970] (-1056.374) -- 0:04:13
222000 -- (-1034.391) [-1041.519] (-1037.343) (-1057.504) * [-1046.000] (-1057.672) (-1044.099) (-1039.329) -- 0:04:12
222500 -- (-1040.104) [-1038.018] (-1052.503) (-1045.365) * (-1043.371) (-1048.533) [-1038.804] (-1050.104) -- 0:04:11
223000 -- (-1047.535) (-1032.048) (-1038.218) [-1045.013] * (-1044.021) (-1060.114) (-1038.885) [-1038.186] -- 0:04:10
223500 -- [-1044.580] (-1043.208) (-1048.409) (-1040.565) * (-1047.080) (-1057.213) [-1039.378] (-1038.824) -- 0:04:13
224000 -- (-1039.885) [-1043.455] (-1052.736) (-1069.113) * (-1059.476) [-1037.143] (-1045.007) (-1055.612) -- 0:04:12
224500 -- [-1044.683] (-1031.318) (-1042.785) (-1051.770) * [-1044.239] (-1065.137) (-1042.997) (-1050.751) -- 0:04:12
225000 -- (-1042.914) (-1047.357) (-1054.401) [-1039.792] * (-1045.181) (-1065.461) (-1038.044) [-1054.057] -- 0:04:11
Average standard deviation of split frequencies: 0.019254
225500 -- (-1052.853) (-1043.536) (-1053.407) [-1042.345] * [-1037.667] (-1058.931) (-1041.680) (-1043.320) -- 0:04:10
226000 -- (-1048.302) (-1040.511) (-1047.261) [-1047.900] * [-1046.673] (-1061.013) (-1038.756) (-1045.586) -- 0:04:10
226500 -- (-1046.713) (-1063.007) [-1044.345] (-1042.888) * [-1031.322] (-1042.971) (-1044.444) (-1041.543) -- 0:04:09
227000 -- [-1039.881] (-1057.243) (-1046.710) (-1036.876) * (-1042.198) (-1050.514) (-1050.790) [-1031.965] -- 0:04:11
227500 -- (-1046.152) (-1049.191) [-1039.990] (-1036.617) * (-1047.946) (-1060.182) [-1052.367] (-1043.795) -- 0:04:11
228000 -- (-1047.658) (-1043.912) (-1056.659) [-1044.088] * [-1036.214] (-1041.673) (-1039.104) (-1062.110) -- 0:04:10
228500 -- (-1047.800) (-1037.660) [-1039.163] (-1044.776) * (-1046.032) (-1045.720) [-1043.468] (-1053.175) -- 0:04:09
229000 -- [-1040.392] (-1040.661) (-1043.476) (-1038.424) * (-1036.432) [-1041.713] (-1043.138) (-1053.509) -- 0:04:09
229500 -- (-1048.422) [-1038.968] (-1043.463) (-1040.974) * (-1035.484) (-1041.074) (-1043.166) [-1036.946] -- 0:04:08
230000 -- [-1037.635] (-1045.708) (-1062.333) (-1049.171) * [-1042.555] (-1039.117) (-1049.377) (-1039.905) -- 0:04:11
Average standard deviation of split frequencies: 0.019022
230500 -- (-1042.860) [-1043.480] (-1039.263) (-1048.751) * (-1047.681) (-1049.903) [-1043.492] (-1035.158) -- 0:04:10
231000 -- [-1045.912] (-1050.607) (-1049.061) (-1061.247) * (-1053.104) (-1042.475) [-1035.270] (-1038.506) -- 0:04:09
231500 -- (-1045.656) [-1050.693] (-1049.268) (-1057.452) * (-1040.201) (-1048.253) [-1030.770] (-1043.186) -- 0:04:08
232000 -- (-1041.695) [-1045.228] (-1045.305) (-1058.975) * [-1046.549] (-1045.609) (-1040.265) (-1046.647) -- 0:04:08
232500 -- (-1051.900) (-1041.649) [-1037.722] (-1056.456) * [-1044.251] (-1054.838) (-1046.031) (-1035.527) -- 0:04:07
233000 -- (-1050.998) (-1051.521) (-1047.009) [-1043.839] * (-1054.618) (-1041.224) (-1044.068) [-1041.356] -- 0:04:10
233500 -- (-1041.098) [-1038.785] (-1049.390) (-1037.753) * (-1051.528) (-1048.522) [-1040.854] (-1044.917) -- 0:04:09
234000 -- (-1036.060) [-1045.102] (-1056.145) (-1047.382) * (-1035.911) (-1043.055) [-1041.086] (-1048.756) -- 0:04:08
234500 -- (-1036.327) [-1042.240] (-1046.548) (-1041.489) * (-1056.846) [-1041.515] (-1044.234) (-1054.733) -- 0:04:08
235000 -- (-1045.940) (-1043.171) [-1038.385] (-1045.440) * (-1053.801) (-1050.243) (-1040.668) [-1030.364] -- 0:04:07
Average standard deviation of split frequencies: 0.018899
235500 -- [-1038.856] (-1043.673) (-1039.631) (-1038.430) * (-1048.261) (-1034.458) (-1040.455) [-1040.055] -- 0:04:06
236000 -- (-1042.540) (-1043.952) (-1051.854) [-1036.873] * [-1037.679] (-1040.815) (-1041.776) (-1040.338) -- 0:04:09
236500 -- [-1038.342] (-1049.360) (-1052.593) (-1049.389) * (-1048.859) [-1041.307] (-1039.093) (-1058.205) -- 0:04:08
237000 -- [-1046.387] (-1057.888) (-1042.510) (-1040.532) * [-1041.277] (-1039.461) (-1054.844) (-1047.416) -- 0:04:07
237500 -- (-1037.115) (-1057.845) (-1040.499) [-1040.694] * (-1047.858) [-1032.378] (-1047.436) (-1047.754) -- 0:04:07
238000 -- [-1041.392] (-1060.830) (-1051.356) (-1040.343) * [-1030.716] (-1034.912) (-1040.017) (-1075.973) -- 0:04:06
238500 -- (-1046.127) (-1048.447) [-1038.677] (-1039.492) * (-1051.998) (-1041.542) [-1037.390] (-1056.650) -- 0:04:05
239000 -- [-1043.548] (-1044.751) (-1056.337) (-1044.903) * (-1043.045) [-1040.388] (-1042.807) (-1057.908) -- 0:04:08
239500 -- (-1069.724) (-1049.526) (-1041.304) [-1041.156] * [-1034.592] (-1046.471) (-1045.232) (-1045.017) -- 0:04:07
240000 -- (-1051.314) (-1049.077) (-1043.956) [-1044.451] * (-1041.388) [-1041.248] (-1044.037) (-1043.927) -- 0:04:07
Average standard deviation of split frequencies: 0.017930
240500 -- [-1038.429] (-1050.159) (-1048.104) (-1055.641) * [-1042.505] (-1046.618) (-1042.739) (-1048.480) -- 0:04:06
241000 -- (-1035.884) (-1046.576) (-1040.766) [-1041.293] * (-1045.149) (-1037.252) (-1050.741) [-1046.836] -- 0:04:05
241500 -- (-1045.252) (-1051.193) [-1050.125] (-1058.545) * (-1048.995) (-1039.222) [-1033.804] (-1050.649) -- 0:04:04
242000 -- (-1042.028) [-1038.353] (-1048.089) (-1037.755) * (-1053.685) [-1035.627] (-1050.729) (-1051.928) -- 0:04:07
242500 -- [-1042.542] (-1037.740) (-1050.962) (-1045.111) * (-1042.996) (-1039.139) (-1035.175) [-1043.046] -- 0:04:06
243000 -- (-1046.649) [-1036.858] (-1044.596) (-1045.989) * (-1050.038) (-1046.333) [-1036.281] (-1047.843) -- 0:04:06
243500 -- [-1034.752] (-1037.709) (-1053.031) (-1048.866) * [-1038.700] (-1053.410) (-1046.237) (-1045.528) -- 0:04:05
244000 -- [-1047.224] (-1038.192) (-1065.229) (-1052.654) * [-1037.619] (-1058.141) (-1045.331) (-1046.059) -- 0:04:04
244500 -- (-1045.425) (-1036.839) (-1046.089) [-1030.461] * (-1036.093) (-1067.130) [-1038.566] (-1048.337) -- 0:04:04
245000 -- (-1049.491) (-1043.638) (-1053.142) [-1042.167] * (-1034.218) [-1039.318] (-1053.142) (-1049.418) -- 0:04:06
Average standard deviation of split frequencies: 0.015772
245500 -- [-1048.093] (-1039.607) (-1052.114) (-1042.965) * (-1035.919) [-1046.205] (-1050.304) (-1045.621) -- 0:04:05
246000 -- [-1039.182] (-1040.642) (-1046.298) (-1056.016) * (-1038.214) (-1058.690) [-1038.110] (-1041.114) -- 0:04:05
246500 -- (-1040.031) [-1036.014] (-1058.760) (-1046.569) * (-1052.654) [-1051.216] (-1050.584) (-1047.206) -- 0:04:04
247000 -- [-1038.561] (-1031.941) (-1052.553) (-1052.122) * (-1054.594) [-1037.105] (-1044.890) (-1043.597) -- 0:04:03
247500 -- [-1045.356] (-1044.507) (-1045.119) (-1062.828) * (-1034.964) (-1050.883) [-1042.091] (-1040.055) -- 0:04:03
248000 -- (-1047.703) (-1049.317) (-1039.632) [-1053.705] * (-1047.825) (-1041.893) [-1038.121] (-1051.627) -- 0:04:02
248500 -- (-1038.720) [-1039.349] (-1047.088) (-1051.673) * (-1047.073) (-1045.200) (-1051.620) [-1041.264] -- 0:04:04
249000 -- [-1049.674] (-1039.814) (-1043.371) (-1051.240) * [-1042.639] (-1042.396) (-1048.973) (-1043.107) -- 0:04:04
249500 -- [-1041.720] (-1036.251) (-1054.989) (-1048.367) * (-1042.879) (-1054.770) [-1042.825] (-1043.674) -- 0:04:03
250000 -- (-1043.676) (-1039.030) (-1055.654) [-1042.161] * (-1047.321) (-1050.308) [-1034.142] (-1042.493) -- 0:04:03
Average standard deviation of split frequencies: 0.014322
250500 -- (-1055.723) (-1047.456) [-1040.549] (-1045.556) * (-1047.932) [-1044.204] (-1034.036) (-1047.685) -- 0:04:02
251000 -- (-1048.952) (-1037.613) (-1041.903) [-1040.781] * (-1042.741) (-1049.744) [-1035.060] (-1052.809) -- 0:04:04
251500 -- (-1035.146) (-1044.126) [-1036.110] (-1049.849) * (-1044.652) (-1044.329) (-1044.812) [-1044.745] -- 0:04:04
252000 -- [-1036.087] (-1032.687) (-1047.936) (-1041.084) * (-1046.208) (-1053.363) (-1038.217) [-1043.372] -- 0:04:03
252500 -- (-1051.668) (-1043.237) (-1047.489) [-1036.736] * (-1043.424) [-1040.704] (-1035.812) (-1045.881) -- 0:04:02
253000 -- (-1041.971) [-1041.160] (-1048.956) (-1037.547) * [-1037.762] (-1042.635) (-1032.661) (-1047.039) -- 0:04:02
253500 -- [-1043.771] (-1037.086) (-1058.051) (-1043.402) * [-1037.667] (-1038.798) (-1046.345) (-1049.544) -- 0:04:01
254000 -- (-1044.353) (-1043.944) (-1062.883) [-1035.014] * (-1049.863) (-1044.362) (-1049.940) [-1035.213] -- 0:04:03
254500 -- (-1051.939) (-1044.110) [-1037.655] (-1044.308) * (-1053.502) (-1049.032) (-1049.973) [-1042.318] -- 0:04:03
255000 -- (-1041.088) [-1043.400] (-1051.897) (-1043.880) * (-1050.980) [-1046.774] (-1041.682) (-1053.306) -- 0:04:02
Average standard deviation of split frequencies: 0.013173
255500 -- (-1038.741) (-1049.691) (-1042.248) [-1038.558] * (-1048.693) [-1034.156] (-1056.796) (-1042.969) -- 0:04:01
256000 -- (-1041.288) (-1039.513) [-1045.735] (-1047.256) * (-1054.348) [-1040.392] (-1047.745) (-1047.097) -- 0:04:01
256500 -- [-1033.211] (-1037.843) (-1044.874) (-1035.823) * [-1051.322] (-1047.891) (-1059.655) (-1036.082) -- 0:04:00
257000 -- (-1043.225) [-1044.099] (-1048.195) (-1044.625) * (-1044.696) (-1046.159) [-1045.813] (-1041.042) -- 0:04:02
257500 -- (-1048.594) [-1038.679] (-1043.255) (-1033.704) * [-1043.266] (-1055.082) (-1040.311) (-1046.830) -- 0:04:02
258000 -- (-1052.214) (-1037.294) (-1051.284) [-1048.021] * [-1045.130] (-1051.188) (-1036.323) (-1046.262) -- 0:04:01
258500 -- (-1044.538) (-1041.645) (-1038.770) [-1038.916] * [-1035.922] (-1047.222) (-1058.805) (-1051.475) -- 0:04:00
259000 -- (-1051.585) (-1049.871) (-1048.850) [-1042.073] * [-1036.751] (-1041.695) (-1044.139) (-1042.807) -- 0:04:00
259500 -- (-1039.720) (-1048.806) (-1037.978) [-1042.487] * [-1037.820] (-1037.988) (-1041.073) (-1043.703) -- 0:03:59
260000 -- (-1048.350) [-1041.029] (-1050.579) (-1042.781) * (-1035.600) (-1041.036) [-1040.690] (-1049.692) -- 0:04:01
Average standard deviation of split frequencies: 0.013494
260500 -- [-1038.999] (-1049.957) (-1059.872) (-1039.744) * (-1039.295) (-1048.421) [-1035.072] (-1066.084) -- 0:04:01
261000 -- (-1045.738) [-1036.407] (-1041.497) (-1048.460) * [-1040.255] (-1035.241) (-1053.189) (-1051.222) -- 0:04:00
261500 -- [-1035.712] (-1048.662) (-1050.160) (-1037.515) * (-1045.763) (-1038.049) (-1050.443) [-1043.359] -- 0:04:00
262000 -- [-1036.839] (-1048.303) (-1037.816) (-1038.886) * (-1046.180) [-1043.977] (-1048.389) (-1046.168) -- 0:03:59
262500 -- [-1039.285] (-1052.469) (-1044.424) (-1038.135) * [-1042.674] (-1049.101) (-1048.056) (-1038.844) -- 0:03:58
263000 -- (-1039.373) [-1035.615] (-1039.434) (-1056.379) * (-1043.244) [-1043.282] (-1040.589) (-1045.346) -- 0:04:00
263500 -- (-1034.506) (-1041.123) [-1040.301] (-1054.674) * (-1037.613) (-1052.125) [-1042.120] (-1046.665) -- 0:04:00
264000 -- (-1038.353) (-1041.181) [-1036.337] (-1054.578) * (-1035.626) [-1043.918] (-1051.142) (-1040.923) -- 0:03:59
264500 -- (-1048.803) [-1044.182] (-1054.827) (-1043.561) * [-1037.271] (-1035.736) (-1044.894) (-1038.825) -- 0:03:59
265000 -- (-1058.822) [-1035.476] (-1043.427) (-1049.218) * (-1048.294) [-1036.237] (-1057.255) (-1036.517) -- 0:03:58
Average standard deviation of split frequencies: 0.012951
265500 -- [-1038.679] (-1048.387) (-1052.399) (-1055.619) * (-1046.850) (-1043.884) (-1042.905) [-1037.429] -- 0:03:57
266000 -- (-1038.999) (-1035.047) (-1050.937) [-1042.567] * (-1044.291) [-1042.191] (-1041.027) (-1040.657) -- 0:04:00
266500 -- (-1040.766) (-1040.984) [-1046.386] (-1055.844) * (-1049.346) [-1043.198] (-1051.894) (-1038.845) -- 0:03:59
267000 -- [-1032.281] (-1040.987) (-1037.920) (-1045.545) * (-1041.817) (-1041.545) [-1040.153] (-1047.610) -- 0:03:58
267500 -- (-1050.420) [-1047.240] (-1045.982) (-1047.627) * (-1050.111) (-1048.947) [-1040.382] (-1053.122) -- 0:03:58
268000 -- (-1045.481) (-1041.077) [-1047.393] (-1057.740) * (-1057.230) (-1050.401) (-1046.273) [-1044.392] -- 0:03:57
268500 -- (-1035.335) (-1046.094) [-1042.124] (-1068.652) * (-1047.276) (-1058.842) (-1043.863) [-1038.004] -- 0:03:57
269000 -- (-1039.281) (-1044.611) [-1034.878] (-1063.964) * (-1049.022) (-1061.413) (-1047.227) [-1045.576] -- 0:03:59
269500 -- [-1040.820] (-1044.114) (-1044.940) (-1052.092) * (-1047.247) (-1048.348) [-1044.210] (-1045.359) -- 0:03:58
270000 -- (-1047.601) (-1058.331) [-1039.401] (-1051.384) * (-1043.326) (-1040.102) (-1045.460) [-1031.550] -- 0:03:57
Average standard deviation of split frequencies: 0.013397
270500 -- (-1051.816) (-1037.766) (-1046.851) [-1043.180] * [-1033.930] (-1042.298) (-1056.837) (-1048.483) -- 0:03:57
271000 -- (-1039.301) (-1047.454) [-1038.346] (-1046.975) * (-1045.302) (-1045.747) (-1059.130) [-1038.334] -- 0:03:56
271500 -- (-1054.910) [-1043.710] (-1045.938) (-1041.443) * [-1037.838] (-1041.971) (-1065.532) (-1050.791) -- 0:03:56
272000 -- (-1041.397) [-1054.073] (-1044.895) (-1057.919) * (-1039.901) [-1041.422] (-1062.584) (-1048.552) -- 0:03:58
272500 -- (-1042.833) (-1048.313) [-1040.249] (-1046.890) * [-1040.174] (-1045.071) (-1057.546) (-1051.623) -- 0:03:57
273000 -- (-1044.097) (-1046.229) (-1047.321) [-1037.861] * (-1040.838) [-1045.601] (-1039.224) (-1046.469) -- 0:03:57
273500 -- (-1042.724) [-1042.434] (-1044.198) (-1055.622) * [-1034.087] (-1036.033) (-1043.206) (-1041.625) -- 0:03:56
274000 -- (-1042.165) (-1048.550) [-1041.931] (-1056.843) * [-1039.726] (-1052.785) (-1041.096) (-1048.248) -- 0:03:55
274500 -- (-1050.212) (-1055.474) (-1040.146) [-1044.816] * [-1035.395] (-1054.561) (-1036.672) (-1049.372) -- 0:03:55
275000 -- (-1060.342) (-1066.662) [-1044.451] (-1047.955) * (-1035.819) (-1050.334) [-1038.455] (-1050.076) -- 0:03:57
Average standard deviation of split frequencies: 0.014715
275500 -- [-1044.238] (-1050.173) (-1049.590) (-1042.896) * [-1044.043] (-1037.890) (-1037.539) (-1041.799) -- 0:03:56
276000 -- [-1049.135] (-1045.861) (-1043.323) (-1041.341) * [-1041.675] (-1050.666) (-1046.155) (-1055.053) -- 0:03:56
276500 -- (-1037.174) (-1049.947) (-1049.152) [-1044.509] * (-1044.834) (-1064.771) (-1041.297) [-1035.860] -- 0:03:55
277000 -- [-1037.822] (-1044.468) (-1049.969) (-1056.908) * [-1038.141] (-1065.821) (-1047.297) (-1054.529) -- 0:03:54
277500 -- (-1038.582) [-1040.349] (-1049.311) (-1044.949) * (-1044.514) (-1046.183) (-1045.043) [-1041.607] -- 0:03:54
278000 -- (-1043.711) (-1044.680) (-1043.246) [-1039.432] * [-1048.196] (-1046.863) (-1045.905) (-1039.026) -- 0:03:56
278500 -- (-1034.753) (-1064.730) (-1033.877) [-1040.204] * [-1048.106] (-1060.815) (-1044.416) (-1054.270) -- 0:03:55
279000 -- (-1045.678) (-1052.138) [-1036.872] (-1047.294) * (-1038.011) [-1058.715] (-1049.478) (-1041.426) -- 0:03:55
279500 -- [-1035.454] (-1045.789) (-1040.236) (-1047.654) * (-1041.384) (-1056.853) (-1049.008) [-1046.474] -- 0:03:54
280000 -- (-1050.891) (-1046.514) (-1051.779) [-1041.809] * (-1040.875) [-1039.815] (-1049.228) (-1040.281) -- 0:03:54
Average standard deviation of split frequencies: 0.013954
280500 -- (-1036.589) [-1042.613] (-1052.750) (-1048.549) * [-1043.874] (-1037.539) (-1050.750) (-1038.139) -- 0:03:53
281000 -- (-1045.729) (-1043.501) (-1036.008) [-1049.079] * (-1041.857) (-1054.541) (-1046.640) [-1043.444] -- 0:03:55
281500 -- (-1042.445) (-1043.186) (-1044.775) [-1045.377] * (-1042.300) (-1049.294) (-1034.419) [-1038.434] -- 0:03:54
282000 -- (-1040.855) (-1048.502) [-1040.671] (-1055.930) * (-1038.928) (-1046.322) [-1043.779] (-1039.760) -- 0:03:54
282500 -- (-1047.622) [-1036.443] (-1046.747) (-1056.918) * (-1048.773) (-1051.175) [-1036.013] (-1035.302) -- 0:03:53
283000 -- (-1043.284) (-1050.961) [-1034.369] (-1043.226) * (-1053.521) (-1049.606) (-1042.648) [-1037.397] -- 0:03:53
283500 -- (-1046.916) (-1052.080) [-1045.075] (-1066.161) * (-1049.479) (-1044.480) (-1048.603) [-1040.562] -- 0:03:52
284000 -- (-1033.586) (-1049.136) [-1032.772] (-1074.557) * [-1041.401] (-1048.484) (-1057.223) (-1043.184) -- 0:03:54
284500 -- [-1034.779] (-1054.137) (-1046.449) (-1058.357) * (-1036.245) (-1053.576) (-1044.748) [-1039.614] -- 0:03:53
285000 -- (-1038.215) [-1042.411] (-1050.190) (-1054.595) * (-1049.724) (-1048.785) (-1033.954) [-1036.801] -- 0:03:53
Average standard deviation of split frequencies: 0.014074
285500 -- [-1043.449] (-1038.914) (-1042.571) (-1038.976) * (-1041.644) (-1046.360) (-1040.600) [-1041.196] -- 0:03:52
286000 -- (-1037.946) [-1038.382] (-1040.531) (-1042.261) * (-1053.519) (-1049.528) (-1050.524) [-1041.950] -- 0:03:52
286500 -- (-1039.283) [-1045.820] (-1048.320) (-1049.273) * (-1037.936) (-1054.088) [-1042.054] (-1038.772) -- 0:03:51
287000 -- [-1038.176] (-1051.710) (-1046.662) (-1048.580) * (-1037.474) (-1054.602) (-1043.804) [-1042.557] -- 0:03:51
287500 -- (-1034.567) [-1040.509] (-1043.372) (-1044.713) * (-1038.193) [-1044.744] (-1045.345) (-1065.865) -- 0:03:52
288000 -- (-1045.474) (-1069.812) (-1054.086) [-1046.134] * [-1046.620] (-1046.624) (-1050.730) (-1042.878) -- 0:03:52
288500 -- (-1040.175) [-1037.355] (-1051.162) (-1041.129) * (-1055.034) (-1061.979) [-1043.312] (-1041.329) -- 0:03:51
289000 -- (-1044.635) [-1042.440] (-1070.336) (-1040.814) * [-1045.479] (-1068.407) (-1033.683) (-1048.773) -- 0:03:51
289500 -- (-1042.062) [-1046.575] (-1048.293) (-1057.653) * [-1042.866] (-1047.856) (-1051.868) (-1039.750) -- 0:03:50
290000 -- (-1044.571) [-1033.625] (-1037.240) (-1049.794) * (-1041.232) (-1053.478) (-1048.771) [-1044.294] -- 0:03:50
Average standard deviation of split frequencies: 0.013848
290500 -- (-1032.789) [-1047.912] (-1040.376) (-1051.825) * (-1047.407) (-1042.941) (-1056.900) [-1043.161] -- 0:03:52
291000 -- (-1044.553) [-1035.904] (-1040.648) (-1042.057) * (-1042.375) (-1050.104) [-1050.628] (-1069.585) -- 0:03:51
291500 -- (-1039.666) [-1033.262] (-1048.961) (-1048.324) * (-1050.536) (-1038.485) [-1041.439] (-1065.504) -- 0:03:50
292000 -- (-1046.276) [-1043.344] (-1046.052) (-1047.053) * (-1053.548) (-1043.117) [-1044.109] (-1056.461) -- 0:03:50
292500 -- (-1042.616) (-1041.096) [-1035.871] (-1049.742) * (-1051.363) [-1040.156] (-1042.870) (-1048.300) -- 0:03:49
293000 -- (-1046.708) (-1046.294) [-1039.083] (-1060.144) * (-1040.622) (-1048.914) [-1049.790] (-1041.629) -- 0:03:49
293500 -- (-1049.697) [-1036.592] (-1054.668) (-1042.942) * [-1039.363] (-1048.415) (-1051.550) (-1041.007) -- 0:03:51
294000 -- (-1051.041) [-1041.508] (-1053.195) (-1065.462) * (-1052.847) (-1043.380) [-1043.550] (-1042.870) -- 0:03:50
294500 -- (-1035.703) [-1041.177] (-1038.098) (-1047.720) * (-1043.079) [-1038.683] (-1057.692) (-1040.361) -- 0:03:49
295000 -- (-1046.627) (-1049.454) (-1054.290) [-1041.226] * (-1046.494) (-1039.907) [-1041.370] (-1042.425) -- 0:03:49
Average standard deviation of split frequencies: 0.013476
295500 -- (-1058.784) (-1042.083) [-1045.414] (-1050.320) * [-1032.533] (-1041.906) (-1036.748) (-1041.109) -- 0:03:48
296000 -- (-1057.432) [-1038.922] (-1046.145) (-1044.822) * [-1035.158] (-1040.565) (-1041.683) (-1039.319) -- 0:03:48
296500 -- (-1049.543) (-1041.794) [-1035.445] (-1036.568) * (-1052.665) (-1046.502) (-1046.553) [-1046.643] -- 0:03:50
297000 -- [-1043.008] (-1049.622) (-1043.900) (-1038.449) * (-1051.243) [-1041.682] (-1045.561) (-1040.389) -- 0:03:49
297500 -- [-1034.739] (-1048.884) (-1044.861) (-1048.114) * [-1040.099] (-1051.070) (-1045.436) (-1055.081) -- 0:03:49
298000 -- (-1060.146) (-1055.872) [-1043.912] (-1037.935) * (-1049.158) (-1052.285) (-1037.162) [-1036.563] -- 0:03:48
298500 -- (-1057.272) (-1043.924) [-1041.223] (-1050.561) * [-1049.143] (-1060.887) (-1039.759) (-1037.176) -- 0:03:47
299000 -- (-1049.662) (-1042.978) [-1048.957] (-1048.533) * [-1031.944] (-1040.679) (-1033.754) (-1051.593) -- 0:03:47
299500 -- (-1055.831) (-1045.210) [-1040.647] (-1041.671) * (-1037.573) [-1036.456] (-1046.030) (-1048.538) -- 0:03:46
300000 -- (-1038.109) (-1042.462) (-1042.198) [-1051.947] * (-1051.875) (-1037.415) (-1044.458) [-1041.555] -- 0:03:48
Average standard deviation of split frequencies: 0.013025
300500 -- [-1046.910] (-1047.718) (-1045.131) (-1041.716) * [-1052.271] (-1039.713) (-1038.083) (-1043.008) -- 0:03:48
301000 -- (-1071.903) [-1039.753] (-1040.285) (-1047.735) * (-1049.593) (-1045.975) [-1035.984] (-1046.282) -- 0:03:47
301500 -- (-1043.435) (-1048.283) [-1048.070] (-1040.495) * (-1037.648) (-1049.305) (-1042.935) [-1045.725] -- 0:03:47
302000 -- (-1049.657) (-1043.096) [-1040.712] (-1047.725) * (-1046.438) (-1047.854) [-1041.243] (-1039.788) -- 0:03:46
302500 -- (-1057.217) [-1047.016] (-1046.422) (-1039.673) * (-1048.043) [-1048.656] (-1051.022) (-1047.373) -- 0:03:45
303000 -- (-1046.472) (-1049.199) (-1038.382) [-1045.240] * (-1043.009) (-1053.973) (-1067.421) [-1041.479] -- 0:03:47
303500 -- (-1041.284) (-1049.444) (-1044.471) [-1035.978] * (-1059.979) [-1041.431] (-1039.038) (-1052.637) -- 0:03:47
304000 -- [-1046.983] (-1045.738) (-1044.121) (-1040.451) * [-1040.161] (-1047.278) (-1038.008) (-1052.202) -- 0:03:46
304500 -- (-1046.280) [-1038.359] (-1049.026) (-1041.987) * (-1039.769) [-1049.627] (-1039.399) (-1043.042) -- 0:03:46
305000 -- (-1048.900) [-1050.605] (-1036.649) (-1042.924) * (-1041.368) [-1042.444] (-1064.161) (-1048.523) -- 0:03:45
Average standard deviation of split frequencies: 0.013865
305500 -- [-1038.439] (-1047.903) (-1057.400) (-1046.203) * [-1031.894] (-1041.657) (-1047.919) (-1059.995) -- 0:03:45
306000 -- (-1057.298) (-1039.846) [-1036.881] (-1048.000) * [-1032.305] (-1043.881) (-1042.445) (-1053.625) -- 0:03:46
306500 -- (-1058.073) (-1058.127) (-1043.319) [-1038.668] * (-1043.445) (-1041.128) [-1043.622] (-1046.404) -- 0:03:46
307000 -- (-1066.598) (-1048.606) (-1040.609) [-1039.016] * [-1041.645] (-1051.321) (-1058.023) (-1042.648) -- 0:03:45
307500 -- (-1059.516) [-1042.926] (-1032.295) (-1039.170) * (-1039.440) (-1052.977) (-1039.291) [-1032.507] -- 0:03:45
308000 -- (-1048.648) (-1043.069) [-1037.920] (-1049.787) * (-1038.335) [-1036.171] (-1041.777) (-1045.838) -- 0:03:44
308500 -- (-1042.010) (-1046.615) (-1044.717) [-1035.538] * [-1036.606] (-1057.432) (-1043.730) (-1044.842) -- 0:03:44
309000 -- (-1057.814) (-1054.765) [-1040.622] (-1050.022) * (-1045.601) (-1048.865) (-1050.159) [-1047.199] -- 0:03:45
309500 -- [-1043.897] (-1058.634) (-1047.040) (-1050.849) * (-1034.429) (-1049.060) (-1041.931) [-1037.397] -- 0:03:45
310000 -- [-1041.633] (-1062.246) (-1045.752) (-1050.530) * (-1049.913) (-1053.666) [-1036.089] (-1037.735) -- 0:03:44
Average standard deviation of split frequencies: 0.014240
310500 -- (-1044.054) (-1055.450) (-1053.638) [-1041.246] * [-1042.077] (-1045.115) (-1054.420) (-1045.874) -- 0:03:44
311000 -- (-1048.062) (-1044.092) (-1056.266) [-1038.575] * (-1036.241) (-1050.356) (-1046.996) [-1046.949] -- 0:03:43
311500 -- [-1040.034] (-1035.221) (-1039.603) (-1056.717) * (-1043.156) (-1049.928) [-1033.585] (-1051.554) -- 0:03:43
312000 -- (-1048.487) [-1038.033] (-1047.430) (-1045.495) * [-1039.556] (-1040.945) (-1040.434) (-1043.961) -- 0:03:44
312500 -- [-1041.385] (-1044.711) (-1045.288) (-1059.816) * (-1041.403) (-1047.344) [-1037.701] (-1047.801) -- 0:03:44
313000 -- [-1043.543] (-1047.714) (-1048.343) (-1045.646) * (-1034.912) (-1045.727) (-1050.801) [-1035.433] -- 0:03:43
313500 -- (-1049.007) [-1031.120] (-1046.488) (-1048.366) * (-1048.515) (-1053.849) (-1047.142) [-1044.190] -- 0:03:43
314000 -- [-1039.248] (-1039.936) (-1043.643) (-1056.031) * (-1049.828) (-1049.652) [-1042.602] (-1056.410) -- 0:03:42
314500 -- (-1044.532) (-1039.289) (-1040.549) [-1038.737] * (-1046.715) [-1040.432] (-1044.838) (-1042.500) -- 0:03:42
315000 -- [-1035.763] (-1043.663) (-1038.670) (-1050.704) * (-1047.118) (-1041.899) [-1048.835] (-1051.740) -- 0:03:43
Average standard deviation of split frequencies: 0.013656
315500 -- (-1039.863) (-1058.459) (-1049.458) [-1039.671] * (-1049.496) (-1034.627) [-1040.005] (-1039.332) -- 0:03:43
316000 -- (-1031.802) (-1041.370) (-1047.452) [-1041.457] * (-1043.005) [-1063.585] (-1037.434) (-1043.206) -- 0:03:42
316500 -- (-1041.433) [-1038.128] (-1041.222) (-1032.861) * (-1042.020) [-1043.638] (-1038.667) (-1051.157) -- 0:03:42
317000 -- [-1041.604] (-1045.984) (-1035.459) (-1045.743) * (-1052.213) (-1041.352) [-1042.269] (-1044.136) -- 0:03:41
317500 -- (-1044.469) [-1041.991] (-1042.101) (-1038.315) * (-1038.842) [-1037.900] (-1035.085) (-1051.129) -- 0:03:41
318000 -- [-1040.958] (-1045.121) (-1057.353) (-1031.797) * (-1039.712) [-1029.107] (-1053.744) (-1058.262) -- 0:03:43
318500 -- [-1042.266] (-1040.050) (-1053.152) (-1040.220) * (-1046.791) [-1035.544] (-1043.082) (-1044.331) -- 0:03:42
319000 -- (-1041.214) (-1042.931) (-1052.338) [-1043.464] * [-1038.446] (-1041.142) (-1042.470) (-1058.447) -- 0:03:42
319500 -- [-1034.370] (-1051.953) (-1059.459) (-1033.929) * (-1044.619) [-1037.774] (-1042.049) (-1047.438) -- 0:03:41
320000 -- (-1053.115) [-1031.701] (-1044.481) (-1037.944) * (-1035.411) [-1034.596] (-1040.985) (-1043.738) -- 0:03:41
Average standard deviation of split frequencies: 0.011987
320500 -- (-1049.015) (-1038.882) (-1040.890) [-1048.503] * (-1048.689) [-1038.224] (-1044.971) (-1048.016) -- 0:03:40
321000 -- (-1044.818) (-1045.887) [-1043.321] (-1049.564) * (-1047.367) (-1046.483) [-1037.319] (-1043.623) -- 0:03:42
321500 -- [-1039.245] (-1045.292) (-1040.148) (-1047.512) * (-1049.122) [-1039.271] (-1050.137) (-1040.557) -- 0:03:41
322000 -- [-1040.999] (-1055.344) (-1044.597) (-1044.342) * (-1045.905) [-1033.238] (-1044.746) (-1047.198) -- 0:03:41
322500 -- [-1035.996] (-1043.182) (-1063.607) (-1041.676) * (-1043.855) [-1042.658] (-1045.705) (-1046.920) -- 0:03:40
323000 -- (-1047.000) [-1042.249] (-1058.440) (-1052.613) * [-1040.031] (-1045.183) (-1038.138) (-1038.244) -- 0:03:40
323500 -- (-1042.598) [-1033.184] (-1044.287) (-1042.636) * (-1058.753) [-1046.289] (-1052.366) (-1045.101) -- 0:03:39
324000 -- (-1049.409) (-1035.481) [-1038.841] (-1051.102) * (-1045.188) (-1051.721) [-1047.959] (-1053.448) -- 0:03:41
324500 -- (-1060.898) [-1041.843] (-1042.956) (-1042.530) * [-1046.223] (-1039.255) (-1048.587) (-1034.355) -- 0:03:40
325000 -- (-1041.208) (-1038.136) (-1052.649) [-1040.288] * [-1040.526] (-1045.938) (-1044.686) (-1039.694) -- 0:03:40
Average standard deviation of split frequencies: 0.013570
325500 -- (-1044.641) (-1043.899) [-1041.618] (-1041.416) * [-1034.276] (-1050.378) (-1042.772) (-1036.084) -- 0:03:39
326000 -- [-1035.514] (-1039.175) (-1044.118) (-1048.490) * (-1041.881) (-1048.901) (-1042.437) [-1043.509] -- 0:03:39
326500 -- (-1042.816) (-1046.324) (-1042.915) [-1038.772] * (-1046.853) [-1044.271] (-1042.638) (-1045.660) -- 0:03:38
327000 -- (-1049.285) (-1042.733) (-1041.997) [-1043.249] * (-1042.164) (-1053.552) [-1042.318] (-1050.255) -- 0:03:40
327500 -- [-1041.631] (-1039.344) (-1058.264) (-1040.764) * (-1053.831) [-1045.403] (-1045.768) (-1043.637) -- 0:03:39
328000 -- [-1033.754] (-1047.231) (-1049.606) (-1058.920) * (-1054.841) [-1039.373] (-1044.598) (-1043.039) -- 0:03:39
328500 -- (-1047.908) (-1051.841) [-1034.688] (-1055.076) * (-1046.526) (-1051.152) (-1045.867) [-1036.460] -- 0:03:38
329000 -- (-1047.117) (-1043.071) [-1038.668] (-1067.141) * (-1035.291) (-1043.215) [-1041.711] (-1054.548) -- 0:03:38
329500 -- (-1040.255) (-1043.256) [-1042.545] (-1042.911) * (-1039.245) (-1048.410) [-1035.558] (-1047.908) -- 0:03:37
330000 -- (-1050.274) [-1048.793] (-1040.686) (-1047.226) * (-1041.770) (-1045.498) (-1047.696) [-1043.524] -- 0:03:39
Average standard deviation of split frequencies: 0.013708
330500 -- (-1054.944) (-1058.762) [-1033.703] (-1037.892) * (-1042.610) [-1039.739] (-1041.940) (-1045.459) -- 0:03:38
331000 -- (-1041.786) (-1054.110) [-1038.011] (-1057.077) * [-1040.563] (-1042.131) (-1047.655) (-1038.443) -- 0:03:38
331500 -- (-1040.666) (-1047.005) (-1050.079) [-1045.986] * (-1051.539) [-1039.325] (-1064.065) (-1041.280) -- 0:03:37
332000 -- (-1039.807) (-1047.030) (-1044.831) [-1053.879] * [-1038.988] (-1038.150) (-1041.164) (-1054.411) -- 0:03:37
332500 -- (-1052.059) (-1039.231) (-1044.981) [-1043.753] * (-1033.360) (-1051.119) [-1045.050] (-1047.655) -- 0:03:36
333000 -- (-1054.346) [-1036.420] (-1045.695) (-1049.075) * (-1045.719) (-1042.050) [-1045.733] (-1043.488) -- 0:03:36
333500 -- (-1046.154) (-1055.914) [-1044.761] (-1053.035) * (-1045.650) (-1040.126) (-1053.582) [-1043.298] -- 0:03:37
334000 -- (-1040.047) [-1036.165] (-1045.867) (-1044.614) * (-1053.001) [-1039.752] (-1038.792) (-1035.966) -- 0:03:37
334500 -- (-1052.222) [-1037.251] (-1043.586) (-1039.346) * (-1061.142) (-1043.294) (-1042.401) [-1039.571] -- 0:03:36
335000 -- (-1050.023) [-1040.081] (-1048.908) (-1045.301) * (-1065.064) [-1042.113] (-1046.268) (-1049.593) -- 0:03:36
Average standard deviation of split frequencies: 0.012951
335500 -- [-1048.470] (-1038.435) (-1056.286) (-1048.654) * (-1050.266) (-1045.439) (-1042.746) [-1039.302] -- 0:03:35
336000 -- (-1044.324) (-1040.321) [-1039.317] (-1050.330) * (-1055.241) [-1043.378] (-1049.012) (-1041.223) -- 0:03:37
336500 -- (-1048.907) [-1048.444] (-1040.803) (-1043.303) * (-1044.483) [-1035.981] (-1038.795) (-1041.195) -- 0:03:36
337000 -- (-1035.556) [-1043.973] (-1043.188) (-1047.440) * (-1039.257) [-1037.521] (-1053.486) (-1044.226) -- 0:03:36
337500 -- [-1038.328] (-1039.440) (-1050.853) (-1046.616) * (-1043.081) (-1036.949) (-1053.502) [-1034.275] -- 0:03:35
338000 -- (-1048.685) [-1037.792] (-1044.430) (-1043.758) * (-1065.010) [-1035.014] (-1048.086) (-1044.745) -- 0:03:35
338500 -- (-1050.588) (-1053.292) [-1040.861] (-1059.665) * (-1052.895) [-1044.177] (-1045.411) (-1044.680) -- 0:03:36
339000 -- (-1041.005) (-1042.044) [-1037.834] (-1053.783) * [-1043.056] (-1041.429) (-1051.846) (-1049.770) -- 0:03:36
339500 -- (-1058.500) [-1041.466] (-1044.393) (-1050.339) * (-1038.653) [-1048.653] (-1062.246) (-1043.136) -- 0:03:35
340000 -- [-1038.471] (-1047.215) (-1044.343) (-1048.044) * (-1046.398) (-1040.233) (-1051.424) [-1038.914] -- 0:03:35
Average standard deviation of split frequencies: 0.013625
340500 -- [-1039.630] (-1040.169) (-1046.981) (-1053.817) * (-1054.982) [-1042.550] (-1052.625) (-1035.153) -- 0:03:34
341000 -- (-1046.282) [-1043.622] (-1039.708) (-1049.211) * (-1042.928) (-1053.165) (-1049.850) [-1047.647] -- 0:03:34
341500 -- (-1047.455) [-1037.281] (-1050.594) (-1047.365) * [-1041.735] (-1056.394) (-1041.055) (-1036.682) -- 0:03:34
342000 -- (-1040.823) (-1039.950) [-1049.090] (-1050.293) * (-1040.318) (-1049.525) [-1048.640] (-1054.552) -- 0:03:35
342500 -- [-1035.978] (-1050.411) (-1056.696) (-1049.007) * (-1052.293) [-1043.385] (-1048.445) (-1051.082) -- 0:03:35
343000 -- [-1041.425] (-1046.153) (-1048.930) (-1060.350) * [-1041.082] (-1046.368) (-1052.573) (-1045.378) -- 0:03:34
343500 -- (-1037.395) [-1038.457] (-1049.987) (-1059.588) * [-1042.924] (-1047.654) (-1041.523) (-1041.078) -- 0:03:34
344000 -- [-1039.406] (-1039.408) (-1038.876) (-1050.491) * (-1055.696) (-1045.557) (-1039.164) [-1045.773] -- 0:03:33
344500 -- (-1054.538) (-1053.537) [-1042.480] (-1045.883) * (-1045.447) (-1041.236) [-1045.713] (-1044.716) -- 0:03:33
345000 -- (-1039.757) (-1042.594) (-1054.818) [-1039.375] * [-1038.005] (-1046.412) (-1049.608) (-1045.488) -- 0:03:34
Average standard deviation of split frequencies: 0.013624
345500 -- (-1047.192) (-1041.857) [-1037.100] (-1044.450) * (-1046.285) (-1053.243) (-1050.583) [-1044.005] -- 0:03:34
346000 -- (-1055.197) [-1036.272] (-1045.603) (-1051.520) * [-1044.264] (-1053.156) (-1040.446) (-1037.027) -- 0:03:33
346500 -- (-1043.322) (-1035.705) (-1045.212) [-1042.108] * (-1043.286) (-1052.700) [-1031.425] (-1039.981) -- 0:03:33
347000 -- (-1049.592) (-1044.218) (-1053.890) [-1040.325] * (-1051.906) (-1046.250) [-1032.680] (-1071.246) -- 0:03:32
347500 -- [-1036.641] (-1056.262) (-1033.946) (-1049.925) * [-1047.051] (-1050.866) (-1044.587) (-1047.595) -- 0:03:32
348000 -- (-1038.504) (-1055.298) [-1044.859] (-1045.811) * (-1057.061) (-1054.062) [-1038.912] (-1049.505) -- 0:03:33
348500 -- (-1044.699) [-1048.867] (-1049.363) (-1058.796) * (-1051.611) (-1056.435) (-1036.956) [-1044.495] -- 0:03:33
349000 -- [-1036.354] (-1046.669) (-1067.183) (-1061.490) * (-1046.663) (-1048.571) [-1041.506] (-1043.452) -- 0:03:32
349500 -- [-1039.203] (-1062.583) (-1051.439) (-1038.592) * [-1039.248] (-1070.522) (-1052.841) (-1055.235) -- 0:03:32
350000 -- [-1038.770] (-1058.228) (-1055.817) (-1046.268) * (-1053.219) [-1038.796] (-1047.013) (-1050.320) -- 0:03:33
Average standard deviation of split frequencies: 0.013029
350500 -- (-1044.608) (-1058.364) (-1053.918) [-1042.656] * (-1039.874) (-1043.237) (-1054.684) [-1040.202] -- 0:03:33
351000 -- (-1038.953) [-1038.988] (-1053.492) (-1048.887) * [-1042.394] (-1036.281) (-1034.899) (-1054.609) -- 0:03:32
351500 -- (-1041.406) (-1044.457) (-1041.087) [-1042.759] * (-1043.625) (-1048.271) [-1040.104] (-1046.852) -- 0:03:32
352000 -- (-1040.414) (-1048.291) [-1036.140] (-1047.673) * (-1054.177) [-1042.591] (-1044.777) (-1048.071) -- 0:03:31
352500 -- (-1047.832) (-1044.490) (-1040.992) [-1045.155] * (-1057.524) [-1046.650] (-1043.036) (-1054.985) -- 0:03:31
353000 -- (-1046.611) (-1039.918) [-1038.316] (-1042.178) * (-1053.529) (-1041.943) (-1041.912) [-1039.445] -- 0:03:30
353500 -- [-1035.607] (-1039.689) (-1052.132) (-1052.622) * (-1048.624) (-1043.252) (-1040.283) [-1036.370] -- 0:03:32
354000 -- [-1044.411] (-1048.690) (-1053.355) (-1071.540) * (-1044.606) (-1052.029) (-1053.409) [-1047.073] -- 0:03:31
354500 -- [-1043.721] (-1043.066) (-1059.982) (-1046.972) * [-1036.959] (-1042.850) (-1041.727) (-1043.890) -- 0:03:31
355000 -- (-1058.623) [-1039.380] (-1058.293) (-1040.532) * (-1041.633) [-1045.047] (-1041.460) (-1042.302) -- 0:03:30
Average standard deviation of split frequencies: 0.012631
355500 -- [-1054.789] (-1034.858) (-1059.666) (-1048.121) * (-1038.707) (-1054.233) [-1040.778] (-1040.284) -- 0:03:30
356000 -- (-1048.750) [-1034.008] (-1065.349) (-1038.215) * (-1042.035) (-1042.914) (-1047.213) [-1048.172] -- 0:03:31
356500 -- (-1052.816) (-1037.612) [-1054.563] (-1042.225) * [-1040.004] (-1046.322) (-1048.632) (-1045.591) -- 0:03:31
357000 -- (-1053.973) (-1043.820) (-1052.982) [-1034.363] * [-1043.710] (-1041.811) (-1049.413) (-1038.137) -- 0:03:30
357500 -- [-1041.421] (-1060.603) (-1041.780) (-1052.456) * [-1042.217] (-1034.902) (-1053.949) (-1053.558) -- 0:03:30
358000 -- [-1040.532] (-1056.783) (-1043.718) (-1044.725) * [-1040.511] (-1035.850) (-1045.778) (-1056.004) -- 0:03:29
358500 -- (-1046.934) [-1040.485] (-1044.537) (-1035.609) * [-1036.038] (-1059.090) (-1042.425) (-1048.974) -- 0:03:31
359000 -- [-1040.842] (-1056.861) (-1052.564) (-1039.537) * (-1033.254) (-1033.164) (-1058.127) [-1041.096] -- 0:03:30
359500 -- (-1043.936) (-1043.900) (-1047.345) [-1044.727] * (-1047.057) (-1040.153) [-1042.569] (-1056.113) -- 0:03:30
360000 -- (-1048.282) [-1046.521] (-1044.375) (-1052.320) * (-1035.988) (-1040.403) (-1049.192) [-1037.206] -- 0:03:29
Average standard deviation of split frequencies: 0.011663
360500 -- (-1065.760) (-1044.157) (-1043.504) [-1043.524] * (-1051.874) [-1044.353] (-1046.105) (-1041.088) -- 0:03:29
361000 -- (-1035.454) (-1042.798) [-1033.569] (-1039.454) * (-1045.403) (-1043.824) [-1045.711] (-1048.373) -- 0:03:28
361500 -- (-1051.823) (-1053.979) (-1051.375) [-1040.419] * (-1053.454) [-1042.350] (-1040.791) (-1034.546) -- 0:03:30
362000 -- (-1036.887) (-1045.415) [-1046.265] (-1040.150) * (-1059.420) (-1057.920) (-1050.797) [-1041.696] -- 0:03:29
362500 -- [-1041.301] (-1040.750) (-1061.500) (-1040.032) * [-1046.413] (-1046.354) (-1042.627) (-1040.601) -- 0:03:29
363000 -- (-1041.413) (-1045.912) (-1056.513) [-1039.829] * [-1053.898] (-1043.652) (-1056.706) (-1050.238) -- 0:03:28
363500 -- [-1045.765] (-1057.562) (-1050.202) (-1046.604) * (-1045.356) (-1039.758) [-1046.792] (-1055.537) -- 0:03:28
364000 -- (-1040.535) (-1050.797) (-1047.381) [-1038.500] * (-1049.435) (-1046.116) (-1051.850) [-1041.371] -- 0:03:27
364500 -- (-1044.352) (-1041.811) (-1048.137) [-1041.458] * (-1048.909) (-1047.519) (-1040.596) [-1047.497] -- 0:03:29
365000 -- [-1037.354] (-1052.644) (-1048.624) (-1051.659) * (-1040.725) (-1057.826) (-1043.248) [-1036.323] -- 0:03:28
Average standard deviation of split frequencies: 0.011493
365500 -- [-1042.158] (-1046.123) (-1055.016) (-1050.439) * (-1040.811) (-1053.522) (-1051.692) [-1037.663] -- 0:03:28
366000 -- (-1050.161) (-1047.487) [-1048.819] (-1042.364) * (-1060.956) [-1036.252] (-1048.554) (-1044.093) -- 0:03:27
366500 -- (-1042.363) (-1044.322) (-1049.934) [-1046.121] * (-1043.675) (-1052.875) (-1041.861) [-1042.889] -- 0:03:27
367000 -- (-1041.929) (-1050.516) [-1048.380] (-1054.028) * (-1051.113) [-1057.731] (-1062.544) (-1067.943) -- 0:03:26
367500 -- [-1037.339] (-1040.334) (-1055.041) (-1058.680) * (-1053.733) [-1038.450] (-1038.285) (-1065.113) -- 0:03:28
368000 -- (-1048.166) (-1046.906) (-1048.844) [-1045.456] * (-1054.225) [-1041.818] (-1038.898) (-1064.278) -- 0:03:27
368500 -- (-1044.311) [-1043.674] (-1054.671) (-1048.513) * (-1043.813) (-1042.156) [-1040.605] (-1053.634) -- 0:03:27
369000 -- (-1051.413) (-1045.978) (-1057.367) [-1053.254] * (-1051.557) [-1034.213] (-1042.997) (-1061.936) -- 0:03:26
369500 -- (-1051.781) (-1050.913) (-1059.153) [-1035.175] * (-1043.676) [-1041.511] (-1039.543) (-1045.605) -- 0:03:26
370000 -- (-1047.775) [-1043.463] (-1044.010) (-1046.594) * (-1052.297) [-1045.238] (-1040.083) (-1042.747) -- 0:03:26
Average standard deviation of split frequencies: 0.011055
370500 -- (-1040.818) (-1064.034) [-1041.492] (-1043.072) * (-1067.213) (-1039.618) (-1035.671) [-1044.257] -- 0:03:27
371000 -- (-1043.121) (-1044.129) [-1043.669] (-1043.037) * (-1057.162) (-1047.745) [-1034.550] (-1050.847) -- 0:03:26
371500 -- [-1038.676] (-1054.260) (-1041.626) (-1039.541) * (-1048.146) [-1039.629] (-1057.639) (-1051.096) -- 0:03:26
372000 -- (-1040.896) (-1050.591) [-1046.787] (-1033.845) * (-1054.817) (-1052.715) (-1040.242) [-1036.385] -- 0:03:25
372500 -- (-1056.002) [-1048.367] (-1041.317) (-1049.630) * (-1048.470) (-1056.421) [-1043.531] (-1043.709) -- 0:03:25
373000 -- [-1039.946] (-1038.955) (-1043.670) (-1050.573) * (-1050.830) (-1044.670) (-1054.665) [-1036.450] -- 0:03:25
373500 -- (-1043.828) (-1044.770) (-1031.813) [-1051.239] * [-1047.501] (-1049.391) (-1048.122) (-1047.426) -- 0:03:24
374000 -- (-1045.598) (-1041.151) (-1037.878) [-1041.224] * (-1047.890) (-1052.678) [-1047.587] (-1056.301) -- 0:03:25
374500 -- [-1042.074] (-1050.883) (-1040.113) (-1046.962) * (-1050.194) (-1044.817) [-1040.380] (-1054.346) -- 0:03:25
375000 -- (-1054.725) [-1041.531] (-1046.335) (-1039.598) * (-1059.285) [-1040.132] (-1034.498) (-1043.175) -- 0:03:25
Average standard deviation of split frequencies: 0.010994
375500 -- [-1039.474] (-1058.575) (-1043.518) (-1044.726) * (-1052.123) (-1045.793) [-1040.382] (-1057.032) -- 0:03:24
376000 -- (-1048.487) (-1046.774) (-1044.728) [-1039.159] * [-1034.038] (-1043.821) (-1052.432) (-1050.127) -- 0:03:24
376500 -- (-1039.234) [-1055.314] (-1056.915) (-1048.449) * (-1038.003) (-1039.751) (-1050.315) [-1041.842] -- 0:03:23
377000 -- (-1040.360) [-1049.110] (-1052.989) (-1048.761) * [-1040.452] (-1043.432) (-1044.969) (-1051.556) -- 0:03:24
377500 -- [-1038.274] (-1050.203) (-1052.121) (-1038.535) * (-1051.218) (-1035.155) (-1043.948) [-1055.019] -- 0:03:24
378000 -- (-1046.881) (-1043.180) (-1048.656) [-1034.722] * (-1048.482) [-1040.956] (-1048.447) (-1045.580) -- 0:03:24
378500 -- (-1032.305) [-1040.131] (-1047.638) (-1044.597) * (-1056.542) (-1047.224) [-1038.698] (-1052.177) -- 0:03:23
379000 -- (-1044.849) [-1048.360] (-1038.275) (-1048.701) * (-1053.956) [-1041.749] (-1047.221) (-1048.096) -- 0:03:23
379500 -- (-1047.185) [-1038.956] (-1064.384) (-1045.686) * [-1040.284] (-1046.231) (-1057.840) (-1035.116) -- 0:03:22
380000 -- [-1046.366] (-1039.591) (-1046.025) (-1042.467) * (-1041.432) (-1048.009) [-1040.935] (-1040.300) -- 0:03:23
Average standard deviation of split frequencies: 0.010574
380500 -- (-1056.471) [-1032.453] (-1056.380) (-1046.693) * [-1034.089] (-1058.882) (-1037.911) (-1045.205) -- 0:03:23
381000 -- (-1061.611) [-1043.430] (-1040.085) (-1062.613) * (-1040.578) (-1045.614) [-1035.073] (-1041.267) -- 0:03:23
381500 -- (-1062.545) [-1044.454] (-1037.580) (-1041.118) * (-1046.648) (-1051.584) (-1045.419) [-1036.377] -- 0:03:22
382000 -- (-1049.262) (-1055.764) (-1041.700) [-1043.381] * (-1034.757) (-1046.949) [-1044.358] (-1041.143) -- 0:03:22
382500 -- (-1047.508) (-1051.074) [-1043.694] (-1043.176) * [-1044.811] (-1053.691) (-1053.500) (-1045.986) -- 0:03:23
383000 -- (-1059.453) (-1052.510) [-1046.207] (-1039.190) * [-1037.667] (-1051.159) (-1046.022) (-1041.070) -- 0:03:22
383500 -- (-1048.022) (-1052.447) (-1039.154) [-1047.843] * [-1036.752] (-1071.122) (-1054.460) (-1049.704) -- 0:03:22
384000 -- (-1052.983) (-1042.648) (-1046.103) [-1043.738] * [-1036.941] (-1060.670) (-1047.111) (-1043.630) -- 0:03:22
384500 -- (-1059.179) [-1037.793] (-1042.426) (-1045.318) * (-1048.384) (-1050.219) [-1041.798] (-1045.723) -- 0:03:21
385000 -- (-1049.563) [-1039.091] (-1034.422) (-1039.061) * (-1046.395) (-1051.108) [-1042.919] (-1039.996) -- 0:03:22
Average standard deviation of split frequencies: 0.010240
385500 -- (-1048.367) (-1046.553) [-1040.237] (-1056.790) * (-1036.572) [-1042.524] (-1054.270) (-1046.264) -- 0:03:22
386000 -- (-1053.842) [-1040.140] (-1045.422) (-1045.163) * (-1041.563) (-1040.938) (-1040.199) [-1040.368] -- 0:03:22
386500 -- (-1057.800) (-1042.738) (-1040.419) [-1042.845] * (-1044.866) [-1047.866] (-1047.520) (-1045.555) -- 0:03:21
387000 -- (-1046.835) [-1040.455] (-1040.118) (-1042.890) * [-1038.997] (-1048.869) (-1050.828) (-1051.180) -- 0:03:21
387500 -- (-1067.990) (-1038.424) [-1053.375] (-1050.446) * (-1043.658) (-1047.325) [-1044.120] (-1051.155) -- 0:03:20
388000 -- (-1049.813) [-1041.489] (-1043.428) (-1047.767) * [-1045.490] (-1056.277) (-1040.122) (-1054.812) -- 0:03:21
388500 -- (-1052.902) (-1037.720) [-1041.520] (-1042.183) * (-1041.320) [-1046.385] (-1041.873) (-1045.820) -- 0:03:21
389000 -- (-1052.996) (-1034.174) (-1039.086) [-1036.257] * [-1038.989] (-1055.190) (-1036.053) (-1042.123) -- 0:03:21
389500 -- (-1045.007) (-1047.586) [-1042.375] (-1036.348) * (-1050.613) (-1049.155) (-1042.672) [-1040.856] -- 0:03:20
390000 -- (-1044.283) (-1042.194) (-1038.371) [-1043.342] * (-1048.109) (-1053.766) (-1049.101) [-1040.823] -- 0:03:20
Average standard deviation of split frequencies: 0.009561
390500 -- (-1039.076) (-1041.178) [-1037.653] (-1047.901) * (-1049.612) (-1045.885) (-1045.023) [-1043.744] -- 0:03:19
391000 -- (-1042.712) (-1050.014) (-1036.571) [-1049.839] * (-1038.747) (-1047.282) [-1039.024] (-1040.128) -- 0:03:20
391500 -- [-1036.665] (-1050.578) (-1045.934) (-1045.021) * [-1039.879] (-1043.107) (-1038.318) (-1046.032) -- 0:03:20
392000 -- (-1047.447) [-1042.053] (-1043.280) (-1051.245) * (-1043.275) (-1042.158) (-1043.301) [-1045.302] -- 0:03:20
392500 -- (-1039.960) (-1040.219) [-1043.043] (-1039.705) * (-1041.542) (-1046.903) (-1043.504) [-1042.559] -- 0:03:19
393000 -- (-1042.855) [-1039.167] (-1034.782) (-1045.931) * (-1039.037) (-1046.971) [-1040.438] (-1059.285) -- 0:03:19
393500 -- [-1039.280] (-1040.821) (-1045.049) (-1042.995) * [-1042.296] (-1050.769) (-1038.719) (-1036.033) -- 0:03:18
394000 -- (-1052.537) (-1037.206) [-1040.252] (-1045.544) * (-1062.479) [-1043.219] (-1039.917) (-1052.179) -- 0:03:19
394500 -- (-1053.161) (-1059.448) (-1038.596) [-1046.620] * (-1045.826) (-1052.789) (-1046.514) [-1045.071] -- 0:03:19
395000 -- (-1054.824) [-1040.851] (-1041.334) (-1045.081) * [-1046.808] (-1041.330) (-1048.413) (-1054.793) -- 0:03:19
Average standard deviation of split frequencies: 0.009798
395500 -- (-1047.397) (-1051.121) (-1038.912) [-1041.400] * (-1042.847) [-1037.263] (-1042.668) (-1053.825) -- 0:03:18
396000 -- (-1060.975) (-1051.014) (-1035.742) [-1044.499] * (-1049.930) (-1042.885) [-1046.356] (-1053.671) -- 0:03:18
396500 -- (-1056.958) [-1043.502] (-1039.765) (-1050.856) * (-1046.305) (-1042.868) (-1051.985) [-1049.824] -- 0:03:17
397000 -- (-1052.377) [-1043.104] (-1037.786) (-1040.026) * [-1046.239] (-1038.306) (-1038.496) (-1054.721) -- 0:03:18
397500 -- (-1045.930) (-1042.094) (-1046.021) [-1036.792] * [-1036.395] (-1037.912) (-1045.614) (-1055.581) -- 0:03:18
398000 -- (-1054.285) (-1049.063) (-1043.465) [-1034.693] * [-1041.233] (-1054.348) (-1048.504) (-1039.706) -- 0:03:18
398500 -- (-1050.423) (-1041.914) [-1041.489] (-1046.996) * [-1037.734] (-1036.867) (-1041.075) (-1043.568) -- 0:03:17
399000 -- [-1037.296] (-1052.505) (-1046.036) (-1059.284) * (-1055.651) [-1041.773] (-1040.764) (-1049.635) -- 0:03:17
399500 -- [-1040.587] (-1061.047) (-1044.493) (-1052.424) * (-1036.304) (-1035.084) [-1048.886] (-1058.306) -- 0:03:16
400000 -- [-1032.782] (-1059.423) (-1042.976) (-1046.228) * [-1041.210] (-1049.354) (-1047.190) (-1048.983) -- 0:03:18
Average standard deviation of split frequencies: 0.010317
400500 -- (-1044.237) [-1044.513] (-1043.829) (-1043.342) * (-1045.797) [-1048.672] (-1046.657) (-1040.961) -- 0:03:17
401000 -- (-1046.155) [-1046.099] (-1043.283) (-1050.311) * (-1044.152) (-1056.102) (-1042.862) [-1043.758] -- 0:03:17
401500 -- [-1040.657] (-1045.113) (-1050.562) (-1043.488) * (-1042.551) (-1055.867) [-1041.039] (-1043.135) -- 0:03:16
402000 -- [-1052.194] (-1038.822) (-1047.292) (-1045.525) * (-1050.401) (-1054.280) (-1055.056) [-1043.109] -- 0:03:16
402500 -- (-1052.110) [-1042.718] (-1036.667) (-1038.792) * (-1060.014) (-1045.221) (-1059.490) [-1035.230] -- 0:03:15
403000 -- (-1047.309) (-1043.681) (-1042.757) [-1043.009] * (-1042.970) (-1054.951) (-1039.432) [-1040.837] -- 0:03:17
403500 -- [-1038.778] (-1045.307) (-1044.853) (-1043.267) * (-1054.982) (-1056.090) (-1037.541) [-1038.562] -- 0:03:16
404000 -- (-1038.921) (-1038.814) (-1052.987) [-1038.272] * (-1037.228) (-1049.461) [-1039.697] (-1053.601) -- 0:03:16
404500 -- [-1044.844] (-1046.938) (-1038.476) (-1041.444) * [-1043.975] (-1040.138) (-1044.605) (-1052.077) -- 0:03:15
405000 -- [-1036.976] (-1036.559) (-1047.737) (-1042.767) * (-1046.932) [-1045.640] (-1041.128) (-1038.397) -- 0:03:15
Average standard deviation of split frequencies: 0.009735
405500 -- (-1049.242) [-1042.273] (-1044.257) (-1046.999) * (-1043.673) (-1047.163) [-1044.134] (-1053.825) -- 0:03:16
406000 -- (-1045.357) [-1040.427] (-1053.001) (-1051.195) * (-1040.125) (-1044.002) [-1041.792] (-1045.644) -- 0:03:16
406500 -- [-1034.821] (-1036.396) (-1043.720) (-1046.800) * (-1044.815) [-1053.333] (-1051.255) (-1077.175) -- 0:03:15
407000 -- (-1043.888) (-1039.250) (-1049.442) [-1042.516] * (-1057.840) [-1035.727] (-1041.185) (-1039.401) -- 0:03:15
407500 -- (-1042.361) (-1041.443) [-1042.282] (-1043.839) * (-1042.141) [-1037.972] (-1041.094) (-1048.165) -- 0:03:14
408000 -- (-1058.454) (-1056.453) [-1039.812] (-1045.804) * (-1040.130) (-1050.129) (-1046.154) [-1039.830] -- 0:03:14
408500 -- [-1038.881] (-1049.628) (-1041.524) (-1048.063) * (-1051.803) (-1050.146) [-1042.387] (-1058.370) -- 0:03:14
409000 -- (-1041.684) [-1048.483] (-1052.351) (-1040.195) * (-1036.829) (-1051.576) (-1051.952) [-1043.172] -- 0:03:15
409500 -- (-1047.584) (-1035.489) [-1038.995] (-1044.456) * (-1041.421) (-1049.198) (-1049.890) [-1038.516] -- 0:03:14
410000 -- (-1040.575) (-1049.521) (-1044.763) [-1043.339] * (-1042.344) (-1055.857) (-1046.859) [-1038.500] -- 0:03:14
Average standard deviation of split frequencies: 0.010066
410500 -- (-1041.980) (-1050.649) [-1040.203] (-1041.506) * (-1042.471) (-1052.694) (-1052.896) [-1041.127] -- 0:03:13
411000 -- (-1058.083) [-1043.241] (-1046.217) (-1045.800) * (-1035.308) (-1046.110) (-1044.953) [-1042.270] -- 0:03:13
411500 -- [-1053.038] (-1047.280) (-1046.288) (-1047.565) * (-1046.530) [-1041.851] (-1052.142) (-1042.740) -- 0:03:13
412000 -- [-1038.118] (-1058.532) (-1041.216) (-1059.476) * [-1037.304] (-1055.851) (-1055.942) (-1039.251) -- 0:03:14
412500 -- (-1044.743) [-1054.283] (-1036.429) (-1054.930) * [-1041.939] (-1048.715) (-1043.898) (-1055.864) -- 0:03:13
413000 -- (-1038.276) (-1046.723) (-1037.843) [-1046.201] * (-1047.434) [-1045.766] (-1055.694) (-1045.161) -- 0:03:13
413500 -- (-1035.507) (-1048.661) [-1038.939] (-1054.779) * (-1053.858) (-1048.824) (-1044.052) [-1043.974] -- 0:03:12
414000 -- (-1049.544) (-1038.828) (-1055.927) [-1043.418] * (-1057.517) (-1051.724) [-1039.967] (-1045.754) -- 0:03:12
414500 -- [-1035.575] (-1047.514) (-1039.612) (-1039.120) * (-1051.147) (-1043.934) (-1051.379) [-1035.702] -- 0:03:12
415000 -- (-1039.588) (-1043.070) [-1054.896] (-1042.695) * (-1044.436) [-1045.162] (-1040.309) (-1047.287) -- 0:03:13
Average standard deviation of split frequencies: 0.011158
415500 -- [-1044.357] (-1042.152) (-1049.096) (-1049.439) * (-1059.313) (-1052.613) [-1038.666] (-1055.256) -- 0:03:12
416000 -- [-1048.315] (-1041.906) (-1040.903) (-1052.804) * (-1055.154) [-1037.195] (-1036.765) (-1049.016) -- 0:03:12
416500 -- [-1034.492] (-1050.553) (-1050.220) (-1039.911) * (-1051.950) (-1038.466) [-1036.602] (-1046.454) -- 0:03:11
417000 -- (-1047.566) [-1034.326] (-1044.581) (-1052.281) * (-1045.359) [-1039.250] (-1046.676) (-1045.995) -- 0:03:11
417500 -- (-1037.811) [-1042.577] (-1053.737) (-1038.542) * (-1045.992) [-1043.603] (-1039.377) (-1030.159) -- 0:03:11
418000 -- (-1053.720) (-1050.660) (-1048.216) [-1037.277] * (-1046.380) (-1051.711) [-1041.869] (-1047.065) -- 0:03:12
418500 -- (-1055.037) [-1039.993] (-1046.428) (-1042.594) * (-1048.994) [-1045.558] (-1049.172) (-1040.118) -- 0:03:11
419000 -- (-1043.004) (-1042.167) [-1038.308] (-1050.270) * (-1050.869) (-1043.485) (-1053.747) [-1040.056] -- 0:03:11
419500 -- (-1044.090) (-1048.701) [-1046.650] (-1045.229) * (-1043.546) [-1044.010] (-1039.198) (-1052.430) -- 0:03:10
420000 -- (-1067.613) (-1043.452) (-1033.643) [-1040.981] * [-1039.157] (-1046.132) (-1041.565) (-1041.687) -- 0:03:10
Average standard deviation of split frequencies: 0.010172
420500 -- (-1058.090) [-1047.431] (-1035.301) (-1046.321) * (-1032.244) (-1053.686) [-1036.803] (-1049.312) -- 0:03:10
421000 -- (-1050.434) (-1042.974) [-1049.279] (-1053.824) * (-1055.187) (-1064.571) (-1046.359) [-1045.187] -- 0:03:11
421500 -- (-1053.454) [-1036.554] (-1051.442) (-1048.159) * (-1061.211) (-1047.015) (-1037.742) [-1041.798] -- 0:03:10
422000 -- (-1036.208) (-1039.043) [-1039.918] (-1048.887) * [-1039.725] (-1042.265) (-1040.757) (-1050.157) -- 0:03:10
422500 -- (-1046.795) (-1051.714) [-1048.961] (-1057.670) * [-1043.303] (-1039.290) (-1049.883) (-1053.051) -- 0:03:09
423000 -- (-1060.336) (-1032.351) (-1043.905) [-1044.268] * (-1041.903) [-1039.943] (-1044.545) (-1045.135) -- 0:03:09
423500 -- (-1049.733) (-1039.511) (-1042.247) [-1044.717] * (-1058.649) (-1036.594) (-1034.964) [-1054.083] -- 0:03:09
424000 -- (-1041.650) (-1041.985) [-1046.237] (-1053.206) * (-1037.925) [-1040.207] (-1035.291) (-1055.969) -- 0:03:08
424500 -- (-1043.095) [-1037.634] (-1040.333) (-1044.781) * (-1039.720) (-1038.115) [-1041.522] (-1052.135) -- 0:03:09
425000 -- (-1045.155) (-1063.907) [-1047.908] (-1053.838) * (-1045.698) (-1054.577) (-1047.779) [-1050.691] -- 0:03:09
Average standard deviation of split frequencies: 0.010385
425500 -- (-1043.359) (-1042.642) (-1052.037) [-1037.594] * (-1042.998) [-1047.638] (-1044.776) (-1051.226) -- 0:03:09
426000 -- (-1042.737) (-1059.091) [-1039.852] (-1051.020) * (-1051.661) (-1051.497) (-1052.083) [-1037.478] -- 0:03:08
426500 -- [-1045.936] (-1043.398) (-1058.961) (-1043.256) * (-1043.984) [-1041.551] (-1043.079) (-1048.905) -- 0:03:08
427000 -- (-1041.649) [-1039.200] (-1054.161) (-1038.229) * (-1038.726) [-1050.803] (-1044.601) (-1039.357) -- 0:03:07
427500 -- (-1043.478) [-1045.861] (-1053.450) (-1049.318) * [-1047.194] (-1052.594) (-1040.948) (-1050.662) -- 0:03:08
428000 -- (-1038.336) [-1037.679] (-1047.615) (-1040.954) * (-1053.501) [-1035.724] (-1045.017) (-1050.088) -- 0:03:08
428500 -- (-1038.949) (-1043.303) (-1056.420) [-1042.396] * (-1050.271) [-1035.545] (-1048.931) (-1045.361) -- 0:03:08
429000 -- [-1051.193] (-1043.115) (-1050.894) (-1060.780) * (-1045.359) [-1036.275] (-1041.809) (-1047.301) -- 0:03:07
429500 -- (-1055.990) (-1049.861) [-1041.644] (-1043.215) * (-1040.956) (-1047.337) [-1039.343] (-1051.312) -- 0:03:07
430000 -- (-1048.018) (-1046.241) (-1049.959) [-1041.870] * (-1034.115) (-1049.984) (-1044.861) [-1043.842] -- 0:03:06
Average standard deviation of split frequencies: 0.009515
430500 -- (-1048.003) (-1051.157) (-1043.156) [-1047.906] * [-1030.805] (-1040.411) (-1046.650) (-1039.883) -- 0:03:07
431000 -- (-1041.978) (-1048.864) [-1041.695] (-1032.915) * [-1040.409] (-1045.079) (-1047.130) (-1053.479) -- 0:03:07
431500 -- (-1052.607) [-1040.339] (-1040.753) (-1043.300) * [-1040.251] (-1067.685) (-1044.486) (-1054.271) -- 0:03:07
432000 -- [-1045.858] (-1052.818) (-1041.670) (-1069.657) * (-1045.163) (-1054.043) (-1046.015) [-1036.874] -- 0:03:06
432500 -- [-1040.079] (-1043.762) (-1044.643) (-1040.122) * (-1049.350) (-1054.389) (-1038.240) [-1043.270] -- 0:03:06
433000 -- (-1050.068) [-1044.987] (-1044.219) (-1045.164) * [-1055.745] (-1050.185) (-1044.616) (-1041.730) -- 0:03:07
433500 -- (-1043.033) [-1042.683] (-1042.903) (-1051.480) * (-1048.835) (-1044.562) (-1052.639) [-1039.397] -- 0:03:06
434000 -- (-1052.908) (-1039.435) (-1048.590) [-1046.484] * (-1055.246) [-1042.453] (-1055.081) (-1039.202) -- 0:03:06
434500 -- [-1046.487] (-1043.690) (-1050.752) (-1037.251) * [-1044.364] (-1054.811) (-1045.647) (-1033.611) -- 0:03:06
435000 -- (-1041.781) (-1042.578) [-1042.790] (-1036.860) * [-1039.838] (-1045.595) (-1036.627) (-1047.581) -- 0:03:05
Average standard deviation of split frequencies: 0.009315
435500 -- (-1055.339) [-1047.532] (-1064.577) (-1037.727) * (-1045.362) (-1046.047) (-1044.618) [-1044.692] -- 0:03:05
436000 -- (-1060.806) [-1043.991] (-1040.253) (-1040.973) * [-1040.330] (-1050.109) (-1044.932) (-1040.939) -- 0:03:06
436500 -- (-1047.785) (-1046.738) [-1038.526] (-1042.466) * [-1033.935] (-1047.480) (-1053.758) (-1051.063) -- 0:03:05
437000 -- [-1047.343] (-1049.131) (-1051.405) (-1066.420) * [-1040.684] (-1044.457) (-1035.847) (-1060.923) -- 0:03:05
437500 -- (-1044.810) [-1053.257] (-1050.055) (-1052.031) * (-1036.478) [-1054.629] (-1047.417) (-1048.872) -- 0:03:05
438000 -- (-1050.499) (-1052.979) [-1041.347] (-1043.569) * (-1042.374) (-1054.287) [-1042.915] (-1051.536) -- 0:03:04
438500 -- (-1046.815) (-1039.549) [-1038.933] (-1053.278) * (-1041.901) (-1046.001) (-1045.947) [-1046.462] -- 0:03:04
439000 -- (-1039.354) (-1046.950) (-1051.981) [-1049.292] * (-1034.131) (-1061.609) [-1038.973] (-1036.916) -- 0:03:05
439500 -- (-1055.533) (-1052.569) [-1042.152] (-1037.831) * (-1040.564) [-1047.138] (-1049.720) (-1048.076) -- 0:03:04
440000 -- (-1060.372) [-1052.253] (-1044.470) (-1043.392) * (-1034.317) [-1037.701] (-1049.500) (-1050.779) -- 0:03:04
Average standard deviation of split frequencies: 0.008393
440500 -- [-1040.563] (-1035.621) (-1058.409) (-1039.912) * [-1044.520] (-1054.322) (-1043.331) (-1069.597) -- 0:03:04
441000 -- (-1044.526) [-1044.829] (-1045.061) (-1049.570) * (-1044.574) (-1047.859) [-1037.353] (-1056.317) -- 0:03:03
441500 -- (-1051.435) [-1042.611] (-1035.439) (-1041.757) * (-1051.427) [-1045.065] (-1047.779) (-1038.925) -- 0:03:03
442000 -- [-1039.942] (-1037.675) (-1046.864) (-1046.611) * (-1037.101) (-1045.331) (-1046.901) [-1041.258] -- 0:03:04
442500 -- (-1052.322) [-1041.770] (-1039.628) (-1049.663) * (-1040.397) (-1052.947) [-1043.369] (-1039.266) -- 0:03:03
443000 -- (-1045.512) (-1045.452) [-1046.712] (-1052.387) * (-1044.826) [-1041.789] (-1051.732) (-1036.682) -- 0:03:03
443500 -- (-1038.928) (-1045.242) [-1035.832] (-1038.594) * [-1042.929] (-1044.737) (-1060.828) (-1033.758) -- 0:03:03
444000 -- [-1039.998] (-1060.477) (-1042.888) (-1049.578) * [-1040.874] (-1051.172) (-1047.889) (-1036.767) -- 0:03:02
444500 -- (-1047.263) (-1050.947) [-1037.419] (-1052.699) * (-1055.219) (-1059.803) (-1044.808) [-1035.831] -- 0:03:02
445000 -- (-1050.658) (-1049.669) [-1045.118] (-1045.998) * (-1044.135) [-1036.510] (-1058.896) (-1042.703) -- 0:03:03
Average standard deviation of split frequencies: 0.008212
445500 -- (-1061.184) (-1046.672) [-1043.243] (-1063.933) * (-1039.521) (-1045.450) [-1043.270] (-1048.092) -- 0:03:02
446000 -- (-1046.806) [-1034.123] (-1047.586) (-1045.363) * [-1043.845] (-1053.829) (-1034.939) (-1047.843) -- 0:03:02
446500 -- (-1053.752) (-1040.371) [-1048.064] (-1043.048) * (-1048.346) (-1047.129) [-1039.834] (-1055.608) -- 0:03:02
447000 -- (-1062.256) [-1035.439] (-1045.936) (-1050.644) * (-1053.376) (-1046.267) (-1040.806) [-1042.562] -- 0:03:01
447500 -- (-1059.475) [-1035.804] (-1055.681) (-1052.159) * (-1045.771) [-1036.897] (-1045.770) (-1051.743) -- 0:03:01
448000 -- (-1047.548) (-1045.092) (-1051.440) [-1039.155] * (-1046.246) (-1040.300) (-1041.002) [-1038.409] -- 0:03:01
448500 -- (-1047.440) (-1056.966) (-1060.089) [-1037.521] * (-1054.529) (-1041.393) [-1042.384] (-1047.127) -- 0:03:01
449000 -- (-1055.625) (-1045.016) (-1043.465) [-1035.020] * (-1042.424) [-1039.685] (-1040.409) (-1043.391) -- 0:03:01
449500 -- (-1054.167) (-1059.418) (-1047.886) [-1043.182] * (-1043.813) (-1043.189) (-1040.448) [-1045.021] -- 0:03:01
450000 -- (-1053.204) [-1040.286] (-1047.583) (-1035.727) * (-1048.466) (-1058.593) [-1048.803] (-1045.811) -- 0:03:00
Average standard deviation of split frequencies: 0.007161
450500 -- (-1052.016) (-1039.171) [-1047.621] (-1052.585) * (-1041.732) (-1043.807) [-1043.810] (-1048.754) -- 0:03:00
451000 -- (-1039.596) (-1047.135) [-1049.283] (-1041.936) * (-1052.754) [-1038.632] (-1038.356) (-1046.489) -- 0:03:00
451500 -- (-1048.109) (-1044.432) [-1046.809] (-1038.413) * (-1045.193) (-1044.626) [-1043.586] (-1041.243) -- 0:03:01
452000 -- (-1056.497) (-1045.202) (-1054.843) [-1042.028] * [-1041.610] (-1044.116) (-1040.729) (-1044.743) -- 0:03:00
452500 -- [-1046.309] (-1050.511) (-1048.558) (-1046.305) * [-1045.727] (-1050.250) (-1041.623) (-1041.643) -- 0:03:00
453000 -- (-1039.765) [-1042.166] (-1040.398) (-1053.151) * (-1060.154) [-1039.180] (-1041.667) (-1035.839) -- 0:02:59
453500 -- (-1043.036) (-1047.180) [-1038.315] (-1047.720) * (-1045.185) (-1045.743) [-1045.347] (-1045.792) -- 0:02:59
454000 -- [-1037.316] (-1048.183) (-1067.136) (-1042.749) * (-1037.459) [-1038.455] (-1040.853) (-1043.473) -- 0:02:59
454500 -- (-1043.017) (-1045.014) (-1048.939) [-1051.060] * (-1041.258) [-1052.971] (-1044.349) (-1053.970) -- 0:03:00
455000 -- (-1053.275) (-1043.993) (-1055.086) [-1041.166] * (-1038.785) (-1054.054) (-1047.894) [-1043.448] -- 0:02:59
Average standard deviation of split frequencies: 0.006998
455500 -- [-1035.583] (-1048.745) (-1041.970) (-1045.507) * (-1050.907) (-1046.592) (-1044.061) [-1047.825] -- 0:02:59
456000 -- (-1039.799) (-1041.738) (-1040.759) [-1050.984] * (-1038.318) (-1049.669) (-1042.425) [-1040.036] -- 0:02:58
456500 -- (-1051.001) (-1047.951) (-1040.870) [-1032.036] * [-1042.435] (-1047.338) (-1043.803) (-1048.980) -- 0:02:58
457000 -- (-1040.139) (-1051.255) (-1044.893) [-1045.429] * [-1041.782] (-1041.949) (-1054.156) (-1047.554) -- 0:02:58
457500 -- [-1033.001] (-1041.522) (-1039.754) (-1042.148) * (-1041.216) [-1045.530] (-1044.764) (-1049.184) -- 0:02:59
458000 -- [-1048.466] (-1053.653) (-1045.654) (-1038.933) * [-1040.593] (-1056.540) (-1048.334) (-1056.021) -- 0:02:58
458500 -- (-1057.399) (-1052.389) (-1042.534) [-1040.382] * (-1043.198) [-1043.259] (-1042.662) (-1039.985) -- 0:02:58
459000 -- (-1044.225) [-1042.120] (-1053.093) (-1046.027) * [-1038.028] (-1041.197) (-1043.592) (-1038.954) -- 0:02:57
459500 -- [-1040.883] (-1040.568) (-1048.464) (-1043.781) * (-1040.642) (-1060.617) [-1045.102] (-1038.688) -- 0:02:57
460000 -- [-1033.940] (-1039.538) (-1058.711) (-1047.660) * [-1037.291] (-1061.017) (-1044.974) (-1049.264) -- 0:02:57
Average standard deviation of split frequencies: 0.007006
460500 -- (-1069.043) (-1038.258) (-1053.986) [-1036.881] * [-1038.683] (-1046.433) (-1043.937) (-1052.455) -- 0:02:58
461000 -- (-1044.356) (-1036.346) (-1052.172) [-1041.251] * (-1048.720) (-1044.928) [-1038.968] (-1038.568) -- 0:02:57
461500 -- (-1041.666) (-1044.831) (-1044.575) [-1039.057] * (-1036.876) (-1048.979) (-1040.367) [-1038.563] -- 0:02:57
462000 -- [-1033.134] (-1043.226) (-1044.944) (-1038.951) * (-1042.710) (-1057.985) [-1043.316] (-1041.804) -- 0:02:57
462500 -- (-1044.593) (-1035.924) (-1045.374) [-1035.443] * [-1043.867] (-1046.455) (-1070.114) (-1040.415) -- 0:02:56
463000 -- (-1045.136) (-1039.779) [-1046.184] (-1038.392) * (-1039.755) (-1034.052) (-1041.874) [-1041.687] -- 0:02:56
463500 -- [-1047.618] (-1062.875) (-1054.168) (-1048.086) * (-1040.846) (-1043.460) (-1054.767) [-1049.922] -- 0:02:55
464000 -- (-1053.369) (-1050.765) (-1050.640) [-1041.681] * (-1046.379) [-1048.413] (-1043.833) (-1054.528) -- 0:02:56
464500 -- (-1041.054) (-1050.384) [-1049.159] (-1046.945) * (-1038.769) [-1036.651] (-1045.307) (-1053.181) -- 0:02:56
465000 -- [-1041.932] (-1052.452) (-1054.435) (-1051.057) * (-1049.874) (-1040.633) [-1044.445] (-1048.908) -- 0:02:56
Average standard deviation of split frequencies: 0.008015
465500 -- (-1057.053) [-1046.253] (-1039.819) (-1048.094) * (-1033.121) (-1052.613) (-1043.836) [-1041.003] -- 0:02:55
466000 -- (-1043.698) [-1047.779] (-1050.559) (-1058.344) * [-1044.429] (-1045.380) (-1040.683) (-1048.871) -- 0:02:55
466500 -- [-1047.591] (-1048.959) (-1049.918) (-1044.950) * [-1044.957] (-1035.737) (-1046.026) (-1058.746) -- 0:02:54
467000 -- (-1051.546) [-1043.706] (-1055.467) (-1057.205) * (-1046.117) (-1059.321) (-1042.685) [-1051.240] -- 0:02:55
467500 -- (-1044.170) (-1047.417) (-1048.564) [-1056.848] * (-1049.888) (-1060.464) (-1045.505) [-1046.542] -- 0:02:55
468000 -- (-1049.557) [-1047.583] (-1046.086) (-1058.274) * (-1039.511) [-1043.624] (-1041.197) (-1061.479) -- 0:02:55
468500 -- (-1051.129) (-1044.523) [-1037.461] (-1050.393) * (-1038.611) (-1051.672) [-1045.948] (-1054.826) -- 0:02:54
469000 -- (-1053.572) (-1047.987) [-1046.066] (-1042.190) * [-1037.716] (-1039.850) (-1042.127) (-1049.796) -- 0:02:54
469500 -- (-1045.280) (-1047.946) [-1037.897] (-1042.657) * (-1040.565) (-1047.561) [-1041.526] (-1038.554) -- 0:02:54
470000 -- (-1049.175) [-1047.031] (-1041.288) (-1050.815) * (-1034.682) (-1052.178) (-1044.834) [-1041.997] -- 0:02:54
Average standard deviation of split frequencies: 0.008321
470500 -- (-1049.397) (-1048.548) [-1044.159] (-1052.345) * (-1037.476) (-1053.840) [-1043.257] (-1050.522) -- 0:02:54
471000 -- (-1053.933) [-1038.888] (-1048.068) (-1043.011) * (-1039.858) (-1062.840) [-1032.986] (-1044.403) -- 0:02:54
471500 -- (-1048.912) (-1043.362) [-1039.593] (-1047.564) * (-1041.440) [-1042.292] (-1041.997) (-1041.570) -- 0:02:53
472000 -- (-1045.252) (-1040.363) [-1044.794] (-1047.420) * [-1040.507] (-1043.642) (-1042.838) (-1044.032) -- 0:02:53
472500 -- [-1031.042] (-1047.833) (-1044.427) (-1059.281) * [-1038.268] (-1056.148) (-1044.632) (-1049.477) -- 0:02:53
473000 -- [-1037.691] (-1050.060) (-1035.505) (-1044.608) * [-1039.961] (-1046.080) (-1042.242) (-1046.952) -- 0:02:53
473500 -- [-1043.898] (-1048.783) (-1057.878) (-1058.232) * [-1042.072] (-1049.589) (-1055.418) (-1050.943) -- 0:02:53
474000 -- (-1044.151) (-1037.936) [-1036.271] (-1041.631) * (-1037.214) (-1040.887) [-1032.996] (-1044.761) -- 0:02:53
474500 -- (-1059.495) (-1038.478) [-1041.199] (-1037.705) * [-1033.045] (-1039.893) (-1058.282) (-1046.218) -- 0:02:52
475000 -- (-1039.323) [-1034.909] (-1042.730) (-1055.645) * [-1048.624] (-1045.015) (-1052.684) (-1051.488) -- 0:02:52
Average standard deviation of split frequencies: 0.008151
475500 -- (-1040.959) (-1048.229) (-1046.904) [-1037.333] * (-1038.926) (-1036.347) [-1044.143] (-1043.774) -- 0:02:52
476000 -- (-1044.533) (-1063.720) (-1045.889) [-1042.528] * (-1057.545) (-1042.463) [-1037.267] (-1045.196) -- 0:02:52
476500 -- (-1042.368) (-1055.930) (-1040.555) [-1042.250] * (-1047.084) (-1059.981) (-1048.998) [-1036.507] -- 0:02:52
477000 -- (-1038.154) (-1047.900) (-1046.020) [-1038.870] * [-1039.291] (-1041.677) (-1057.126) (-1041.275) -- 0:02:52
477500 -- (-1049.191) (-1050.004) [-1041.161] (-1049.300) * (-1044.298) (-1046.511) (-1048.618) [-1039.264] -- 0:02:51
478000 -- (-1045.803) [-1035.208] (-1043.553) (-1047.168) * [-1039.967] (-1050.179) (-1044.721) (-1044.815) -- 0:02:51
478500 -- (-1052.790) [-1035.520] (-1043.927) (-1052.160) * (-1038.445) (-1038.908) (-1044.644) [-1043.166] -- 0:02:51
479000 -- (-1039.287) [-1039.017] (-1045.486) (-1038.885) * (-1050.775) (-1038.288) (-1051.759) [-1040.964] -- 0:02:50
479500 -- (-1058.792) (-1043.069) (-1045.598) [-1038.595] * [-1044.655] (-1037.919) (-1062.567) (-1046.497) -- 0:02:51
480000 -- (-1042.417) (-1064.096) (-1039.335) [-1043.784] * (-1043.050) (-1041.170) (-1057.989) [-1034.728] -- 0:02:51
Average standard deviation of split frequencies: 0.008902
480500 -- (-1047.935) (-1049.327) [-1042.275] (-1041.075) * (-1053.173) (-1049.745) (-1040.805) [-1039.930] -- 0:02:50
481000 -- (-1041.979) (-1049.332) [-1044.147] (-1047.690) * (-1041.291) (-1036.292) (-1047.849) [-1042.561] -- 0:02:50
481500 -- [-1037.312] (-1042.486) (-1058.525) (-1047.136) * (-1042.162) [-1033.439] (-1046.383) (-1047.710) -- 0:02:50
482000 -- [-1043.900] (-1034.418) (-1054.278) (-1051.612) * [-1043.142] (-1041.868) (-1058.941) (-1042.508) -- 0:02:49
482500 -- (-1035.713) (-1041.881) (-1051.948) [-1045.885] * (-1043.451) (-1057.329) (-1052.095) [-1044.169] -- 0:02:50
483000 -- (-1049.607) [-1038.330] (-1044.778) (-1056.396) * (-1039.785) (-1057.917) (-1046.208) [-1049.156] -- 0:02:50
483500 -- [-1046.304] (-1043.109) (-1050.823) (-1042.369) * (-1055.241) (-1043.672) (-1039.647) [-1037.440] -- 0:02:49
484000 -- (-1050.806) [-1043.800] (-1035.389) (-1042.677) * (-1036.192) (-1057.112) (-1039.617) [-1047.807] -- 0:02:49
484500 -- (-1051.650) (-1057.374) [-1044.631] (-1046.676) * (-1043.791) (-1049.912) (-1040.156) [-1039.932] -- 0:02:49
485000 -- (-1040.686) (-1050.785) [-1032.665] (-1059.395) * [-1047.935] (-1039.614) (-1040.873) (-1043.050) -- 0:02:48
Average standard deviation of split frequencies: 0.008431
485500 -- (-1042.019) (-1056.224) (-1048.182) [-1047.469] * (-1051.046) [-1049.770] (-1047.985) (-1045.134) -- 0:02:49
486000 -- (-1046.389) [-1041.057] (-1034.090) (-1041.603) * [-1042.545] (-1043.560) (-1041.840) (-1050.881) -- 0:02:49
486500 -- [-1039.574] (-1052.001) (-1040.165) (-1049.839) * (-1039.572) (-1050.423) (-1043.624) [-1042.574] -- 0:02:48
487000 -- (-1040.253) (-1058.929) [-1048.773] (-1048.830) * (-1050.973) (-1041.847) [-1047.931] (-1045.604) -- 0:02:48
487500 -- (-1053.234) [-1042.096] (-1043.022) (-1049.395) * [-1046.977] (-1039.081) (-1041.332) (-1041.199) -- 0:02:48
488000 -- (-1041.909) (-1043.291) (-1049.581) [-1037.721] * (-1042.264) (-1040.889) [-1053.426] (-1040.051) -- 0:02:47
488500 -- [-1038.823] (-1042.020) (-1048.407) (-1042.889) * (-1042.211) (-1051.028) (-1048.742) [-1047.337] -- 0:02:48
489000 -- (-1043.665) (-1047.648) [-1035.890] (-1037.831) * [-1042.672] (-1047.208) (-1054.929) (-1044.273) -- 0:02:48
489500 -- (-1037.613) [-1036.659] (-1041.575) (-1056.259) * (-1050.744) (-1046.417) (-1048.266) [-1041.471] -- 0:02:47
490000 -- [-1033.284] (-1042.162) (-1041.491) (-1053.475) * (-1047.670) (-1042.835) (-1047.107) [-1043.071] -- 0:02:47
Average standard deviation of split frequencies: 0.008055
490500 -- (-1047.821) (-1042.704) (-1058.969) [-1035.568] * (-1058.805) [-1036.584] (-1044.051) (-1042.687) -- 0:02:47
491000 -- [-1034.123] (-1042.867) (-1051.099) (-1049.224) * (-1049.907) (-1044.830) (-1055.784) [-1040.510] -- 0:02:46
491500 -- (-1054.184) (-1044.113) (-1040.945) [-1044.495] * (-1056.386) (-1040.604) (-1045.170) [-1035.194] -- 0:02:46
492000 -- (-1049.148) [-1039.037] (-1040.574) (-1040.070) * (-1050.669) (-1052.403) [-1042.198] (-1050.428) -- 0:02:47
492500 -- [-1041.403] (-1045.297) (-1060.457) (-1048.971) * (-1045.715) (-1041.114) (-1044.113) [-1037.606] -- 0:02:46
493000 -- [-1034.564] (-1050.818) (-1038.485) (-1041.738) * (-1065.443) (-1041.266) [-1038.412] (-1051.760) -- 0:02:46
493500 -- [-1045.616] (-1042.598) (-1050.434) (-1044.146) * [-1046.108] (-1048.773) (-1050.677) (-1036.399) -- 0:02:46
494000 -- (-1042.625) [-1041.726] (-1039.733) (-1057.060) * [-1038.420] (-1035.953) (-1042.953) (-1040.153) -- 0:02:45
494500 -- (-1046.277) [-1042.148] (-1048.060) (-1039.396) * (-1044.479) (-1053.217) (-1040.583) [-1039.457] -- 0:02:45
495000 -- (-1054.036) (-1048.494) [-1046.335] (-1048.612) * (-1055.660) [-1041.359] (-1049.549) (-1048.293) -- 0:02:46
Average standard deviation of split frequencies: 0.008700
495500 -- [-1040.617] (-1042.122) (-1052.839) (-1041.783) * (-1044.713) [-1039.945] (-1042.416) (-1045.834) -- 0:02:45
496000 -- [-1039.233] (-1046.694) (-1053.802) (-1038.136) * [-1046.254] (-1038.899) (-1051.317) (-1042.852) -- 0:02:45
496500 -- (-1049.529) (-1047.361) (-1044.877) [-1039.925] * (-1043.774) (-1045.953) [-1036.119] (-1052.687) -- 0:02:45
497000 -- [-1049.368] (-1044.764) (-1046.115) (-1052.329) * (-1042.092) (-1045.461) [-1037.077] (-1051.626) -- 0:02:44
497500 -- [-1038.841] (-1044.507) (-1045.457) (-1051.964) * (-1045.773) (-1055.846) [-1034.752] (-1047.373) -- 0:02:44
498000 -- (-1040.985) (-1041.335) (-1047.987) [-1053.981] * (-1054.383) (-1042.680) [-1046.829] (-1041.582) -- 0:02:45
498500 -- (-1043.662) [-1049.151] (-1046.458) (-1046.000) * [-1043.703] (-1046.628) (-1051.783) (-1045.886) -- 0:02:44
499000 -- [-1036.563] (-1052.956) (-1041.670) (-1051.306) * (-1048.503) [-1033.695] (-1037.857) (-1050.041) -- 0:02:44
499500 -- (-1052.873) [-1037.898] (-1040.536) (-1052.711) * (-1048.963) (-1041.740) (-1045.063) [-1040.557] -- 0:02:44
500000 -- (-1049.308) (-1046.454) (-1044.119) [-1051.969] * (-1050.234) (-1046.230) (-1050.164) [-1052.868] -- 0:02:44
Average standard deviation of split frequencies: 0.009271
500500 -- [-1041.383] (-1049.992) (-1042.587) (-1059.641) * (-1040.140) (-1044.821) [-1041.230] (-1047.455) -- 0:02:43
501000 -- (-1038.806) (-1039.912) [-1046.037] (-1037.832) * (-1048.039) [-1041.350] (-1047.499) (-1042.268) -- 0:02:44
501500 -- (-1038.650) (-1049.659) (-1038.334) [-1045.693] * (-1054.874) (-1045.668) (-1042.989) [-1036.741] -- 0:02:44
502000 -- [-1041.192] (-1038.800) (-1035.689) (-1047.759) * [-1041.091] (-1044.671) (-1043.741) (-1054.928) -- 0:02:43
502500 -- (-1042.506) (-1036.071) [-1030.040] (-1044.123) * (-1041.220) [-1035.767] (-1050.358) (-1046.095) -- 0:02:43
503000 -- (-1046.189) [-1038.734] (-1052.672) (-1045.179) * (-1048.384) (-1033.092) [-1041.730] (-1049.568) -- 0:02:43
503500 -- [-1038.100] (-1036.320) (-1038.918) (-1048.044) * (-1037.223) [-1042.245] (-1051.250) (-1051.483) -- 0:02:42
504000 -- (-1035.747) (-1044.165) (-1051.276) [-1040.843] * [-1034.731] (-1039.220) (-1047.009) (-1048.097) -- 0:02:43
504500 -- [-1039.902] (-1047.109) (-1046.387) (-1036.219) * (-1041.002) (-1044.054) (-1043.911) [-1051.588] -- 0:02:43
505000 -- (-1047.354) (-1056.839) [-1038.841] (-1049.407) * [-1050.334] (-1049.478) (-1045.874) (-1038.466) -- 0:02:42
Average standard deviation of split frequencies: 0.009746
505500 -- [-1042.384] (-1056.275) (-1049.644) (-1043.707) * (-1058.119) (-1048.286) (-1056.776) [-1043.601] -- 0:02:42
506000 -- (-1045.694) (-1038.119) (-1045.188) [-1035.328] * (-1044.225) (-1052.096) [-1041.719] (-1037.776) -- 0:02:42
506500 -- (-1053.706) (-1043.078) (-1038.104) [-1038.445] * (-1036.501) (-1052.166) (-1047.444) [-1042.013] -- 0:02:41
507000 -- (-1049.129) [-1042.061] (-1061.450) (-1040.514) * [-1038.006] (-1045.741) (-1043.066) (-1057.351) -- 0:02:42
507500 -- (-1044.719) [-1038.240] (-1037.308) (-1058.665) * [-1039.317] (-1037.786) (-1052.373) (-1055.847) -- 0:02:42
508000 -- (-1056.232) (-1046.942) [-1044.788] (-1048.148) * (-1054.447) [-1032.817] (-1051.677) (-1053.738) -- 0:02:41
508500 -- (-1043.710) (-1042.326) [-1038.690] (-1047.751) * (-1049.771) (-1040.795) (-1049.892) [-1040.189] -- 0:02:41
509000 -- (-1045.778) (-1047.034) [-1035.455] (-1034.728) * (-1038.886) (-1032.352) (-1047.302) [-1041.696] -- 0:02:41
509500 -- [-1044.686] (-1039.380) (-1047.394) (-1039.873) * (-1046.857) [-1038.273] (-1048.650) (-1038.048) -- 0:02:40
510000 -- (-1047.468) (-1040.308) (-1041.508) [-1040.685] * (-1066.728) [-1041.570] (-1042.955) (-1044.219) -- 0:02:41
Average standard deviation of split frequencies: 0.009302
510500 -- (-1045.629) (-1044.204) (-1047.676) [-1045.783] * (-1040.905) (-1055.954) [-1037.968] (-1041.935) -- 0:02:41
511000 -- (-1047.933) [-1047.154] (-1037.140) (-1041.691) * [-1044.544] (-1049.453) (-1050.634) (-1063.854) -- 0:02:40
511500 -- (-1043.949) (-1065.508) (-1050.863) [-1045.422] * (-1041.204) (-1054.525) (-1041.158) [-1040.666] -- 0:02:40
512000 -- (-1046.892) (-1051.002) [-1034.831] (-1043.781) * (-1045.566) [-1035.645] (-1045.066) (-1038.526) -- 0:02:40
512500 -- (-1044.714) (-1045.099) [-1036.672] (-1046.048) * [-1042.212] (-1044.833) (-1039.529) (-1043.108) -- 0:02:39
513000 -- (-1045.719) (-1048.682) [-1029.413] (-1042.481) * [-1037.898] (-1048.438) (-1041.217) (-1050.511) -- 0:02:40
513500 -- (-1044.570) [-1040.605] (-1035.593) (-1053.641) * (-1042.305) (-1044.890) (-1038.014) [-1040.127] -- 0:02:40
514000 -- (-1045.827) (-1045.008) (-1034.873) [-1047.281] * (-1030.571) (-1037.853) (-1047.726) [-1036.307] -- 0:02:39
514500 -- (-1050.035) (-1053.672) [-1037.564] (-1039.572) * (-1049.004) (-1044.802) (-1049.150) [-1040.850] -- 0:02:39
515000 -- (-1046.632) (-1038.876) (-1043.745) [-1039.765] * (-1048.566) (-1053.912) [-1046.299] (-1035.825) -- 0:02:39
Average standard deviation of split frequencies: 0.009206
515500 -- [-1047.357] (-1048.030) (-1043.317) (-1051.859) * [-1050.237] (-1046.190) (-1053.523) (-1045.883) -- 0:02:38
516000 -- (-1047.445) (-1041.535) [-1035.760] (-1056.469) * (-1058.700) (-1047.386) (-1051.686) [-1043.081] -- 0:02:39
516500 -- (-1044.905) [-1041.627] (-1039.682) (-1044.015) * (-1040.934) (-1048.335) [-1045.561] (-1040.185) -- 0:02:39
517000 -- [-1037.813] (-1040.093) (-1037.798) (-1055.915) * (-1043.308) (-1045.240) (-1053.794) [-1036.123] -- 0:02:38
517500 -- [-1038.066] (-1032.921) (-1052.319) (-1052.596) * [-1043.235] (-1041.788) (-1048.463) (-1045.051) -- 0:02:38
518000 -- (-1039.893) [-1034.927] (-1054.381) (-1038.169) * [-1044.779] (-1039.351) (-1050.733) (-1049.986) -- 0:02:38
518500 -- (-1045.165) (-1033.032) [-1050.534] (-1047.315) * (-1046.095) (-1041.824) (-1048.183) [-1039.152] -- 0:02:37
519000 -- (-1044.341) (-1047.403) (-1053.495) [-1048.139] * (-1042.498) [-1041.233] (-1042.586) (-1055.064) -- 0:02:38
519500 -- [-1037.347] (-1039.039) (-1057.614) (-1052.681) * (-1048.204) (-1041.425) [-1047.688] (-1050.206) -- 0:02:38
520000 -- [-1042.072] (-1034.670) (-1056.705) (-1054.076) * (-1053.230) (-1037.658) [-1034.662] (-1046.855) -- 0:02:37
Average standard deviation of split frequencies: 0.008148
520500 -- (-1043.670) (-1048.296) [-1045.906] (-1044.449) * (-1046.851) (-1048.808) (-1058.287) [-1041.352] -- 0:02:37
521000 -- [-1037.310] (-1062.548) (-1037.774) (-1045.404) * (-1040.730) [-1039.908] (-1050.641) (-1041.579) -- 0:02:37
521500 -- [-1034.129] (-1040.225) (-1044.375) (-1042.686) * (-1046.057) (-1046.648) (-1041.414) [-1043.209] -- 0:02:36
522000 -- (-1044.599) [-1039.488] (-1049.866) (-1037.950) * (-1038.520) [-1038.475] (-1043.212) (-1044.757) -- 0:02:36
522500 -- (-1041.118) (-1036.402) [-1038.976] (-1041.907) * (-1051.401) (-1046.833) (-1039.004) [-1050.926] -- 0:02:37
523000 -- (-1055.889) (-1038.128) (-1049.978) [-1035.848] * (-1062.875) [-1035.287] (-1041.655) (-1039.492) -- 0:02:36
523500 -- (-1048.371) (-1051.774) (-1047.580) [-1037.632] * [-1042.224] (-1045.990) (-1049.536) (-1036.535) -- 0:02:36
524000 -- (-1051.348) (-1048.893) [-1036.093] (-1041.560) * (-1043.322) (-1049.008) [-1038.580] (-1047.040) -- 0:02:36
524500 -- (-1039.124) [-1048.102] (-1056.013) (-1040.690) * (-1045.916) (-1040.399) [-1039.719] (-1055.324) -- 0:02:35
525000 -- (-1041.946) (-1041.126) [-1040.114] (-1050.087) * (-1045.659) (-1053.373) [-1045.957] (-1044.186) -- 0:02:35
Average standard deviation of split frequencies: 0.008273
525500 -- (-1039.175) [-1035.677] (-1041.520) (-1045.358) * (-1048.036) (-1043.169) [-1050.565] (-1048.807) -- 0:02:36
526000 -- (-1045.810) (-1050.329) (-1041.051) [-1042.525] * (-1053.401) (-1060.350) (-1040.039) [-1056.445] -- 0:02:35
526500 -- (-1049.818) (-1051.760) (-1047.640) [-1035.459] * (-1039.520) [-1048.558] (-1043.988) (-1043.890) -- 0:02:35
527000 -- [-1042.801] (-1070.375) (-1048.783) (-1035.432) * (-1042.130) [-1044.515] (-1057.711) (-1042.406) -- 0:02:35
527500 -- [-1037.661] (-1051.331) (-1046.855) (-1035.910) * (-1052.433) (-1043.896) (-1049.958) [-1038.212] -- 0:02:34
528000 -- (-1038.512) (-1052.957) [-1033.834] (-1040.338) * [-1035.691] (-1042.538) (-1060.144) (-1042.725) -- 0:02:34
528500 -- (-1047.391) [-1045.982] (-1040.064) (-1053.692) * (-1047.941) [-1042.133] (-1049.713) (-1039.345) -- 0:02:35
529000 -- (-1045.777) (-1050.703) [-1046.617] (-1052.586) * [-1033.896] (-1044.294) (-1044.348) (-1041.201) -- 0:02:34
529500 -- (-1039.051) [-1042.671] (-1048.087) (-1041.703) * (-1040.497) (-1043.547) (-1043.184) [-1041.268] -- 0:02:34
530000 -- (-1047.017) [-1044.438] (-1044.463) (-1045.083) * (-1051.257) [-1034.377] (-1046.306) (-1035.732) -- 0:02:34
Average standard deviation of split frequencies: 0.007995
530500 -- [-1035.225] (-1044.449) (-1038.305) (-1046.705) * (-1045.923) [-1040.783] (-1041.697) (-1038.678) -- 0:02:33
531000 -- (-1037.348) (-1044.082) (-1045.638) [-1041.207] * [-1048.102] (-1039.707) (-1056.724) (-1040.768) -- 0:02:33
531500 -- (-1054.693) [-1042.020] (-1040.864) (-1062.662) * (-1056.618) (-1046.247) [-1041.669] (-1034.822) -- 0:02:34
532000 -- [-1039.602] (-1041.188) (-1040.654) (-1049.265) * (-1044.317) [-1046.032] (-1043.109) (-1044.362) -- 0:02:33
532500 -- (-1035.614) [-1049.041] (-1051.734) (-1050.587) * (-1037.220) (-1043.387) [-1039.451] (-1041.451) -- 0:02:33
533000 -- [-1039.161] (-1038.570) (-1054.594) (-1049.823) * [-1044.085] (-1046.814) (-1048.198) (-1042.562) -- 0:02:33
533500 -- (-1037.447) (-1053.690) (-1047.758) [-1040.089] * (-1040.512) [-1039.687] (-1038.209) (-1045.292) -- 0:02:33
534000 -- (-1041.943) (-1040.474) (-1048.044) [-1036.952] * (-1045.714) [-1038.621] (-1045.674) (-1042.272) -- 0:02:32
534500 -- [-1038.573] (-1051.756) (-1055.264) (-1041.590) * (-1048.858) (-1039.548) (-1052.101) [-1052.267] -- 0:02:33
535000 -- (-1045.028) (-1040.205) [-1044.271] (-1046.819) * (-1054.277) [-1047.591] (-1051.762) (-1051.904) -- 0:02:32
Average standard deviation of split frequencies: 0.007171
535500 -- [-1044.538] (-1045.923) (-1054.825) (-1052.618) * (-1039.992) [-1041.688] (-1042.216) (-1058.731) -- 0:02:32
536000 -- (-1050.204) [-1038.459] (-1035.077) (-1046.462) * [-1045.940] (-1047.052) (-1043.926) (-1038.271) -- 0:02:32
536500 -- [-1035.632] (-1045.514) (-1053.933) (-1046.889) * [-1046.437] (-1052.022) (-1047.837) (-1037.896) -- 0:02:32
537000 -- [-1042.998] (-1038.996) (-1032.966) (-1047.428) * (-1047.486) (-1044.094) [-1030.466] (-1036.244) -- 0:02:31
537500 -- (-1049.836) (-1041.265) [-1037.825] (-1052.169) * (-1040.341) [-1038.566] (-1044.093) (-1039.348) -- 0:02:31
538000 -- (-1042.790) (-1039.138) (-1044.529) [-1040.298] * (-1040.605) (-1041.351) (-1052.397) [-1032.620] -- 0:02:31
538500 -- (-1055.258) [-1038.931] (-1042.339) (-1048.338) * (-1053.780) (-1051.779) (-1038.538) [-1045.043] -- 0:02:31
539000 -- (-1042.957) [-1038.841] (-1043.622) (-1041.830) * (-1047.601) (-1044.903) [-1046.360] (-1040.933) -- 0:02:31
539500 -- (-1061.825) [-1041.234] (-1036.806) (-1048.024) * (-1050.365) (-1062.665) (-1059.275) [-1036.522] -- 0:02:31
540000 -- [-1052.878] (-1048.185) (-1049.955) (-1042.302) * (-1062.438) [-1053.050] (-1036.924) (-1042.631) -- 0:02:30
Average standard deviation of split frequencies: 0.007378
540500 -- [-1032.688] (-1040.072) (-1047.201) (-1037.314) * (-1061.642) (-1048.298) (-1043.901) [-1042.447] -- 0:02:30
541000 -- [-1038.271] (-1046.634) (-1043.218) (-1053.932) * (-1057.273) (-1052.699) (-1053.844) [-1037.232] -- 0:02:31
541500 -- [-1044.746] (-1052.220) (-1041.558) (-1037.913) * [-1045.647] (-1045.693) (-1047.154) (-1047.420) -- 0:02:30
542000 -- (-1047.377) (-1044.243) [-1037.639] (-1033.418) * (-1039.998) (-1050.763) (-1052.532) [-1037.927] -- 0:02:30
542500 -- (-1057.051) (-1050.223) [-1048.464] (-1036.814) * [-1036.440] (-1054.739) (-1039.840) (-1037.999) -- 0:02:30
543000 -- (-1048.668) (-1039.059) (-1043.968) [-1039.821] * [-1039.617] (-1042.155) (-1050.386) (-1040.256) -- 0:02:29
543500 -- (-1036.267) [-1039.369] (-1045.449) (-1045.777) * [-1037.427] (-1037.395) (-1048.203) (-1039.894) -- 0:02:29
544000 -- [-1031.733] (-1044.858) (-1043.152) (-1052.297) * [-1032.912] (-1041.913) (-1055.205) (-1046.925) -- 0:02:30
544500 -- (-1049.506) [-1041.635] (-1045.222) (-1040.374) * (-1037.966) (-1045.719) (-1061.604) [-1053.909] -- 0:02:29
545000 -- (-1041.169) [-1035.655] (-1057.958) (-1052.447) * (-1042.349) (-1042.011) [-1040.162] (-1051.293) -- 0:02:29
Average standard deviation of split frequencies: 0.007173
545500 -- (-1051.771) (-1052.483) [-1043.066] (-1064.107) * (-1044.711) [-1043.030] (-1045.073) (-1066.389) -- 0:02:29
546000 -- [-1038.370] (-1045.896) (-1059.787) (-1039.916) * (-1046.750) [-1051.974] (-1046.347) (-1049.855) -- 0:02:28
546500 -- [-1039.411] (-1052.330) (-1046.483) (-1051.445) * [-1035.811] (-1038.741) (-1046.732) (-1051.041) -- 0:02:28
547000 -- (-1058.481) (-1047.342) (-1037.318) [-1036.467] * (-1040.035) (-1044.461) [-1039.415] (-1048.337) -- 0:02:28
547500 -- (-1053.888) (-1049.804) (-1042.594) [-1035.929] * (-1051.793) (-1044.190) [-1049.324] (-1053.267) -- 0:02:28
548000 -- (-1050.645) [-1051.859] (-1050.353) (-1044.830) * [-1033.383] (-1047.713) (-1049.282) (-1047.401) -- 0:02:28
548500 -- (-1053.247) [-1042.406] (-1043.759) (-1044.945) * [-1034.634] (-1053.026) (-1046.037) (-1036.742) -- 0:02:28
549000 -- (-1061.682) [-1043.994] (-1042.096) (-1049.193) * (-1042.673) (-1041.198) [-1038.157] (-1051.195) -- 0:02:27
549500 -- (-1054.700) (-1041.737) (-1037.867) [-1036.602] * [-1035.850] (-1048.421) (-1046.977) (-1044.721) -- 0:02:27
550000 -- (-1040.775) (-1058.944) (-1052.501) [-1041.383] * [-1040.451] (-1045.877) (-1043.339) (-1042.254) -- 0:02:27
Average standard deviation of split frequencies: 0.006980
550500 -- [-1040.488] (-1059.978) (-1054.050) (-1035.537) * (-1047.789) (-1051.305) (-1041.292) [-1048.062] -- 0:02:27
551000 -- (-1044.478) (-1048.573) (-1060.168) [-1045.509] * (-1034.416) [-1037.902] (-1050.618) (-1045.855) -- 0:02:27
551500 -- (-1051.921) (-1041.325) [-1038.068] (-1046.452) * (-1043.927) [-1037.412] (-1066.133) (-1044.990) -- 0:02:27
552000 -- (-1040.631) (-1054.942) [-1039.541] (-1047.136) * (-1049.759) [-1041.991] (-1052.831) (-1045.538) -- 0:02:26
552500 -- (-1039.164) (-1045.484) (-1046.152) [-1047.012] * [-1039.325] (-1049.557) (-1042.001) (-1048.766) -- 0:02:26
553000 -- (-1039.353) (-1053.113) [-1041.442] (-1044.673) * (-1032.671) (-1037.536) [-1042.655] (-1046.791) -- 0:02:26
553500 -- (-1043.005) [-1055.023] (-1037.527) (-1046.713) * (-1041.504) [-1041.164] (-1054.726) (-1040.685) -- 0:02:26
554000 -- (-1036.677) (-1050.416) [-1038.056] (-1044.471) * (-1045.681) [-1039.043] (-1049.980) (-1052.676) -- 0:02:26
554500 -- (-1051.262) (-1057.836) [-1031.358] (-1042.852) * (-1040.812) (-1040.185) (-1065.638) [-1039.690] -- 0:02:26
555000 -- (-1049.171) (-1048.308) (-1041.912) [-1045.931] * [-1041.335] (-1043.741) (-1047.794) (-1048.176) -- 0:02:25
Average standard deviation of split frequencies: 0.006978
555500 -- (-1039.525) [-1046.178] (-1038.752) (-1054.591) * [-1050.462] (-1038.458) (-1050.271) (-1056.271) -- 0:02:25
556000 -- (-1048.659) (-1048.312) (-1051.251) [-1047.295] * (-1042.702) [-1035.589] (-1041.831) (-1041.171) -- 0:02:25
556500 -- [-1041.028] (-1039.969) (-1048.760) (-1046.003) * (-1043.305) (-1041.946) [-1043.234] (-1051.252) -- 0:02:25
557000 -- (-1042.283) (-1046.720) (-1051.446) [-1040.355] * [-1043.377] (-1054.664) (-1042.096) (-1042.086) -- 0:02:25
557500 -- [-1052.526] (-1057.482) (-1044.909) (-1041.471) * (-1042.799) (-1050.366) (-1042.785) [-1031.904] -- 0:02:25
558000 -- [-1034.424] (-1049.186) (-1048.755) (-1048.408) * (-1047.006) (-1045.358) [-1041.681] (-1047.570) -- 0:02:24
558500 -- (-1048.415) [-1042.930] (-1035.317) (-1054.033) * [-1041.271] (-1046.877) (-1040.756) (-1057.304) -- 0:02:24
559000 -- (-1045.764) (-1042.664) (-1044.785) [-1037.669] * (-1053.241) (-1061.928) [-1033.401] (-1039.722) -- 0:02:24
559500 -- (-1038.209) (-1068.952) (-1052.847) [-1047.601] * [-1038.549] (-1054.192) (-1061.591) (-1043.829) -- 0:02:24
560000 -- (-1042.424) (-1059.768) (-1044.567) [-1045.383] * [-1038.290] (-1067.929) (-1049.230) (-1038.606) -- 0:02:24
Average standard deviation of split frequencies: 0.007050
560500 -- [-1037.283] (-1067.928) (-1047.052) (-1055.141) * [-1042.327] (-1042.560) (-1071.007) (-1043.903) -- 0:02:24
561000 -- [-1037.062] (-1056.781) (-1064.220) (-1047.591) * [-1041.956] (-1040.138) (-1050.403) (-1048.959) -- 0:02:23
561500 -- [-1036.500] (-1056.066) (-1047.595) (-1050.877) * (-1045.829) [-1043.844] (-1059.647) (-1054.452) -- 0:02:23
562000 -- (-1044.580) (-1037.363) (-1051.959) [-1043.689] * (-1053.613) [-1048.381] (-1044.054) (-1058.045) -- 0:02:23
562500 -- (-1044.044) (-1050.789) (-1050.668) [-1040.200] * (-1045.032) (-1046.871) [-1043.788] (-1044.671) -- 0:02:23
563000 -- (-1043.396) [-1045.470] (-1060.429) (-1048.485) * (-1053.775) [-1040.961] (-1049.021) (-1044.681) -- 0:02:23
563500 -- [-1042.753] (-1041.301) (-1048.268) (-1056.228) * (-1049.404) (-1042.671) (-1036.081) [-1052.192] -- 0:02:23
564000 -- (-1044.552) (-1047.301) (-1044.388) [-1045.629] * (-1046.690) (-1045.622) (-1050.509) [-1045.872] -- 0:02:23
564500 -- [-1043.477] (-1056.105) (-1038.842) (-1042.158) * [-1040.622] (-1051.994) (-1040.789) (-1047.925) -- 0:02:22
565000 -- (-1039.848) (-1043.563) (-1035.070) [-1038.637] * [-1036.602] (-1046.422) (-1051.643) (-1050.076) -- 0:02:22
Average standard deviation of split frequencies: 0.006855
565500 -- (-1043.351) [-1050.274] (-1043.632) (-1055.096) * (-1047.587) (-1049.814) [-1041.491] (-1044.372) -- 0:02:22
566000 -- [-1040.172] (-1051.185) (-1038.314) (-1058.182) * (-1054.869) (-1036.593) [-1038.725] (-1057.629) -- 0:02:22
566500 -- (-1055.994) (-1044.811) [-1042.730] (-1058.028) * (-1049.848) (-1038.737) (-1047.395) [-1045.828] -- 0:02:22
567000 -- (-1046.978) (-1055.387) [-1040.699] (-1049.668) * (-1056.641) [-1048.752] (-1049.888) (-1057.645) -- 0:02:22
567500 -- (-1050.461) [-1048.041] (-1053.452) (-1052.879) * (-1037.263) [-1047.862] (-1045.396) (-1043.975) -- 0:02:21
568000 -- [-1042.901] (-1051.855) (-1039.872) (-1042.314) * (-1045.405) (-1043.110) (-1046.015) [-1036.505] -- 0:02:21
568500 -- (-1056.369) [-1040.402] (-1052.109) (-1047.724) * (-1050.783) (-1045.723) [-1044.202] (-1049.902) -- 0:02:21
569000 -- (-1050.426) [-1038.358] (-1048.290) (-1044.736) * (-1053.285) (-1057.894) (-1047.530) [-1048.355] -- 0:02:21
569500 -- (-1046.571) [-1044.364] (-1033.890) (-1050.471) * [-1053.536] (-1061.829) (-1043.199) (-1053.203) -- 0:02:21
570000 -- (-1049.256) [-1036.114] (-1042.508) (-1055.231) * (-1048.867) (-1066.939) (-1045.020) [-1048.414] -- 0:02:21
Average standard deviation of split frequencies: 0.007180
570500 -- (-1037.370) [-1040.451] (-1042.903) (-1042.703) * (-1051.622) (-1043.583) [-1039.870] (-1036.528) -- 0:02:20
571000 -- (-1040.993) [-1039.309] (-1046.179) (-1050.384) * (-1053.923) [-1045.317] (-1042.733) (-1051.953) -- 0:02:20
571500 -- (-1043.389) [-1046.556] (-1039.740) (-1065.230) * (-1043.575) (-1040.425) (-1042.683) [-1040.689] -- 0:02:20
572000 -- (-1042.530) (-1039.022) [-1033.257] (-1055.042) * (-1047.027) (-1047.897) [-1038.856] (-1046.340) -- 0:02:20
572500 -- (-1046.176) (-1037.161) [-1041.626] (-1049.694) * (-1059.596) [-1038.351] (-1041.929) (-1039.138) -- 0:02:20
573000 -- [-1040.043] (-1051.609) (-1046.673) (-1057.300) * (-1055.688) (-1045.155) [-1037.281] (-1038.662) -- 0:02:20
573500 -- (-1050.699) [-1040.922] (-1049.462) (-1042.401) * (-1065.187) [-1040.074] (-1039.807) (-1049.097) -- 0:02:19
574000 -- [-1039.993] (-1037.405) (-1047.325) (-1042.558) * (-1055.387) [-1037.798] (-1037.286) (-1060.460) -- 0:02:19
574500 -- [-1039.739] (-1045.591) (-1056.623) (-1035.982) * [-1046.221] (-1045.767) (-1041.709) (-1056.133) -- 0:02:19
575000 -- [-1041.942] (-1045.672) (-1053.241) (-1040.756) * (-1055.366) [-1043.045] (-1042.648) (-1048.501) -- 0:02:18
Average standard deviation of split frequencies: 0.008058
575500 -- (-1043.899) (-1053.501) [-1039.115] (-1039.775) * (-1065.720) (-1039.513) (-1063.353) [-1035.692] -- 0:02:19
576000 -- [-1036.905] (-1046.285) (-1037.243) (-1056.623) * (-1068.357) [-1048.087] (-1045.098) (-1045.239) -- 0:02:19
576500 -- [-1033.790] (-1051.721) (-1038.600) (-1044.220) * (-1048.315) [-1039.729] (-1043.399) (-1041.243) -- 0:02:18
577000 -- [-1038.853] (-1044.306) (-1048.632) (-1049.795) * (-1039.110) (-1046.989) (-1052.947) [-1036.792] -- 0:02:18
577500 -- [-1032.191] (-1051.644) (-1046.606) (-1050.968) * (-1051.486) (-1061.869) [-1044.296] (-1040.186) -- 0:02:18
578000 -- [-1039.842] (-1047.437) (-1050.957) (-1047.423) * [-1039.903] (-1051.342) (-1047.357) (-1047.400) -- 0:02:17
578500 -- (-1041.743) (-1048.599) (-1050.522) [-1046.687] * (-1051.229) (-1049.543) [-1049.506] (-1039.745) -- 0:02:18
579000 -- [-1034.152] (-1044.093) (-1054.523) (-1038.359) * (-1042.075) (-1044.980) (-1053.854) [-1039.506] -- 0:02:18
579500 -- (-1043.001) (-1045.139) (-1049.746) [-1040.478] * [-1039.185] (-1050.095) (-1045.632) (-1043.327) -- 0:02:17
580000 -- (-1049.667) (-1053.150) (-1036.765) [-1042.760] * (-1052.163) (-1044.083) (-1055.887) [-1044.138] -- 0:02:17
Average standard deviation of split frequencies: 0.008243
580500 -- (-1041.295) (-1043.639) [-1033.120] (-1048.263) * [-1033.246] (-1044.974) (-1037.361) (-1044.974) -- 0:02:17
581000 -- [-1043.233] (-1051.814) (-1042.421) (-1042.619) * [-1042.057] (-1038.846) (-1043.052) (-1043.221) -- 0:02:17
581500 -- (-1040.656) [-1042.891] (-1049.500) (-1040.470) * (-1045.699) (-1046.850) [-1039.384] (-1049.323) -- 0:02:17
582000 -- (-1039.595) [-1046.027] (-1044.189) (-1045.514) * (-1040.549) (-1048.803) [-1042.391] (-1059.159) -- 0:02:17
582500 -- (-1037.429) [-1055.138] (-1047.153) (-1059.977) * [-1038.752] (-1043.778) (-1042.400) (-1059.028) -- 0:02:16
583000 -- (-1036.390) [-1036.411] (-1056.173) (-1048.905) * [-1035.260] (-1053.274) (-1056.675) (-1042.457) -- 0:02:16
583500 -- (-1037.102) (-1045.587) (-1063.437) [-1042.827] * (-1050.681) (-1057.500) [-1049.978] (-1040.997) -- 0:02:16
584000 -- (-1048.842) (-1037.101) (-1050.968) [-1036.786] * [-1039.626] (-1051.290) (-1042.944) (-1052.403) -- 0:02:16
584500 -- (-1041.049) (-1046.946) (-1053.485) [-1041.823] * (-1054.073) (-1038.576) [-1049.263] (-1038.835) -- 0:02:15
585000 -- (-1046.564) [-1048.840] (-1034.253) (-1041.742) * [-1043.396] (-1044.575) (-1037.430) (-1043.179) -- 0:02:16
Average standard deviation of split frequencies: 0.007673
585500 -- (-1061.029) (-1039.259) [-1042.199] (-1043.180) * (-1047.573) (-1041.828) [-1043.861] (-1046.805) -- 0:02:15
586000 -- (-1055.602) [-1041.797] (-1049.978) (-1051.447) * (-1049.864) (-1056.780) (-1034.698) [-1040.563] -- 0:02:15
586500 -- (-1056.425) [-1038.824] (-1044.593) (-1045.057) * (-1046.591) [-1044.882] (-1038.988) (-1038.723) -- 0:02:15
587000 -- (-1061.547) (-1052.607) [-1048.687] (-1045.061) * [-1045.035] (-1040.324) (-1056.252) (-1043.400) -- 0:02:15
587500 -- (-1041.278) (-1039.624) [-1049.078] (-1044.703) * (-1056.932) (-1047.031) (-1046.162) [-1044.430] -- 0:02:14
588000 -- (-1053.770) (-1051.935) (-1050.747) [-1037.337] * (-1038.261) [-1044.730] (-1038.865) (-1041.024) -- 0:02:15
588500 -- (-1038.863) [-1037.203] (-1046.685) (-1041.989) * [-1036.476] (-1048.773) (-1039.795) (-1041.062) -- 0:02:14
589000 -- [-1055.476] (-1054.654) (-1049.064) (-1043.299) * (-1040.798) (-1048.962) [-1031.805] (-1034.589) -- 0:02:14
589500 -- (-1054.508) (-1037.682) [-1038.158] (-1042.161) * (-1047.935) (-1055.714) (-1051.524) [-1035.641] -- 0:02:14
590000 -- (-1049.231) (-1057.062) [-1039.070] (-1041.733) * (-1048.463) (-1052.214) [-1047.816] (-1042.067) -- 0:02:14
Average standard deviation of split frequencies: 0.007490
590500 -- (-1060.073) (-1042.547) [-1041.596] (-1047.382) * [-1054.078] (-1053.700) (-1050.325) (-1040.251) -- 0:02:13
591000 -- (-1059.384) (-1032.259) (-1051.555) [-1034.655] * [-1048.190] (-1050.090) (-1044.736) (-1059.057) -- 0:02:14
591500 -- (-1044.144) [-1042.556] (-1048.585) (-1049.562) * (-1042.751) (-1049.610) [-1041.638] (-1047.274) -- 0:02:13
592000 -- (-1057.256) (-1043.017) [-1041.855] (-1068.916) * [-1037.705] (-1045.051) (-1041.245) (-1051.523) -- 0:02:13
592500 -- (-1051.583) (-1035.831) (-1038.836) [-1048.433] * [-1034.662] (-1043.204) (-1042.961) (-1048.194) -- 0:02:13
593000 -- (-1052.280) (-1053.363) [-1033.914] (-1043.207) * (-1053.124) [-1036.282] (-1043.053) (-1045.758) -- 0:02:13
593500 -- (-1043.539) [-1053.978] (-1042.223) (-1050.010) * [-1050.764] (-1046.190) (-1045.495) (-1054.301) -- 0:02:12
594000 -- (-1046.998) (-1045.086) (-1049.846) [-1039.272] * (-1050.892) (-1055.507) [-1046.877] (-1045.726) -- 0:02:13
594500 -- [-1047.122] (-1047.640) (-1044.906) (-1044.520) * (-1051.195) (-1054.633) (-1053.938) [-1040.598] -- 0:02:13
595000 -- (-1041.672) (-1036.824) (-1052.840) [-1044.448] * (-1045.377) [-1037.137] (-1044.174) (-1050.093) -- 0:02:12
Average standard deviation of split frequencies: 0.008214
595500 -- (-1047.003) (-1045.523) (-1047.736) [-1038.084] * (-1053.089) (-1051.228) (-1046.015) [-1035.475] -- 0:02:12
596000 -- (-1041.693) [-1038.472] (-1055.322) (-1059.092) * (-1044.545) [-1037.358] (-1050.637) (-1042.808) -- 0:02:12
596500 -- (-1044.734) (-1054.771) (-1053.792) [-1041.694] * (-1051.272) [-1041.715] (-1050.191) (-1053.153) -- 0:02:11
597000 -- (-1037.599) (-1049.611) [-1034.825] (-1051.283) * (-1052.185) (-1056.744) (-1054.672) [-1054.903] -- 0:02:11
597500 -- (-1041.269) (-1040.471) (-1047.099) [-1038.707] * (-1044.289) (-1043.270) (-1050.170) [-1048.071] -- 0:02:12
598000 -- (-1049.069) (-1055.574) [-1039.990] (-1052.406) * [-1040.397] (-1058.207) (-1043.069) (-1050.721) -- 0:02:11
598500 -- (-1040.892) (-1053.051) [-1043.257] (-1046.358) * [-1038.822] (-1037.660) (-1047.565) (-1044.383) -- 0:02:11
599000 -- [-1042.041] (-1056.816) (-1050.199) (-1051.798) * (-1040.568) [-1040.133] (-1050.445) (-1043.893) -- 0:02:11
599500 -- [-1042.009] (-1052.923) (-1046.020) (-1045.821) * (-1036.446) (-1043.517) (-1047.920) [-1044.076] -- 0:02:10
600000 -- (-1044.134) (-1061.941) [-1039.609] (-1039.725) * [-1040.696] (-1041.437) (-1053.115) (-1053.759) -- 0:02:10
Average standard deviation of split frequencies: 0.007969
600500 -- (-1040.260) (-1041.807) [-1040.540] (-1055.732) * (-1049.696) [-1041.177] (-1048.768) (-1041.323) -- 0:02:11
601000 -- [-1037.792] (-1048.545) (-1047.731) (-1048.915) * (-1040.367) (-1051.706) [-1048.854] (-1040.554) -- 0:02:10
601500 -- [-1034.296] (-1050.934) (-1042.389) (-1040.888) * (-1039.739) (-1042.267) [-1042.005] (-1041.524) -- 0:02:10
602000 -- [-1031.689] (-1036.712) (-1050.557) (-1049.946) * [-1032.757] (-1047.017) (-1047.162) (-1042.929) -- 0:02:10
602500 -- [-1041.792] (-1041.919) (-1068.050) (-1038.456) * [-1040.776] (-1051.550) (-1050.099) (-1047.751) -- 0:02:09
603000 -- (-1044.700) [-1054.639] (-1053.902) (-1039.212) * (-1045.046) (-1053.790) (-1038.750) [-1043.971] -- 0:02:09
603500 -- (-1032.933) (-1044.386) (-1040.808) [-1036.878] * [-1048.947] (-1052.469) (-1046.774) (-1058.723) -- 0:02:10
604000 -- (-1056.200) [-1038.063] (-1041.442) (-1040.046) * [-1034.922] (-1055.223) (-1050.830) (-1055.062) -- 0:02:09
604500 -- (-1044.764) [-1045.680] (-1062.097) (-1044.571) * (-1053.152) (-1066.443) (-1045.318) [-1043.406] -- 0:02:09
605000 -- (-1038.517) (-1048.449) (-1054.759) [-1044.592] * (-1059.401) (-1051.323) [-1039.502] (-1056.108) -- 0:02:09
Average standard deviation of split frequencies: 0.008437
605500 -- (-1051.937) (-1049.190) (-1058.692) [-1047.865] * (-1043.157) [-1042.393] (-1055.617) (-1070.574) -- 0:02:09
606000 -- (-1047.110) [-1047.099] (-1051.582) (-1047.811) * (-1037.096) (-1041.505) (-1064.484) [-1050.394] -- 0:02:08
606500 -- (-1054.471) (-1045.353) [-1040.501] (-1045.132) * (-1043.120) (-1058.788) (-1051.002) [-1041.463] -- 0:02:09
607000 -- (-1054.883) (-1036.358) (-1053.265) [-1035.326] * (-1048.959) (-1044.487) [-1048.464] (-1047.102) -- 0:02:08
607500 -- (-1038.009) [-1048.417] (-1042.199) (-1040.774) * (-1048.865) [-1044.083] (-1040.905) (-1046.239) -- 0:02:08
608000 -- (-1058.201) [-1032.116] (-1039.867) (-1043.243) * [-1042.786] (-1030.649) (-1051.570) (-1052.068) -- 0:02:08
608500 -- [-1038.668] (-1044.611) (-1047.372) (-1047.664) * (-1047.850) (-1032.070) (-1047.794) [-1053.295] -- 0:02:08
609000 -- [-1048.165] (-1039.509) (-1038.377) (-1054.969) * (-1048.975) [-1038.607] (-1051.314) (-1052.487) -- 0:02:07
609500 -- [-1035.260] (-1039.561) (-1044.162) (-1043.333) * [-1034.859] (-1039.645) (-1069.679) (-1045.074) -- 0:02:08
610000 -- (-1043.031) (-1035.679) [-1045.692] (-1046.442) * [-1041.226] (-1031.813) (-1043.301) (-1061.093) -- 0:02:07
Average standard deviation of split frequencies: 0.008313
610500 -- (-1044.443) [-1043.997] (-1044.366) (-1048.196) * (-1037.335) [-1036.242] (-1044.451) (-1048.914) -- 0:02:07
611000 -- (-1049.912) (-1046.373) [-1046.430] (-1051.597) * [-1044.612] (-1042.474) (-1043.232) (-1037.927) -- 0:02:07
611500 -- (-1049.063) (-1044.056) [-1042.874] (-1038.927) * (-1050.382) [-1036.425] (-1048.328) (-1033.153) -- 0:02:07
612000 -- (-1041.065) (-1051.033) (-1045.613) [-1049.309] * (-1047.873) (-1064.583) (-1047.151) [-1033.647] -- 0:02:06
612500 -- (-1057.999) (-1053.742) [-1043.360] (-1058.243) * (-1041.909) (-1043.667) (-1048.042) [-1035.650] -- 0:02:06
613000 -- (-1055.641) (-1052.964) [-1039.260] (-1066.635) * (-1046.839) [-1039.053] (-1054.985) (-1046.587) -- 0:02:06
613500 -- [-1044.055] (-1045.783) (-1034.701) (-1051.494) * (-1047.795) (-1066.903) (-1047.729) [-1039.476] -- 0:02:06
614000 -- (-1040.080) (-1056.100) [-1035.093] (-1048.923) * (-1046.640) (-1045.437) [-1044.914] (-1047.789) -- 0:02:06
614500 -- (-1045.602) (-1049.680) [-1038.598] (-1044.258) * [-1047.255] (-1042.821) (-1044.654) (-1051.943) -- 0:02:06
615000 -- [-1044.591] (-1037.363) (-1040.135) (-1056.155) * (-1046.913) (-1040.329) (-1047.365) [-1051.448] -- 0:02:05
Average standard deviation of split frequencies: 0.008477
615500 -- (-1048.197) [-1038.359] (-1048.194) (-1043.280) * (-1038.942) [-1045.544] (-1054.218) (-1047.712) -- 0:02:05
616000 -- (-1048.067) (-1054.544) [-1045.006] (-1043.058) * [-1041.831] (-1049.272) (-1053.428) (-1052.646) -- 0:02:05
616500 -- (-1053.289) (-1059.312) (-1041.369) [-1043.804] * (-1046.379) (-1045.906) (-1056.863) [-1038.183] -- 0:02:05
617000 -- [-1039.157] (-1054.154) (-1052.477) (-1039.767) * (-1044.766) (-1046.286) (-1049.000) [-1039.752] -- 0:02:05
617500 -- (-1042.054) (-1052.867) [-1045.517] (-1046.701) * (-1058.863) (-1053.498) (-1045.451) [-1045.750] -- 0:02:05
618000 -- [-1040.425] (-1056.930) (-1042.674) (-1057.982) * (-1059.163) (-1050.903) (-1056.731) [-1049.776] -- 0:02:04
618500 -- (-1051.187) [-1037.447] (-1036.461) (-1038.280) * (-1049.928) (-1042.650) [-1040.468] (-1047.498) -- 0:02:04
619000 -- (-1057.106) (-1049.152) [-1042.219] (-1044.683) * (-1066.190) (-1062.696) (-1041.880) [-1044.879] -- 0:02:04
619500 -- (-1048.979) (-1042.058) (-1045.432) [-1039.422] * (-1043.098) (-1058.085) [-1042.609] (-1046.830) -- 0:02:04
620000 -- (-1048.763) (-1046.695) (-1053.995) [-1044.003] * [-1041.030] (-1063.550) (-1042.788) (-1041.954) -- 0:02:04
Average standard deviation of split frequencies: 0.007770
620500 -- (-1047.357) (-1050.720) (-1042.869) [-1037.445] * (-1047.635) (-1041.062) (-1038.833) [-1044.598] -- 0:02:04
621000 -- (-1049.671) [-1041.789] (-1039.757) (-1040.946) * [-1047.993] (-1049.471) (-1038.099) (-1044.224) -- 0:02:03
621500 -- (-1045.268) (-1046.592) (-1053.359) [-1034.473] * (-1042.992) (-1047.807) [-1040.658] (-1055.633) -- 0:02:03
622000 -- (-1042.001) (-1051.587) (-1058.181) [-1048.280] * (-1051.060) (-1048.633) [-1033.761] (-1055.943) -- 0:02:03
622500 -- (-1052.425) (-1039.839) [-1039.619] (-1041.559) * (-1045.109) [-1049.431] (-1041.183) (-1046.639) -- 0:02:03
623000 -- [-1044.031] (-1040.355) (-1046.130) (-1039.994) * (-1042.139) [-1046.176] (-1040.572) (-1045.690) -- 0:02:03
623500 -- (-1044.825) (-1043.345) (-1050.906) [-1034.262] * (-1044.494) [-1041.119] (-1042.760) (-1040.024) -- 0:02:03
624000 -- (-1041.518) (-1047.242) (-1056.033) [-1035.208] * (-1041.330) [-1041.298] (-1047.649) (-1043.036) -- 0:02:02
624500 -- [-1044.910] (-1042.076) (-1044.807) (-1033.986) * (-1039.975) [-1036.481] (-1056.388) (-1050.300) -- 0:02:02
625000 -- (-1039.746) (-1046.891) [-1038.465] (-1045.672) * (-1057.536) (-1044.529) [-1041.014] (-1047.122) -- 0:02:02
Average standard deviation of split frequencies: 0.007762
625500 -- (-1040.145) (-1046.471) (-1054.114) [-1048.258] * [-1045.380] (-1047.223) (-1043.700) (-1048.974) -- 0:02:02
626000 -- (-1044.452) [-1037.851] (-1047.434) (-1043.154) * (-1047.912) (-1056.183) [-1041.713] (-1037.399) -- 0:02:02
626500 -- (-1047.510) (-1053.218) [-1041.716] (-1044.620) * [-1043.636] (-1045.940) (-1048.005) (-1047.771) -- 0:02:02
627000 -- (-1040.648) (-1048.887) [-1042.418] (-1047.609) * (-1043.692) (-1045.924) (-1050.605) [-1047.843] -- 0:02:01
627500 -- (-1037.955) [-1041.906] (-1045.122) (-1046.252) * (-1050.421) (-1040.853) [-1040.531] (-1044.134) -- 0:02:01
628000 -- (-1044.798) (-1061.564) [-1040.180] (-1039.614) * (-1050.287) [-1040.244] (-1049.781) (-1042.336) -- 0:02:01
628500 -- (-1048.457) (-1053.443) [-1036.227] (-1039.405) * (-1044.959) (-1047.027) [-1037.311] (-1042.704) -- 0:02:01
629000 -- (-1057.200) [-1047.848] (-1038.941) (-1046.968) * (-1045.565) [-1047.493] (-1055.872) (-1041.605) -- 0:02:01
629500 -- (-1042.252) (-1051.755) (-1042.585) [-1039.303] * (-1041.873) (-1039.524) [-1042.080] (-1064.470) -- 0:02:01
630000 -- (-1044.549) (-1045.942) (-1046.639) [-1033.724] * (-1038.130) (-1055.864) (-1040.016) [-1038.928] -- 0:02:00
Average standard deviation of split frequencies: 0.007590
630500 -- (-1076.471) (-1048.514) (-1042.705) [-1041.440] * (-1036.969) (-1045.051) [-1039.242] (-1039.081) -- 0:02:00
631000 -- (-1052.350) (-1051.202) [-1036.489] (-1045.020) * (-1049.509) (-1051.849) (-1049.282) [-1038.044] -- 0:02:00
631500 -- (-1056.580) (-1044.162) (-1038.325) [-1049.788] * (-1043.690) (-1052.542) [-1049.514] (-1044.992) -- 0:02:00
632000 -- [-1038.016] (-1056.858) (-1050.782) (-1056.045) * (-1049.107) (-1050.072) (-1049.915) [-1039.971] -- 0:02:00
632500 -- (-1051.322) (-1042.065) [-1042.090] (-1046.798) * (-1042.853) [-1040.762] (-1045.313) (-1050.092) -- 0:02:00
633000 -- [-1033.771] (-1043.323) (-1044.733) (-1057.587) * [-1042.240] (-1056.623) (-1043.221) (-1045.535) -- 0:02:00
633500 -- (-1058.387) [-1042.975] (-1047.273) (-1042.085) * (-1056.017) (-1056.142) (-1047.567) [-1049.431] -- 0:01:59
634000 -- [-1045.405] (-1038.076) (-1040.352) (-1062.690) * (-1045.617) [-1042.468] (-1042.009) (-1053.970) -- 0:01:59
634500 -- (-1048.989) [-1039.835] (-1046.521) (-1048.878) * (-1048.387) (-1040.458) (-1049.840) [-1036.483] -- 0:01:59
635000 -- (-1047.608) [-1038.168] (-1045.693) (-1048.429) * [-1043.532] (-1040.987) (-1049.076) (-1056.344) -- 0:01:59
Average standard deviation of split frequencies: 0.008039
635500 -- (-1051.017) [-1037.435] (-1034.501) (-1065.019) * (-1046.869) (-1048.266) [-1040.122] (-1038.897) -- 0:01:59
636000 -- [-1047.376] (-1044.752) (-1042.981) (-1055.838) * (-1044.367) (-1035.514) [-1039.856] (-1054.433) -- 0:01:59
636500 -- (-1044.713) (-1048.642) [-1047.336] (-1041.468) * (-1059.583) (-1048.031) (-1034.708) [-1040.652] -- 0:01:58
637000 -- (-1041.802) [-1044.048] (-1054.750) (-1062.998) * (-1048.721) (-1036.932) [-1034.704] (-1039.430) -- 0:01:58
637500 -- (-1045.402) [-1036.419] (-1047.008) (-1061.965) * [-1033.956] (-1047.386) (-1059.134) (-1044.677) -- 0:01:58
638000 -- [-1045.685] (-1038.707) (-1042.104) (-1068.514) * (-1042.752) [-1035.396] (-1047.759) (-1044.424) -- 0:01:58
638500 -- (-1040.147) [-1041.929] (-1051.476) (-1053.923) * (-1052.722) (-1042.010) (-1050.568) [-1038.096] -- 0:01:58
639000 -- (-1036.313) [-1037.357] (-1056.018) (-1048.272) * (-1053.892) (-1046.261) [-1038.581] (-1052.297) -- 0:01:58
639500 -- [-1042.979] (-1042.977) (-1040.860) (-1044.347) * (-1049.688) (-1052.012) [-1043.989] (-1043.879) -- 0:01:57
640000 -- (-1046.123) [-1045.801] (-1041.184) (-1040.763) * [-1048.815] (-1059.608) (-1051.413) (-1042.997) -- 0:01:58
Average standard deviation of split frequencies: 0.008037
640500 -- (-1051.185) (-1051.846) [-1040.633] (-1057.810) * (-1040.771) (-1048.796) [-1034.895] (-1040.699) -- 0:01:57
641000 -- [-1051.289] (-1059.077) (-1049.735) (-1064.362) * [-1032.173] (-1046.988) (-1045.556) (-1056.032) -- 0:01:57
641500 -- [-1042.515] (-1044.795) (-1051.979) (-1059.008) * [-1041.654] (-1042.246) (-1044.580) (-1053.980) -- 0:01:57
642000 -- (-1038.128) [-1044.023] (-1062.650) (-1050.795) * (-1044.026) (-1049.080) [-1042.747] (-1038.329) -- 0:01:57
642500 -- [-1042.406] (-1038.803) (-1051.780) (-1042.195) * (-1047.107) (-1045.886) [-1050.077] (-1042.166) -- 0:01:56
643000 -- [-1041.680] (-1042.812) (-1048.279) (-1055.277) * (-1039.160) (-1057.958) [-1043.477] (-1043.196) -- 0:01:57
643500 -- [-1042.343] (-1048.959) (-1043.671) (-1044.924) * (-1036.800) (-1043.474) (-1060.807) [-1032.981] -- 0:01:56
644000 -- (-1045.601) (-1045.489) (-1051.167) [-1040.121] * [-1033.225] (-1050.208) (-1046.456) (-1042.411) -- 0:01:56
644500 -- (-1052.294) [-1039.976] (-1046.975) (-1051.704) * (-1033.411) [-1038.002] (-1057.355) (-1038.918) -- 0:01:56
645000 -- [-1044.656] (-1054.990) (-1057.165) (-1047.449) * (-1037.024) (-1041.406) (-1051.039) [-1040.997] -- 0:01:56
Average standard deviation of split frequencies: 0.007634
645500 -- (-1047.194) (-1037.309) [-1031.182] (-1047.488) * [-1039.510] (-1049.097) (-1048.847) (-1062.670) -- 0:01:55
646000 -- (-1050.406) (-1042.039) [-1038.190] (-1046.830) * [-1042.462] (-1061.758) (-1052.646) (-1049.655) -- 0:01:55
646500 -- (-1038.003) (-1039.873) [-1041.192] (-1040.537) * [-1044.954] (-1049.285) (-1042.107) (-1037.260) -- 0:01:55
647000 -- [-1039.781] (-1053.807) (-1046.438) (-1043.379) * (-1051.683) (-1053.218) (-1042.331) [-1039.761] -- 0:01:55
647500 -- [-1043.597] (-1044.296) (-1046.345) (-1046.637) * (-1043.414) (-1041.768) (-1051.286) [-1034.748] -- 0:01:55
648000 -- (-1048.986) [-1045.032] (-1054.360) (-1040.277) * [-1049.001] (-1044.810) (-1043.914) (-1039.410) -- 0:01:55
648500 -- [-1038.373] (-1045.339) (-1059.395) (-1038.241) * (-1038.312) (-1043.297) [-1036.622] (-1049.384) -- 0:01:54
649000 -- [-1048.612] (-1048.032) (-1045.780) (-1043.680) * (-1043.428) [-1047.713] (-1052.029) (-1049.935) -- 0:01:54
649500 -- (-1055.358) (-1057.793) (-1049.941) [-1046.341] * (-1045.101) (-1047.045) (-1052.614) [-1046.286] -- 0:01:54
650000 -- [-1048.456] (-1039.828) (-1044.690) (-1038.593) * (-1037.782) (-1057.332) (-1050.384) [-1039.568] -- 0:01:54
Average standard deviation of split frequencies: 0.007356
650500 -- [-1039.425] (-1045.641) (-1048.794) (-1036.167) * (-1042.153) (-1050.960) [-1032.121] (-1042.400) -- 0:01:54
651000 -- [-1041.052] (-1047.264) (-1051.498) (-1046.425) * [-1043.932] (-1048.513) (-1041.272) (-1038.953) -- 0:01:54
651500 -- (-1042.832) [-1046.931] (-1057.569) (-1047.474) * [-1033.837] (-1053.041) (-1038.502) (-1040.556) -- 0:01:53
652000 -- [-1039.444] (-1032.610) (-1049.135) (-1041.776) * (-1037.347) (-1057.031) (-1048.677) [-1042.539] -- 0:01:53
652500 -- (-1052.292) [-1039.505] (-1056.829) (-1039.376) * (-1043.526) [-1041.337] (-1038.116) (-1042.254) -- 0:01:53
653000 -- [-1041.119] (-1042.818) (-1049.594) (-1054.697) * (-1043.681) (-1051.990) (-1045.341) [-1044.005] -- 0:01:53
653500 -- (-1059.862) (-1048.797) (-1051.146) [-1041.288] * [-1032.694] (-1048.164) (-1043.845) (-1044.736) -- 0:01:53
654000 -- (-1057.092) (-1042.977) (-1035.794) [-1037.388] * (-1044.204) (-1039.214) [-1035.630] (-1054.778) -- 0:01:53
654500 -- [-1050.709] (-1051.414) (-1038.386) (-1045.756) * (-1044.621) [-1041.647] (-1035.270) (-1042.714) -- 0:01:52
655000 -- (-1060.006) (-1047.369) (-1041.618) [-1039.255] * (-1038.145) (-1059.457) [-1046.008] (-1044.629) -- 0:01:52
Average standard deviation of split frequencies: 0.007573
655500 -- (-1062.891) (-1055.816) (-1033.826) [-1051.940] * [-1052.649] (-1049.848) (-1041.993) (-1054.266) -- 0:01:52
656000 -- (-1043.496) (-1038.377) [-1045.625] (-1032.442) * [-1035.827] (-1057.043) (-1059.698) (-1051.592) -- 0:01:52
656500 -- [-1039.780] (-1051.041) (-1048.201) (-1052.879) * [-1039.472] (-1041.139) (-1042.011) (-1051.279) -- 0:01:52
657000 -- (-1054.443) (-1041.955) [-1033.973] (-1055.645) * (-1035.894) (-1054.053) [-1046.231] (-1043.506) -- 0:01:52
657500 -- (-1058.940) (-1037.959) [-1037.421] (-1048.649) * [-1052.949] (-1050.090) (-1044.723) (-1052.146) -- 0:01:51
658000 -- (-1046.094) (-1050.077) [-1038.525] (-1047.444) * (-1065.902) (-1052.402) [-1042.304] (-1047.237) -- 0:01:51
658500 -- (-1057.439) (-1047.628) (-1037.237) [-1031.860] * (-1051.256) [-1039.656] (-1048.005) (-1044.205) -- 0:01:51
659000 -- (-1051.088) [-1040.099] (-1049.332) (-1044.398) * (-1043.433) (-1055.565) (-1055.585) [-1039.961] -- 0:01:51
659500 -- (-1045.599) [-1053.014] (-1049.869) (-1053.132) * [-1041.499] (-1042.486) (-1049.048) (-1055.367) -- 0:01:51
660000 -- (-1035.519) (-1050.074) [-1042.582] (-1055.045) * [-1042.540] (-1039.637) (-1050.192) (-1050.134) -- 0:01:51
Average standard deviation of split frequencies: 0.006806
660500 -- (-1037.417) (-1048.817) (-1039.733) [-1042.512] * (-1043.439) [-1040.143] (-1047.171) (-1047.247) -- 0:01:51
661000 -- [-1034.292] (-1050.798) (-1038.750) (-1045.702) * [-1043.277] (-1041.426) (-1054.962) (-1044.200) -- 0:01:50
661500 -- (-1036.130) [-1040.653] (-1044.467) (-1038.073) * (-1048.465) [-1058.573] (-1048.751) (-1041.034) -- 0:01:50
662000 -- [-1053.858] (-1038.197) (-1045.578) (-1055.774) * (-1045.496) (-1051.630) (-1042.569) [-1041.285] -- 0:01:50
662500 -- [-1039.334] (-1044.354) (-1041.703) (-1048.963) * [-1040.742] (-1038.996) (-1059.981) (-1051.580) -- 0:01:50
663000 -- [-1039.692] (-1043.606) (-1051.779) (-1046.232) * (-1052.458) (-1052.839) [-1053.257] (-1060.689) -- 0:01:50
663500 -- [-1036.832] (-1050.735) (-1049.467) (-1048.052) * (-1047.464) [-1045.060] (-1054.009) (-1059.141) -- 0:01:50
664000 -- [-1039.171] (-1049.214) (-1040.436) (-1049.408) * (-1042.683) (-1049.678) (-1046.191) [-1040.908] -- 0:01:49
664500 -- (-1050.540) [-1034.318] (-1046.121) (-1049.300) * [-1034.575] (-1041.598) (-1049.596) (-1043.733) -- 0:01:49
665000 -- [-1039.837] (-1064.965) (-1048.247) (-1045.799) * (-1051.856) (-1045.549) [-1029.725] (-1034.810) -- 0:01:49
Average standard deviation of split frequencies: 0.007350
665500 -- [-1038.477] (-1044.027) (-1039.157) (-1075.148) * (-1055.349) (-1044.886) [-1035.469] (-1037.871) -- 0:01:49
666000 -- [-1037.781] (-1037.495) (-1045.703) (-1051.888) * (-1050.665) (-1046.085) (-1045.477) [-1039.772] -- 0:01:49
666500 -- [-1035.362] (-1041.807) (-1049.237) (-1060.755) * (-1048.408) [-1047.049] (-1040.933) (-1043.198) -- 0:01:49
667000 -- (-1048.090) (-1049.843) [-1052.972] (-1039.764) * (-1050.035) (-1054.324) (-1043.290) [-1033.305] -- 0:01:48
667500 -- [-1040.692] (-1053.196) (-1053.940) (-1034.886) * [-1037.473] (-1037.549) (-1048.259) (-1041.745) -- 0:01:48
668000 -- [-1037.034] (-1053.676) (-1044.012) (-1039.152) * (-1050.275) [-1040.630] (-1038.390) (-1041.612) -- 0:01:48
668500 -- (-1046.724) (-1046.276) (-1040.954) [-1047.318] * (-1052.339) [-1037.527] (-1049.861) (-1046.342) -- 0:01:48
669000 -- [-1043.264] (-1058.426) (-1054.070) (-1039.306) * (-1044.767) (-1052.218) [-1045.143] (-1038.440) -- 0:01:48
669500 -- (-1046.066) (-1050.805) [-1043.343] (-1051.545) * (-1044.170) [-1041.267] (-1046.839) (-1054.636) -- 0:01:48
670000 -- [-1043.986] (-1049.071) (-1049.286) (-1058.597) * [-1041.434] (-1040.541) (-1043.481) (-1053.899) -- 0:01:47
Average standard deviation of split frequencies: 0.007029
670500 -- [-1047.738] (-1048.765) (-1041.929) (-1051.557) * (-1050.966) (-1036.620) (-1049.609) [-1044.997] -- 0:01:47
671000 -- (-1041.911) [-1047.092] (-1046.111) (-1068.668) * (-1044.340) [-1033.927] (-1050.899) (-1047.074) -- 0:01:47
671500 -- (-1059.823) (-1055.316) [-1046.769] (-1057.875) * [-1037.551] (-1035.625) (-1045.424) (-1049.260) -- 0:01:47
672000 -- (-1042.441) (-1047.245) (-1056.459) [-1045.646] * (-1048.371) (-1045.508) (-1057.725) [-1036.206] -- 0:01:47
672500 -- (-1050.945) (-1041.314) (-1043.606) [-1046.541] * [-1047.278] (-1042.815) (-1048.256) (-1043.952) -- 0:01:47
673000 -- (-1059.848) [-1043.484] (-1048.831) (-1046.253) * (-1039.445) [-1047.498] (-1042.328) (-1042.855) -- 0:01:46
673500 -- (-1048.939) [-1042.081] (-1062.777) (-1056.365) * (-1046.404) (-1040.016) [-1046.928] (-1044.004) -- 0:01:46
674000 -- [-1044.554] (-1056.858) (-1050.936) (-1055.303) * (-1048.771) (-1048.596) [-1036.460] (-1042.645) -- 0:01:46
674500 -- [-1048.111] (-1059.395) (-1043.487) (-1042.104) * (-1036.100) (-1044.441) (-1043.799) [-1039.675] -- 0:01:46
675000 -- (-1049.101) (-1053.982) [-1047.756] (-1046.995) * (-1058.723) (-1051.960) (-1033.938) [-1045.079] -- 0:01:46
Average standard deviation of split frequencies: 0.006598
675500 -- (-1045.740) (-1058.559) (-1044.799) [-1041.733] * (-1044.851) [-1043.204] (-1035.665) (-1047.855) -- 0:01:46
676000 -- (-1044.648) (-1045.322) [-1049.904] (-1045.653) * (-1050.056) (-1049.527) [-1044.216] (-1039.258) -- 0:01:45
676500 -- [-1042.659] (-1045.799) (-1042.891) (-1049.039) * (-1049.739) (-1045.827) (-1058.826) [-1047.209] -- 0:01:45
677000 -- (-1043.718) [-1040.568] (-1043.555) (-1044.709) * (-1043.607) (-1057.279) [-1037.045] (-1050.030) -- 0:01:45
677500 -- (-1049.384) (-1048.034) (-1048.927) [-1036.943] * [-1044.824] (-1054.706) (-1037.558) (-1045.593) -- 0:01:45
678000 -- (-1040.515) (-1043.769) [-1039.869] (-1043.139) * (-1049.193) (-1053.594) [-1036.593] (-1051.465) -- 0:01:45
678500 -- [-1037.572] (-1040.245) (-1057.249) (-1046.532) * [-1037.776] (-1042.794) (-1040.524) (-1034.819) -- 0:01:45
679000 -- (-1058.633) [-1035.639] (-1041.185) (-1050.749) * (-1044.982) [-1044.270] (-1042.313) (-1044.596) -- 0:01:44
679500 -- (-1065.751) (-1041.757) [-1039.205] (-1061.868) * [-1039.168] (-1049.081) (-1047.925) (-1049.345) -- 0:01:44
680000 -- (-1065.482) (-1045.441) (-1038.488) [-1039.524] * (-1037.188) (-1044.706) [-1038.864] (-1046.439) -- 0:01:44
Average standard deviation of split frequencies: 0.006553
680500 -- (-1043.976) (-1048.433) [-1035.354] (-1045.899) * [-1041.499] (-1048.988) (-1034.480) (-1041.414) -- 0:01:44
681000 -- (-1055.393) (-1047.055) (-1039.324) [-1040.457] * [-1045.391] (-1038.765) (-1058.328) (-1050.730) -- 0:01:44
681500 -- (-1044.683) [-1046.700] (-1043.109) (-1036.736) * (-1056.111) [-1039.196] (-1044.163) (-1054.249) -- 0:01:44
682000 -- [-1044.944] (-1052.020) (-1053.123) (-1042.047) * [-1044.425] (-1040.381) (-1047.941) (-1042.401) -- 0:01:43
682500 -- [-1041.456] (-1060.199) (-1047.099) (-1051.943) * [-1036.811] (-1044.466) (-1058.473) (-1049.635) -- 0:01:43
683000 -- (-1053.565) (-1044.746) [-1040.832] (-1047.761) * (-1045.335) (-1043.540) [-1041.669] (-1050.961) -- 0:01:43
683500 -- (-1042.303) (-1046.512) [-1036.923] (-1054.710) * [-1040.205] (-1051.101) (-1046.561) (-1048.667) -- 0:01:43
684000 -- (-1047.050) [-1042.021] (-1044.284) (-1061.702) * (-1048.250) (-1046.973) [-1044.107] (-1051.133) -- 0:01:43
684500 -- [-1041.839] (-1048.003) (-1042.246) (-1046.564) * (-1043.830) [-1034.629] (-1049.686) (-1046.862) -- 0:01:43
685000 -- (-1046.125) [-1040.710] (-1044.667) (-1050.152) * (-1043.784) [-1036.970] (-1044.740) (-1049.097) -- 0:01:43
Average standard deviation of split frequencies: 0.006660
685500 -- (-1054.147) [-1040.250] (-1040.380) (-1042.832) * (-1038.374) [-1050.098] (-1054.705) (-1046.026) -- 0:01:42
686000 -- (-1057.524) (-1037.483) (-1041.170) [-1038.382] * (-1052.600) [-1042.732] (-1052.029) (-1042.487) -- 0:01:42
686500 -- (-1049.076) [-1041.320] (-1050.567) (-1044.913) * (-1043.994) (-1037.515) (-1048.209) [-1033.758] -- 0:01:42
687000 -- (-1045.443) (-1048.959) [-1044.552] (-1053.420) * [-1032.424] (-1051.069) (-1052.283) (-1039.982) -- 0:01:42
687500 -- (-1042.686) (-1047.491) (-1056.461) [-1044.748] * (-1045.256) [-1042.948] (-1039.262) (-1047.138) -- 0:01:42
688000 -- (-1050.002) [-1046.242] (-1043.452) (-1045.265) * (-1037.966) (-1044.392) [-1036.416] (-1034.870) -- 0:01:42
688500 -- (-1049.016) (-1045.976) (-1051.511) [-1035.972] * (-1058.889) (-1035.946) (-1037.773) [-1036.071] -- 0:01:41
689000 -- (-1045.340) (-1053.066) (-1047.186) [-1045.896] * [-1049.097] (-1052.333) (-1049.529) (-1044.650) -- 0:01:41
689500 -- (-1033.139) (-1043.876) (-1053.562) [-1041.738] * (-1046.342) (-1049.620) [-1065.045] (-1045.690) -- 0:01:41
690000 -- (-1049.664) (-1051.029) (-1048.061) [-1039.009] * [-1039.413] (-1041.531) (-1049.038) (-1052.303) -- 0:01:41
Average standard deviation of split frequencies: 0.006878
690500 -- [-1041.703] (-1043.766) (-1055.280) (-1036.633) * [-1046.168] (-1048.908) (-1048.996) (-1038.872) -- 0:01:41
691000 -- [-1041.692] (-1043.333) (-1036.771) (-1040.600) * (-1039.698) (-1047.176) (-1048.389) [-1050.240] -- 0:01:41
691500 -- (-1053.629) (-1043.214) [-1045.414] (-1042.685) * [-1044.359] (-1044.528) (-1047.307) (-1042.839) -- 0:01:40
692000 -- (-1057.622) (-1045.140) [-1042.038] (-1037.331) * (-1047.147) (-1044.127) [-1039.752] (-1043.492) -- 0:01:40
692500 -- (-1063.662) (-1044.994) (-1046.099) [-1043.475] * [-1041.478] (-1052.074) (-1051.410) (-1043.016) -- 0:01:40
693000 -- (-1050.238) (-1043.368) (-1056.040) [-1046.014] * [-1036.128] (-1051.185) (-1062.894) (-1052.156) -- 0:01:40
693500 -- (-1037.411) (-1043.027) [-1042.284] (-1059.534) * (-1044.715) (-1052.799) [-1038.394] (-1056.092) -- 0:01:40
694000 -- (-1041.048) (-1038.187) [-1043.285] (-1051.924) * (-1050.776) [-1052.232] (-1033.663) (-1051.938) -- 0:01:40
694500 -- [-1037.688] (-1045.563) (-1053.609) (-1040.375) * (-1050.480) (-1053.473) (-1046.069) [-1049.776] -- 0:01:39
695000 -- (-1046.720) [-1035.230] (-1051.002) (-1048.633) * (-1039.629) (-1056.557) [-1041.548] (-1052.245) -- 0:01:39
Average standard deviation of split frequencies: 0.007034
695500 -- (-1040.130) [-1035.179] (-1052.147) (-1049.814) * (-1046.166) (-1043.319) (-1034.363) [-1041.079] -- 0:01:39
696000 -- (-1047.391) [-1036.369] (-1051.158) (-1046.339) * (-1053.844) (-1054.102) (-1043.760) [-1040.864] -- 0:01:39
696500 -- (-1037.211) (-1044.354) (-1049.665) [-1039.103] * (-1046.180) (-1037.554) [-1038.431] (-1063.070) -- 0:01:39
697000 -- (-1034.645) (-1057.216) (-1046.818) [-1037.580] * (-1053.558) (-1046.683) [-1034.155] (-1048.453) -- 0:01:39
697500 -- (-1050.097) [-1042.191] (-1044.186) (-1053.287) * (-1046.159) [-1040.731] (-1040.419) (-1054.107) -- 0:01:38
698000 -- (-1043.049) (-1054.170) (-1040.841) [-1045.882] * (-1047.456) (-1040.404) [-1036.377] (-1060.232) -- 0:01:38
698500 -- (-1045.703) (-1037.863) [-1045.318] (-1044.677) * [-1046.205] (-1036.067) (-1051.995) (-1046.592) -- 0:01:38
699000 -- (-1041.434) (-1043.972) (-1051.584) [-1043.141] * (-1040.615) (-1051.410) (-1048.551) [-1031.702] -- 0:01:38
699500 -- [-1040.204] (-1043.935) (-1046.328) (-1051.408) * (-1038.307) (-1060.961) (-1045.214) [-1036.823] -- 0:01:38
700000 -- (-1054.834) (-1039.617) [-1043.167] (-1040.949) * [-1039.342] (-1047.023) (-1045.381) (-1049.655) -- 0:01:38
Average standard deviation of split frequencies: 0.006935
700500 -- (-1046.956) (-1042.017) [-1032.159] (-1047.602) * (-1042.129) [-1036.697] (-1040.286) (-1057.631) -- 0:01:37
701000 -- (-1037.158) (-1048.262) (-1050.721) [-1037.703] * [-1053.159] (-1059.841) (-1049.952) (-1049.528) -- 0:01:37
701500 -- (-1039.676) (-1049.411) [-1034.166] (-1046.217) * (-1056.055) (-1049.139) [-1046.621] (-1037.426) -- 0:01:37
702000 -- [-1048.101] (-1048.552) (-1040.853) (-1043.808) * (-1049.562) (-1048.275) [-1044.383] (-1041.653) -- 0:01:37
702500 -- (-1055.569) (-1049.251) [-1040.014] (-1046.345) * (-1054.530) [-1041.025] (-1048.903) (-1041.614) -- 0:01:37
703000 -- (-1055.186) [-1034.323] (-1054.070) (-1043.548) * [-1040.113] (-1063.604) (-1047.906) (-1038.451) -- 0:01:37
703500 -- (-1043.906) (-1053.548) [-1042.745] (-1041.630) * (-1037.702) (-1051.667) [-1046.180] (-1038.339) -- 0:01:36
704000 -- (-1045.682) [-1042.963] (-1051.893) (-1047.588) * (-1041.680) [-1038.602] (-1046.660) (-1055.400) -- 0:01:36
704500 -- (-1045.770) (-1041.468) (-1047.520) [-1040.816] * (-1044.482) (-1053.821) (-1040.042) [-1038.294] -- 0:01:36
705000 -- (-1047.299) (-1044.066) (-1053.454) [-1040.547] * (-1041.286) (-1044.361) (-1055.484) [-1033.361] -- 0:01:36
Average standard deviation of split frequencies: 0.006574
705500 -- (-1042.371) [-1038.427] (-1050.948) (-1046.239) * (-1048.770) [-1041.262] (-1051.025) (-1040.756) -- 0:01:36
706000 -- [-1048.782] (-1045.433) (-1047.176) (-1043.917) * (-1037.592) [-1039.739] (-1049.554) (-1053.806) -- 0:01:36
706500 -- (-1047.874) (-1045.780) [-1036.550] (-1048.858) * (-1045.972) (-1044.253) [-1040.798] (-1053.236) -- 0:01:35
707000 -- (-1048.961) (-1049.767) (-1041.661) [-1038.800] * (-1045.618) [-1042.950] (-1057.681) (-1045.451) -- 0:01:35
707500 -- (-1053.581) (-1042.641) [-1040.892] (-1051.170) * (-1050.218) (-1049.877) [-1036.308] (-1045.230) -- 0:01:35
708000 -- [-1038.225] (-1044.663) (-1035.637) (-1055.628) * (-1051.883) (-1040.957) [-1037.224] (-1037.476) -- 0:01:35
708500 -- (-1051.159) [-1042.429] (-1049.504) (-1048.221) * (-1039.568) (-1064.378) [-1036.517] (-1044.851) -- 0:01:35
709000 -- [-1042.323] (-1042.103) (-1045.007) (-1051.656) * [-1036.130] (-1051.614) (-1055.090) (-1037.959) -- 0:01:35
709500 -- (-1037.418) [-1036.702] (-1049.273) (-1047.454) * (-1051.624) (-1041.567) (-1044.220) [-1038.323] -- 0:01:34
710000 -- (-1043.292) (-1043.318) (-1046.469) [-1042.331] * (-1043.234) (-1045.347) [-1041.495] (-1039.715) -- 0:01:34
Average standard deviation of split frequencies: 0.006429
710500 -- (-1038.733) (-1048.688) [-1052.444] (-1041.548) * [-1050.732] (-1042.915) (-1044.540) (-1043.115) -- 0:01:34
711000 -- [-1042.755] (-1053.339) (-1047.234) (-1046.835) * (-1052.790) (-1043.836) (-1045.097) [-1037.838] -- 0:01:34
711500 -- (-1039.776) (-1053.294) [-1042.533] (-1044.298) * (-1053.684) (-1038.317) (-1047.414) [-1046.166] -- 0:01:34
712000 -- [-1047.290] (-1043.367) (-1046.994) (-1054.643) * (-1043.855) [-1037.939] (-1041.649) (-1046.532) -- 0:01:34
712500 -- (-1050.487) [-1041.347] (-1045.590) (-1050.111) * (-1037.458) (-1055.356) [-1043.428] (-1054.903) -- 0:01:34
713000 -- [-1056.145] (-1060.398) (-1060.068) (-1049.632) * (-1051.797) (-1063.553) [-1040.615] (-1043.216) -- 0:01:33
713500 -- (-1044.301) (-1051.187) (-1047.071) [-1047.894] * (-1039.058) (-1050.183) [-1038.937] (-1048.505) -- 0:01:33
714000 -- (-1046.538) (-1048.898) [-1034.177] (-1049.016) * (-1057.742) [-1041.314] (-1049.852) (-1051.829) -- 0:01:33
714500 -- (-1051.055) [-1047.044] (-1043.502) (-1050.189) * (-1058.308) (-1045.372) [-1039.068] (-1053.582) -- 0:01:33
715000 -- (-1044.691) (-1040.983) [-1042.286] (-1051.213) * (-1039.944) (-1049.384) [-1037.857] (-1050.036) -- 0:01:33
Average standard deviation of split frequencies: 0.006736
715500 -- (-1042.566) (-1051.526) (-1044.439) [-1042.272] * (-1065.791) (-1036.295) (-1036.599) [-1042.158] -- 0:01:33
716000 -- [-1041.947] (-1066.219) (-1039.464) (-1045.033) * (-1052.382) (-1057.349) (-1050.459) [-1049.278] -- 0:01:32
716500 -- (-1046.109) (-1041.567) [-1035.981] (-1060.891) * (-1035.012) [-1040.499] (-1054.489) (-1046.177) -- 0:01:32
717000 -- (-1043.775) (-1045.762) [-1036.088] (-1054.155) * [-1036.283] (-1034.082) (-1041.631) (-1053.948) -- 0:01:32
717500 -- (-1043.191) [-1038.630] (-1045.030) (-1039.613) * (-1042.225) [-1036.204] (-1043.320) (-1042.682) -- 0:01:32
718000 -- (-1053.555) [-1040.483] (-1046.465) (-1043.030) * (-1041.478) [-1044.329] (-1061.443) (-1047.510) -- 0:01:31
718500 -- (-1051.335) (-1041.025) (-1044.112) [-1045.080] * (-1044.205) (-1042.168) (-1060.424) [-1044.966] -- 0:01:32
719000 -- (-1049.535) [-1041.173] (-1053.570) (-1043.534) * (-1050.932) [-1036.289] (-1051.545) (-1042.457) -- 0:01:31
719500 -- (-1052.036) (-1047.403) (-1069.444) [-1044.420] * [-1037.675] (-1042.404) (-1043.772) (-1045.830) -- 0:01:31
720000 -- (-1059.603) (-1041.437) (-1049.946) [-1041.498] * [-1037.183] (-1042.157) (-1037.254) (-1046.611) -- 0:01:31
Average standard deviation of split frequencies: 0.007346
720500 -- [-1037.723] (-1046.682) (-1052.173) (-1045.446) * (-1040.972) [-1039.814] (-1042.973) (-1046.240) -- 0:01:31
721000 -- [-1038.981] (-1044.684) (-1044.181) (-1043.204) * (-1047.922) [-1037.849] (-1038.357) (-1055.156) -- 0:01:30
721500 -- (-1033.820) (-1045.741) (-1055.189) [-1039.493] * (-1037.574) (-1047.114) (-1043.336) [-1046.399] -- 0:01:31
722000 -- (-1042.089) (-1051.967) [-1048.312] (-1045.353) * [-1048.780] (-1044.555) (-1038.291) (-1040.907) -- 0:01:30
722500 -- (-1054.855) (-1054.113) (-1048.000) [-1049.378] * [-1040.173] (-1045.586) (-1039.426) (-1038.591) -- 0:01:30
723000 -- (-1044.949) (-1051.769) [-1041.474] (-1052.196) * (-1036.897) (-1045.373) [-1040.092] (-1039.774) -- 0:01:30
723500 -- (-1043.121) (-1047.627) (-1048.427) [-1040.916] * (-1049.869) (-1054.090) [-1045.379] (-1038.366) -- 0:01:30
724000 -- (-1037.344) [-1044.589] (-1053.711) (-1053.777) * (-1040.898) (-1045.723) [-1043.287] (-1050.085) -- 0:01:29
724500 -- (-1044.869) (-1053.613) [-1034.558] (-1044.387) * (-1043.805) (-1048.150) (-1041.423) [-1036.157] -- 0:01:30
725000 -- (-1033.978) [-1050.888] (-1046.552) (-1037.614) * (-1037.666) (-1050.010) [-1036.111] (-1049.766) -- 0:01:29
Average standard deviation of split frequencies: 0.006943
725500 -- (-1049.467) (-1041.692) [-1039.725] (-1044.491) * (-1059.467) [-1038.345] (-1040.251) (-1046.633) -- 0:01:29
726000 -- (-1041.338) [-1045.853] (-1042.564) (-1042.697) * (-1036.020) (-1045.718) (-1056.388) [-1045.542] -- 0:01:29
726500 -- (-1037.766) [-1048.242] (-1045.525) (-1041.968) * (-1047.507) [-1044.604] (-1049.670) (-1056.876) -- 0:01:29
727000 -- (-1042.454) (-1046.077) [-1038.882] (-1036.362) * (-1041.833) (-1045.150) [-1040.013] (-1047.398) -- 0:01:28
727500 -- (-1043.554) [-1054.565] (-1042.096) (-1041.011) * (-1042.760) [-1041.540] (-1050.622) (-1040.474) -- 0:01:29
728000 -- (-1037.088) [-1042.642] (-1048.293) (-1041.675) * (-1037.563) [-1032.556] (-1043.159) (-1049.100) -- 0:01:28
728500 -- (-1035.112) [-1039.369] (-1042.390) (-1042.389) * [-1039.425] (-1046.448) (-1047.056) (-1041.295) -- 0:01:28
729000 -- [-1045.904] (-1043.858) (-1041.685) (-1040.325) * (-1038.461) [-1036.710] (-1048.638) (-1039.227) -- 0:01:28
729500 -- [-1039.287] (-1049.137) (-1047.840) (-1056.906) * [-1048.277] (-1044.496) (-1050.151) (-1045.854) -- 0:01:28
730000 -- (-1037.692) [-1054.542] (-1047.066) (-1049.733) * (-1042.805) (-1046.385) [-1034.092] (-1051.754) -- 0:01:28
Average standard deviation of split frequencies: 0.008040
730500 -- (-1043.982) (-1042.511) [-1056.146] (-1048.111) * [-1045.878] (-1051.118) (-1043.885) (-1053.807) -- 0:01:28
731000 -- [-1038.260] (-1041.684) (-1055.744) (-1042.163) * [-1037.140] (-1054.193) (-1040.720) (-1047.151) -- 0:01:27
731500 -- (-1037.366) (-1047.871) [-1047.470] (-1039.888) * (-1044.190) (-1052.452) [-1038.091] (-1052.646) -- 0:01:27
732000 -- [-1041.840] (-1048.070) (-1040.874) (-1040.666) * (-1038.512) (-1045.233) [-1039.309] (-1058.362) -- 0:01:27
732500 -- [-1041.905] (-1052.049) (-1047.919) (-1037.528) * [-1050.591] (-1049.570) (-1048.508) (-1059.534) -- 0:01:27
733000 -- [-1046.458] (-1042.611) (-1035.640) (-1044.497) * (-1043.131) [-1045.438] (-1046.733) (-1061.657) -- 0:01:27
733500 -- (-1046.333) (-1043.526) (-1064.801) [-1038.586] * (-1057.318) (-1039.987) [-1040.483] (-1057.263) -- 0:01:26
734000 -- (-1036.965) (-1046.181) (-1050.830) [-1037.162] * [-1040.001] (-1042.207) (-1046.709) (-1061.806) -- 0:01:26
734500 -- (-1053.486) [-1036.858] (-1052.898) (-1039.033) * (-1042.939) [-1044.641] (-1059.079) (-1059.260) -- 0:01:26
735000 -- [-1032.489] (-1045.563) (-1053.849) (-1039.784) * [-1049.804] (-1042.428) (-1055.452) (-1060.159) -- 0:01:26
Average standard deviation of split frequencies: 0.007587
735500 -- [-1043.624] (-1048.722) (-1050.473) (-1039.927) * (-1036.705) [-1041.947] (-1053.361) (-1059.276) -- 0:01:26
736000 -- (-1040.159) (-1041.185) (-1045.526) [-1041.780] * (-1056.047) (-1045.418) [-1041.604] (-1050.932) -- 0:01:26
736500 -- (-1044.086) (-1038.310) [-1049.272] (-1047.049) * [-1041.121] (-1043.316) (-1043.940) (-1040.879) -- 0:01:25
737000 -- (-1049.748) (-1060.238) [-1042.414] (-1040.559) * [-1041.525] (-1044.573) (-1049.933) (-1041.713) -- 0:01:26
737500 -- (-1046.997) [-1049.266] (-1051.173) (-1045.418) * [-1036.098] (-1038.970) (-1045.483) (-1041.548) -- 0:01:25
738000 -- (-1047.491) (-1047.494) [-1039.926] (-1055.103) * [-1038.328] (-1043.163) (-1051.893) (-1063.113) -- 0:01:25
738500 -- [-1040.449] (-1057.575) (-1055.135) (-1038.898) * (-1041.865) [-1035.171] (-1057.121) (-1042.604) -- 0:01:25
739000 -- (-1052.904) (-1048.077) (-1036.068) [-1039.350] * [-1046.190] (-1041.681) (-1046.058) (-1042.674) -- 0:01:25
739500 -- (-1048.800) (-1053.247) (-1049.448) [-1051.196] * [-1039.239] (-1042.009) (-1053.752) (-1040.381) -- 0:01:24
740000 -- [-1048.800] (-1055.356) (-1055.499) (-1037.793) * (-1041.594) [-1041.861] (-1054.274) (-1043.211) -- 0:01:25
Average standard deviation of split frequencies: 0.007393
740500 -- (-1060.340) [-1036.832] (-1043.843) (-1054.015) * (-1044.347) [-1039.593] (-1051.928) (-1037.902) -- 0:01:24
741000 -- (-1048.561) (-1039.393) [-1033.161] (-1048.125) * (-1052.553) [-1043.525] (-1049.183) (-1036.043) -- 0:01:24
741500 -- (-1051.351) [-1036.211] (-1048.994) (-1048.865) * [-1042.615] (-1042.117) (-1054.109) (-1044.737) -- 0:01:24
742000 -- (-1047.523) (-1055.175) (-1044.279) [-1046.297] * (-1052.545) (-1042.409) [-1036.230] (-1055.660) -- 0:01:24
742500 -- [-1048.051] (-1041.553) (-1045.367) (-1046.855) * (-1057.548) (-1049.791) (-1038.855) [-1041.728] -- 0:01:23
743000 -- (-1055.740) (-1036.817) (-1058.773) [-1042.127] * (-1054.214) (-1040.117) (-1041.561) [-1041.161] -- 0:01:24
743500 -- [-1048.236] (-1050.410) (-1061.651) (-1054.676) * (-1061.368) (-1045.961) [-1036.893] (-1059.543) -- 0:01:23
744000 -- (-1061.415) [-1050.591] (-1053.763) (-1049.422) * [-1054.822] (-1035.948) (-1040.138) (-1053.759) -- 0:01:23
744500 -- [-1044.142] (-1048.525) (-1045.175) (-1048.424) * (-1059.059) [-1034.560] (-1044.485) (-1055.120) -- 0:01:23
745000 -- (-1043.855) [-1043.607] (-1042.489) (-1054.649) * [-1042.348] (-1050.648) (-1045.017) (-1051.604) -- 0:01:23
Average standard deviation of split frequencies: 0.007680
745500 -- (-1058.031) (-1055.526) (-1043.960) [-1047.308] * (-1046.994) [-1046.034] (-1043.361) (-1034.623) -- 0:01:22
746000 -- (-1043.869) (-1055.587) (-1046.536) [-1036.634] * (-1052.340) (-1045.164) (-1056.607) [-1036.524] -- 0:01:23
746500 -- (-1041.279) (-1051.615) [-1043.492] (-1049.088) * [-1044.668] (-1058.706) (-1050.639) (-1042.788) -- 0:01:22
747000 -- (-1040.043) (-1047.639) (-1054.868) [-1044.195] * (-1040.850) [-1037.392] (-1059.260) (-1045.042) -- 0:01:22
747500 -- (-1056.066) (-1050.054) (-1051.260) [-1038.446] * (-1037.350) [-1043.020] (-1045.412) (-1048.582) -- 0:01:22
748000 -- (-1046.026) (-1065.364) (-1057.928) [-1037.920] * (-1052.120) (-1044.155) [-1049.693] (-1043.570) -- 0:01:22
748500 -- (-1040.923) (-1050.822) [-1049.579] (-1044.819) * (-1056.976) [-1040.860] (-1034.675) (-1040.099) -- 0:01:21
749000 -- (-1044.055) (-1069.477) [-1044.139] (-1056.309) * (-1044.747) (-1053.903) [-1034.540] (-1036.976) -- 0:01:21
749500 -- (-1044.019) (-1055.232) (-1037.045) [-1046.619] * (-1047.044) [-1042.399] (-1048.325) (-1041.446) -- 0:01:21
750000 -- (-1053.101) (-1069.892) [-1040.980] (-1040.947) * [-1040.698] (-1035.174) (-1052.784) (-1044.410) -- 0:01:21
Average standard deviation of split frequencies: 0.007681
750500 -- (-1057.103) (-1047.834) (-1040.049) [-1043.327] * (-1038.621) (-1045.990) [-1045.907] (-1044.102) -- 0:01:21
751000 -- (-1047.574) (-1045.937) [-1041.957] (-1042.214) * (-1048.443) (-1041.905) [-1035.517] (-1062.545) -- 0:01:21
751500 -- (-1050.383) [-1039.953] (-1041.560) (-1050.188) * (-1046.473) (-1044.858) (-1049.589) [-1044.553] -- 0:01:21
752000 -- [-1049.226] (-1041.100) (-1042.601) (-1045.299) * (-1031.703) (-1059.615) (-1051.398) [-1038.933] -- 0:01:20
752500 -- [-1046.892] (-1037.791) (-1051.506) (-1054.775) * (-1039.635) (-1043.550) [-1039.416] (-1048.433) -- 0:01:20
753000 -- (-1047.189) (-1050.842) [-1042.361] (-1047.985) * (-1052.403) [-1043.277] (-1036.089) (-1046.452) -- 0:01:20
753500 -- (-1048.946) (-1035.712) (-1050.700) [-1041.028] * [-1050.349] (-1061.918) (-1043.571) (-1047.688) -- 0:01:20
754000 -- [-1045.685] (-1047.008) (-1046.648) (-1054.866) * (-1044.271) (-1046.878) [-1035.246] (-1043.339) -- 0:01:20
754500 -- (-1060.867) [-1038.621] (-1041.127) (-1042.795) * [-1039.603] (-1043.629) (-1043.341) (-1044.430) -- 0:01:20
755000 -- [-1042.068] (-1055.771) (-1043.968) (-1045.178) * (-1043.645) (-1061.619) (-1050.786) [-1048.259] -- 0:01:19
Average standard deviation of split frequencies: 0.008010
755500 -- (-1037.891) [-1039.166] (-1042.547) (-1042.961) * (-1042.994) (-1041.557) (-1044.703) [-1035.874] -- 0:01:19
756000 -- (-1047.932) (-1050.907) (-1046.616) [-1042.973] * (-1035.270) (-1034.735) [-1040.212] (-1033.994) -- 0:01:19
756500 -- (-1054.010) [-1041.359] (-1053.236) (-1060.829) * [-1038.067] (-1042.986) (-1040.835) (-1041.185) -- 0:01:19
757000 -- (-1040.044) [-1037.625] (-1044.987) (-1063.316) * [-1037.876] (-1054.575) (-1035.399) (-1044.811) -- 0:01:19
757500 -- (-1052.998) [-1038.537] (-1036.386) (-1055.485) * (-1044.775) (-1067.706) (-1061.905) [-1038.752] -- 0:01:19
758000 -- (-1055.281) [-1034.618] (-1049.266) (-1038.859) * (-1046.140) [-1044.482] (-1061.942) (-1045.457) -- 0:01:18
758500 -- [-1043.795] (-1051.986) (-1044.132) (-1040.222) * [-1032.387] (-1048.833) (-1041.414) (-1046.127) -- 0:01:18
759000 -- (-1049.137) (-1040.571) (-1047.113) [-1034.112] * [-1035.575] (-1042.198) (-1035.644) (-1051.840) -- 0:01:18
759500 -- [-1035.420] (-1046.968) (-1034.077) (-1060.828) * (-1046.477) [-1041.358] (-1039.086) (-1046.928) -- 0:01:18
760000 -- (-1042.643) [-1040.453] (-1037.772) (-1044.036) * (-1035.306) [-1037.135] (-1056.990) (-1050.918) -- 0:01:18
Average standard deviation of split frequencies: 0.008009
760500 -- (-1045.106) [-1045.549] (-1047.074) (-1035.242) * (-1036.574) [-1041.963] (-1050.773) (-1045.453) -- 0:01:18
761000 -- [-1038.503] (-1033.914) (-1038.602) (-1045.853) * (-1038.485) (-1050.735) (-1049.818) [-1048.341] -- 0:01:17
761500 -- [-1043.933] (-1047.856) (-1053.968) (-1045.800) * [-1048.001] (-1045.577) (-1034.571) (-1041.576) -- 0:01:17
762000 -- (-1047.939) [-1034.209] (-1039.347) (-1055.479) * (-1041.100) (-1046.253) [-1037.435] (-1046.130) -- 0:01:17
762500 -- [-1039.599] (-1036.559) (-1050.633) (-1045.738) * [-1035.266] (-1051.371) (-1045.968) (-1055.936) -- 0:01:17
763000 -- [-1036.355] (-1049.341) (-1065.769) (-1043.427) * [-1043.418] (-1039.778) (-1056.024) (-1050.718) -- 0:01:17
763500 -- (-1041.400) [-1045.283] (-1059.153) (-1045.672) * (-1038.022) [-1034.947] (-1056.535) (-1041.484) -- 0:01:17
764000 -- [-1047.553] (-1036.460) (-1049.341) (-1050.648) * (-1040.524) (-1046.046) (-1059.086) [-1037.436] -- 0:01:16
764500 -- (-1044.599) [-1040.744] (-1043.492) (-1046.700) * [-1050.151] (-1043.320) (-1052.615) (-1050.159) -- 0:01:17
765000 -- [-1033.919] (-1039.080) (-1044.881) (-1051.495) * [-1049.049] (-1038.037) (-1037.020) (-1041.023) -- 0:01:16
Average standard deviation of split frequencies: 0.007622
765500 -- (-1046.572) (-1049.246) (-1046.821) [-1046.666] * (-1047.203) [-1033.995] (-1046.040) (-1047.132) -- 0:01:16
766000 -- [-1036.247] (-1045.300) (-1051.655) (-1046.896) * (-1048.941) (-1040.352) (-1035.915) [-1029.148] -- 0:01:16
766500 -- (-1049.235) [-1036.387] (-1045.770) (-1053.636) * (-1047.277) [-1036.228] (-1044.945) (-1037.916) -- 0:01:16
767000 -- (-1045.972) (-1049.387) [-1039.147] (-1038.625) * [-1047.685] (-1044.813) (-1051.908) (-1042.361) -- 0:01:15
767500 -- (-1047.375) (-1041.500) (-1043.549) [-1036.661] * (-1045.885) (-1037.163) [-1045.457] (-1040.870) -- 0:01:16
768000 -- (-1039.515) [-1044.272] (-1045.102) (-1040.295) * (-1048.665) (-1047.768) [-1037.469] (-1038.653) -- 0:01:15
768500 -- (-1039.291) (-1043.661) [-1046.181] (-1046.394) * (-1032.483) (-1045.963) (-1038.763) [-1036.507] -- 0:01:15
769000 -- (-1050.057) (-1046.271) [-1046.228] (-1039.767) * (-1043.178) [-1039.396] (-1051.055) (-1044.361) -- 0:01:15
769500 -- [-1041.934] (-1044.217) (-1036.964) (-1047.570) * (-1042.925) [-1044.997] (-1041.486) (-1045.018) -- 0:01:15
770000 -- (-1048.568) (-1049.896) [-1039.465] (-1038.327) * (-1041.703) (-1055.037) [-1044.402] (-1054.440) -- 0:01:14
Average standard deviation of split frequencies: 0.007575
770500 -- (-1051.811) [-1034.699] (-1052.028) (-1042.974) * (-1039.259) (-1046.953) (-1041.109) [-1048.280] -- 0:01:15
771000 -- (-1045.072) (-1039.627) (-1040.287) [-1040.175] * (-1048.268) (-1045.653) [-1041.246] (-1046.742) -- 0:01:14
771500 -- (-1055.086) [-1042.781] (-1049.558) (-1049.507) * (-1052.759) [-1039.896] (-1039.223) (-1050.410) -- 0:01:14
772000 -- (-1051.161) (-1047.162) [-1043.487] (-1050.434) * (-1046.346) (-1052.019) (-1050.580) [-1035.707] -- 0:01:14
772500 -- (-1046.902) [-1041.345] (-1042.484) (-1045.494) * (-1045.319) (-1054.354) (-1046.027) [-1036.957] -- 0:01:14
773000 -- (-1047.564) (-1044.729) (-1043.915) [-1037.346] * (-1052.116) [-1036.971] (-1042.685) (-1044.726) -- 0:01:14
773500 -- [-1040.409] (-1040.617) (-1045.475) (-1050.475) * (-1037.894) (-1058.566) [-1052.035] (-1041.055) -- 0:01:14
774000 -- (-1041.909) [-1043.901] (-1043.175) (-1048.866) * (-1045.312) (-1055.929) [-1043.882] (-1039.746) -- 0:01:13
774500 -- [-1039.644] (-1049.874) (-1034.514) (-1048.921) * (-1040.353) (-1040.931) [-1034.881] (-1045.244) -- 0:01:13
775000 -- (-1039.544) (-1043.340) (-1041.177) [-1035.574] * (-1044.768) (-1054.781) (-1046.137) [-1040.926] -- 0:01:13
Average standard deviation of split frequencies: 0.007523
775500 -- [-1030.667] (-1047.516) (-1047.215) (-1045.146) * (-1040.360) (-1045.739) (-1042.051) [-1041.886] -- 0:01:13
776000 -- (-1039.082) (-1043.263) (-1047.614) [-1047.091] * (-1054.732) (-1054.359) (-1058.281) [-1044.929] -- 0:01:13
776500 -- (-1041.097) (-1054.842) [-1037.547] (-1045.174) * (-1048.218) [-1034.051] (-1058.012) (-1046.502) -- 0:01:13
777000 -- (-1052.839) (-1055.108) [-1044.205] (-1039.713) * (-1055.966) (-1041.110) [-1037.533] (-1033.633) -- 0:01:12
777500 -- (-1039.944) (-1050.237) (-1049.646) [-1032.744] * (-1049.305) (-1050.407) [-1041.666] (-1048.517) -- 0:01:12
778000 -- (-1060.898) (-1050.644) (-1038.616) [-1044.986] * (-1044.544) (-1044.475) (-1055.323) [-1045.525] -- 0:01:12
778500 -- (-1051.479) (-1052.323) (-1042.606) [-1035.171] * [-1046.869] (-1041.552) (-1048.026) (-1066.755) -- 0:01:12
779000 -- (-1049.222) (-1053.591) [-1048.389] (-1042.666) * (-1046.107) (-1034.924) (-1056.385) [-1049.906] -- 0:01:12
779500 -- (-1037.511) (-1056.736) (-1056.910) [-1043.382] * [-1044.950] (-1039.993) (-1045.938) (-1060.177) -- 0:01:12
780000 -- (-1047.657) (-1062.807) [-1048.981] (-1044.877) * [-1037.326] (-1044.271) (-1055.660) (-1048.151) -- 0:01:11
Average standard deviation of split frequencies: 0.007153
780500 -- (-1045.196) (-1055.522) [-1045.614] (-1059.982) * (-1036.476) (-1045.902) (-1050.363) [-1045.423] -- 0:01:11
781000 -- (-1051.300) (-1044.684) (-1041.481) [-1044.352] * [-1035.296] (-1040.150) (-1065.490) (-1050.744) -- 0:01:11
781500 -- (-1051.271) (-1045.527) (-1048.617) [-1035.780] * (-1047.029) [-1046.090] (-1041.497) (-1052.065) -- 0:01:11
782000 -- [-1040.852] (-1049.259) (-1042.912) (-1037.078) * [-1043.667] (-1036.865) (-1047.409) (-1037.302) -- 0:01:11
782500 -- (-1041.877) (-1037.356) (-1049.633) [-1047.473] * [-1033.309] (-1034.871) (-1054.705) (-1042.531) -- 0:01:11
783000 -- (-1042.891) [-1034.169] (-1061.240) (-1046.305) * [-1040.055] (-1042.185) (-1053.124) (-1054.154) -- 0:01:10
783500 -- (-1036.910) [-1037.413] (-1070.022) (-1049.216) * (-1046.216) [-1041.894] (-1042.772) (-1034.640) -- 0:01:10
784000 -- [-1034.959] (-1037.315) (-1050.444) (-1041.556) * [-1037.497] (-1047.074) (-1050.570) (-1051.856) -- 0:01:10
784500 -- [-1048.930] (-1040.562) (-1059.095) (-1044.680) * (-1051.092) (-1047.573) (-1036.486) [-1041.173] -- 0:01:10
785000 -- (-1056.186) [-1042.230] (-1043.201) (-1046.865) * (-1042.787) (-1041.005) (-1049.900) [-1043.267] -- 0:01:10
Average standard deviation of split frequencies: 0.007105
785500 -- (-1057.271) (-1050.301) [-1046.154] (-1036.979) * (-1041.345) (-1051.030) (-1047.562) [-1052.571] -- 0:01:10
786000 -- (-1047.209) (-1052.581) [-1042.065] (-1058.886) * (-1061.837) [-1047.904] (-1042.633) (-1053.022) -- 0:01:09
786500 -- [-1039.174] (-1040.914) (-1043.734) (-1049.459) * (-1050.523) (-1042.140) [-1037.971] (-1058.846) -- 0:01:09
787000 -- (-1042.014) [-1039.290] (-1051.973) (-1045.753) * (-1048.564) [-1046.292] (-1044.173) (-1041.546) -- 0:01:09
787500 -- (-1050.805) (-1054.500) [-1049.167] (-1046.430) * (-1047.957) [-1046.389] (-1038.433) (-1045.309) -- 0:01:09
788000 -- (-1051.516) [-1042.670] (-1039.956) (-1053.310) * (-1041.195) (-1042.226) [-1046.512] (-1062.419) -- 0:01:09
788500 -- [-1036.454] (-1044.783) (-1042.074) (-1044.842) * (-1050.440) (-1042.004) [-1043.145] (-1047.702) -- 0:01:08
789000 -- [-1044.327] (-1045.227) (-1050.821) (-1048.304) * (-1043.350) [-1040.501] (-1070.921) (-1052.048) -- 0:01:08
789500 -- [-1035.108] (-1051.638) (-1049.913) (-1045.722) * (-1039.426) [-1043.949] (-1046.408) (-1055.538) -- 0:01:08
790000 -- [-1042.270] (-1050.467) (-1058.925) (-1048.108) * [-1044.114] (-1045.977) (-1045.498) (-1047.701) -- 0:01:08
Average standard deviation of split frequencies: 0.007430
790500 -- [-1038.587] (-1051.545) (-1050.427) (-1049.416) * (-1052.634) (-1045.797) [-1038.857] (-1047.938) -- 0:01:08
791000 -- (-1055.593) [-1044.784] (-1040.041) (-1044.219) * (-1050.211) (-1049.686) [-1045.872] (-1056.154) -- 0:01:08
791500 -- (-1049.887) [-1046.139] (-1043.089) (-1049.047) * (-1053.231) (-1047.030) (-1044.491) [-1045.076] -- 0:01:07
792000 -- [-1046.020] (-1050.425) (-1043.310) (-1067.834) * [-1044.242] (-1039.663) (-1054.061) (-1047.642) -- 0:01:08
792500 -- (-1052.205) [-1049.797] (-1049.381) (-1035.792) * (-1046.450) (-1052.269) (-1044.866) [-1039.661] -- 0:01:07
793000 -- [-1030.805] (-1049.297) (-1046.181) (-1046.898) * (-1047.371) (-1049.852) (-1041.845) [-1039.288] -- 0:01:07
793500 -- (-1036.156) [-1046.003] (-1039.838) (-1042.331) * (-1048.683) (-1045.496) [-1043.823] (-1038.377) -- 0:01:07
794000 -- (-1042.934) [-1043.333] (-1046.557) (-1044.616) * (-1034.913) [-1044.208] (-1039.634) (-1046.010) -- 0:01:07
794500 -- (-1045.448) (-1050.124) [-1044.045] (-1054.587) * [-1043.157] (-1055.139) (-1048.373) (-1053.136) -- 0:01:06
795000 -- (-1047.944) (-1044.694) [-1041.577] (-1038.624) * (-1045.744) (-1050.201) [-1031.745] (-1038.709) -- 0:01:07
Average standard deviation of split frequencies: 0.007881
795500 -- [-1049.545] (-1049.080) (-1049.016) (-1050.391) * [-1044.191] (-1052.303) (-1043.721) (-1058.299) -- 0:01:06
796000 -- (-1039.473) (-1045.016) (-1049.731) [-1050.286] * (-1039.128) (-1054.028) [-1049.383] (-1048.482) -- 0:01:06
796500 -- [-1037.661] (-1043.723) (-1043.103) (-1042.777) * (-1044.752) (-1053.589) [-1046.067] (-1038.558) -- 0:01:06
797000 -- [-1036.714] (-1050.095) (-1036.259) (-1058.174) * [-1038.116] (-1049.221) (-1050.398) (-1039.728) -- 0:01:06
797500 -- [-1041.963] (-1050.785) (-1045.992) (-1041.208) * (-1048.222) (-1049.609) (-1042.596) [-1044.548] -- 0:01:06
798000 -- (-1041.746) [-1047.437] (-1061.041) (-1045.621) * (-1037.872) (-1059.205) (-1047.832) [-1047.131] -- 0:01:06
798500 -- (-1040.272) (-1042.291) (-1046.211) [-1049.841] * (-1045.003) (-1056.896) [-1038.245] (-1038.975) -- 0:01:05
799000 -- (-1056.454) (-1039.329) [-1042.822] (-1042.913) * (-1052.497) (-1054.584) (-1050.865) [-1037.106] -- 0:01:05
799500 -- [-1041.420] (-1044.439) (-1047.597) (-1048.247) * (-1064.909) (-1048.770) [-1047.350] (-1040.575) -- 0:01:05
800000 -- (-1050.310) (-1040.387) [-1039.667] (-1044.831) * (-1058.398) (-1057.497) [-1038.449] (-1038.751) -- 0:01:05
Average standard deviation of split frequencies: 0.007835
800500 -- (-1044.537) (-1039.432) (-1042.428) [-1037.598] * (-1065.900) [-1044.190] (-1054.404) (-1044.699) -- 0:01:05
801000 -- (-1047.778) [-1043.004] (-1047.914) (-1045.902) * [-1046.259] (-1040.788) (-1037.240) (-1040.694) -- 0:01:05
801500 -- (-1049.862) (-1063.839) (-1037.066) [-1037.197] * (-1042.406) [-1042.437] (-1052.210) (-1041.853) -- 0:01:04
802000 -- (-1046.300) (-1051.255) (-1041.607) [-1036.672] * (-1048.598) [-1045.764] (-1039.733) (-1041.798) -- 0:01:04
802500 -- (-1045.700) (-1043.042) (-1046.927) [-1036.397] * (-1048.321) (-1050.196) (-1051.495) [-1046.865] -- 0:01:04
803000 -- (-1055.274) [-1037.235] (-1054.130) (-1047.139) * (-1045.260) [-1039.291] (-1042.311) (-1036.735) -- 0:01:04
803500 -- (-1043.847) (-1047.271) [-1032.659] (-1036.982) * (-1047.767) (-1038.804) (-1047.034) [-1036.039] -- 0:01:04
804000 -- (-1048.236) [-1043.579] (-1036.347) (-1040.064) * (-1039.548) (-1038.797) [-1037.549] (-1049.981) -- 0:01:04
804500 -- [-1045.141] (-1048.506) (-1044.626) (-1055.296) * (-1038.778) (-1057.056) (-1037.063) [-1038.476] -- 0:01:03
805000 -- [-1044.749] (-1038.527) (-1045.487) (-1035.379) * (-1046.580) [-1047.534] (-1042.401) (-1046.534) -- 0:01:03
Average standard deviation of split frequencies: 0.007873
805500 -- (-1046.091) (-1044.776) (-1050.988) [-1041.021] * (-1044.484) (-1042.461) [-1034.852] (-1044.979) -- 0:01:03
806000 -- [-1049.842] (-1038.507) (-1045.752) (-1043.592) * (-1045.702) (-1056.014) [-1047.015] (-1035.381) -- 0:01:03
806500 -- (-1042.474) (-1048.527) (-1041.396) [-1035.007] * (-1032.930) [-1037.768] (-1047.129) (-1044.412) -- 0:01:03
807000 -- [-1041.682] (-1036.363) (-1038.524) (-1056.456) * (-1043.362) [-1033.986] (-1036.214) (-1051.346) -- 0:01:03
807500 -- [-1036.855] (-1042.673) (-1049.355) (-1041.655) * (-1048.555) [-1035.396] (-1045.916) (-1058.135) -- 0:01:02
808000 -- [-1039.363] (-1038.110) (-1041.955) (-1038.426) * [-1037.703] (-1047.268) (-1045.810) (-1048.996) -- 0:01:02
808500 -- (-1042.284) [-1049.740] (-1047.997) (-1053.567) * (-1034.546) [-1050.474] (-1057.388) (-1041.154) -- 0:01:02
809000 -- [-1042.791] (-1041.190) (-1043.501) (-1047.364) * (-1054.071) (-1043.720) (-1041.281) [-1038.315] -- 0:01:02
809500 -- [-1059.130] (-1066.240) (-1041.253) (-1046.158) * (-1055.535) (-1037.732) [-1038.996] (-1043.199) -- 0:01:02
810000 -- (-1046.371) (-1046.685) (-1056.606) [-1039.823] * (-1047.346) (-1039.965) [-1039.869] (-1039.904) -- 0:01:02
Average standard deviation of split frequencies: 0.008588
810500 -- (-1041.452) (-1044.265) (-1045.070) [-1048.932] * (-1040.814) (-1049.368) [-1033.772] (-1033.470) -- 0:01:01
811000 -- (-1048.920) [-1040.153] (-1042.140) (-1054.957) * (-1038.000) (-1057.160) [-1043.003] (-1043.700) -- 0:01:01
811500 -- (-1043.967) (-1040.334) [-1032.844] (-1054.592) * (-1058.142) (-1037.796) (-1044.263) [-1034.790] -- 0:01:01
812000 -- (-1043.905) (-1042.030) (-1041.300) [-1051.718] * (-1031.974) (-1053.597) (-1040.539) [-1037.652] -- 0:01:01
812500 -- (-1044.128) (-1049.740) (-1038.965) [-1039.440] * (-1035.212) (-1048.669) (-1041.233) [-1036.233] -- 0:01:01
813000 -- [-1032.406] (-1051.274) (-1040.042) (-1044.496) * (-1044.797) [-1046.225] (-1034.951) (-1050.357) -- 0:01:01
813500 -- (-1043.946) [-1047.125] (-1045.618) (-1042.783) * (-1034.839) [-1041.508] (-1060.652) (-1047.819) -- 0:01:00
814000 -- (-1038.283) (-1057.413) (-1048.790) [-1048.706] * (-1053.723) (-1045.081) [-1042.045] (-1038.601) -- 0:01:00
814500 -- [-1040.200] (-1049.942) (-1035.830) (-1044.876) * (-1045.653) (-1047.472) [-1040.743] (-1038.386) -- 0:01:00
815000 -- (-1036.826) [-1040.006] (-1042.247) (-1057.841) * (-1042.064) (-1036.545) [-1040.866] (-1048.620) -- 0:01:00
Average standard deviation of split frequencies: 0.007955
815500 -- [-1041.690] (-1046.537) (-1043.451) (-1051.810) * (-1038.362) [-1037.516] (-1039.065) (-1053.506) -- 0:01:00
816000 -- (-1034.484) [-1042.497] (-1044.061) (-1044.386) * (-1043.985) (-1054.271) (-1041.143) [-1046.201] -- 0:01:00
816500 -- [-1032.467] (-1047.964) (-1050.582) (-1065.916) * [-1035.105] (-1042.625) (-1043.228) (-1047.054) -- 0:01:00
817000 -- [-1036.887] (-1055.629) (-1040.423) (-1049.337) * [-1038.383] (-1041.006) (-1043.548) (-1058.867) -- 0:00:59
817500 -- (-1042.202) (-1041.886) (-1046.984) [-1047.854] * [-1039.450] (-1051.679) (-1037.882) (-1044.411) -- 0:00:59
818000 -- (-1045.021) (-1042.042) [-1049.480] (-1048.006) * (-1042.736) (-1063.764) [-1041.963] (-1041.641) -- 0:00:59
818500 -- (-1052.034) (-1051.142) (-1038.783) [-1040.604] * [-1040.295] (-1054.218) (-1045.832) (-1044.728) -- 0:00:59
819000 -- (-1050.248) (-1044.411) (-1041.951) [-1048.901] * (-1042.944) (-1045.743) [-1048.471] (-1045.070) -- 0:00:59
819500 -- (-1052.728) (-1049.110) (-1041.864) [-1033.929] * [-1045.784] (-1045.686) (-1049.631) (-1058.462) -- 0:00:59
820000 -- (-1047.654) [-1049.837] (-1051.430) (-1050.383) * [-1043.010] (-1043.449) (-1049.294) (-1050.112) -- 0:00:58
Average standard deviation of split frequencies: 0.008351
820500 -- (-1045.643) (-1049.756) [-1034.805] (-1050.293) * (-1047.095) [-1038.529] (-1045.336) (-1048.424) -- 0:00:58
821000 -- (-1044.849) [-1041.610] (-1035.695) (-1043.992) * [-1041.884] (-1037.538) (-1048.929) (-1057.454) -- 0:00:58
821500 -- (-1045.388) (-1041.959) [-1041.391] (-1049.775) * [-1046.444] (-1038.092) (-1054.021) (-1057.985) -- 0:00:58
822000 -- (-1044.518) [-1037.773] (-1040.539) (-1048.709) * [-1034.780] (-1042.916) (-1046.833) (-1046.099) -- 0:00:58
822500 -- (-1037.597) (-1046.726) [-1032.199] (-1061.876) * [-1036.464] (-1048.592) (-1048.319) (-1051.943) -- 0:00:58
823000 -- [-1044.094] (-1039.469) (-1041.090) (-1052.498) * (-1035.565) (-1049.804) [-1041.982] (-1044.571) -- 0:00:57
823500 -- [-1043.611] (-1039.701) (-1037.116) (-1049.503) * [-1045.480] (-1038.218) (-1048.220) (-1047.490) -- 0:00:57
824000 -- [-1037.785] (-1047.790) (-1054.099) (-1039.680) * [-1049.184] (-1046.166) (-1050.156) (-1039.504) -- 0:00:57
824500 -- (-1048.855) [-1039.759] (-1034.857) (-1059.762) * [-1046.415] (-1044.100) (-1041.690) (-1045.135) -- 0:00:57
825000 -- (-1034.649) [-1046.560] (-1044.226) (-1038.530) * (-1043.701) (-1044.876) [-1044.033] (-1048.827) -- 0:00:57
Average standard deviation of split frequencies: 0.008034
825500 -- (-1049.073) (-1058.246) (-1042.047) [-1041.845] * (-1039.708) (-1047.600) (-1048.968) [-1039.473] -- 0:00:57
826000 -- (-1036.636) [-1045.971] (-1054.350) (-1045.713) * (-1047.577) [-1035.076] (-1042.679) (-1038.117) -- 0:00:56
826500 -- (-1035.595) (-1048.382) (-1048.339) [-1044.097] * (-1060.333) (-1039.655) [-1036.826] (-1043.127) -- 0:00:56
827000 -- (-1033.764) (-1043.011) (-1049.103) [-1036.862] * (-1043.655) [-1035.416] (-1050.335) (-1045.404) -- 0:00:56
827500 -- (-1048.754) (-1040.905) [-1048.748] (-1050.911) * (-1049.662) (-1045.604) [-1039.640] (-1050.830) -- 0:00:56
828000 -- (-1053.483) [-1035.150] (-1049.026) (-1038.621) * (-1048.001) (-1052.043) [-1035.890] (-1037.056) -- 0:00:56
828500 -- (-1046.484) (-1048.131) (-1039.384) [-1041.107] * (-1037.891) (-1044.838) (-1052.242) [-1033.709] -- 0:00:56
829000 -- (-1044.173) (-1052.783) (-1045.684) [-1058.166] * (-1056.828) (-1051.804) (-1048.945) [-1038.207] -- 0:00:55
829500 -- [-1034.861] (-1061.508) (-1044.329) (-1045.099) * (-1053.359) (-1047.271) [-1044.552] (-1045.605) -- 0:00:55
830000 -- (-1046.570) (-1059.834) (-1060.085) [-1036.126] * (-1048.255) [-1039.523] (-1044.421) (-1057.760) -- 0:00:55
Average standard deviation of split frequencies: 0.007989
830500 -- (-1051.851) (-1050.114) [-1043.776] (-1048.679) * (-1049.748) (-1049.666) [-1038.156] (-1056.267) -- 0:00:55
831000 -- (-1040.462) [-1032.110] (-1050.633) (-1053.426) * (-1056.265) (-1065.123) (-1043.952) [-1042.933] -- 0:00:55
831500 -- [-1037.362] (-1040.194) (-1039.379) (-1046.244) * (-1051.428) [-1051.858] (-1042.051) (-1051.295) -- 0:00:55
832000 -- (-1043.436) (-1049.179) (-1041.988) [-1044.818] * (-1052.496) (-1044.593) [-1045.306] (-1044.834) -- 0:00:54
832500 -- (-1045.542) [-1038.467] (-1041.503) (-1057.485) * (-1039.086) (-1044.017) [-1052.467] (-1046.365) -- 0:00:54
833000 -- (-1042.624) [-1040.136] (-1044.121) (-1051.991) * (-1047.832) (-1046.014) (-1038.695) [-1041.216] -- 0:00:54
833500 -- (-1043.075) (-1050.807) [-1050.198] (-1053.303) * (-1066.180) (-1048.009) (-1043.561) [-1045.467] -- 0:00:54
834000 -- (-1042.903) (-1060.062) (-1047.484) [-1034.376] * [-1055.305] (-1045.970) (-1048.591) (-1043.582) -- 0:00:54
834500 -- (-1044.769) [-1043.576] (-1046.720) (-1046.889) * (-1063.094) (-1045.834) (-1041.114) [-1044.944] -- 0:00:54
835000 -- (-1046.837) (-1045.874) (-1041.903) [-1041.467] * (-1054.692) [-1053.016] (-1043.872) (-1047.425) -- 0:00:54
Average standard deviation of split frequencies: 0.007634
835500 -- (-1047.441) [-1041.921] (-1036.915) (-1038.336) * (-1034.286) (-1049.863) (-1053.169) [-1031.649] -- 0:00:53
836000 -- (-1038.598) [-1038.340] (-1036.871) (-1042.119) * (-1046.373) (-1050.628) (-1045.740) [-1039.772] -- 0:00:53
836500 -- (-1043.737) (-1050.437) (-1044.018) [-1040.365] * (-1053.313) (-1042.096) (-1046.391) [-1039.623] -- 0:00:53
837000 -- [-1038.990] (-1044.887) (-1048.669) (-1044.365) * (-1041.485) [-1049.452] (-1045.740) (-1040.820) -- 0:00:53
837500 -- (-1046.372) [-1045.754] (-1046.503) (-1061.072) * (-1049.979) (-1051.918) (-1052.417) [-1044.683] -- 0:00:53
838000 -- (-1052.064) (-1056.157) (-1049.369) [-1043.524] * [-1052.614] (-1040.000) (-1040.280) (-1046.068) -- 0:00:53
838500 -- (-1047.588) (-1038.138) [-1040.626] (-1048.415) * (-1038.727) (-1042.450) [-1038.776] (-1038.917) -- 0:00:52
839000 -- (-1061.137) [-1037.688] (-1043.056) (-1045.253) * [-1039.831] (-1048.632) (-1048.071) (-1043.187) -- 0:00:52
839500 -- [-1051.302] (-1039.180) (-1042.063) (-1043.363) * (-1043.326) [-1037.004] (-1048.745) (-1054.397) -- 0:00:52
840000 -- (-1040.260) (-1051.893) [-1038.795] (-1041.181) * (-1049.519) (-1045.306) (-1052.889) [-1045.431] -- 0:00:52
Average standard deviation of split frequencies: 0.006902
840500 -- (-1070.606) (-1048.063) [-1031.833] (-1047.990) * (-1038.743) [-1043.092] (-1062.990) (-1041.507) -- 0:00:52
841000 -- (-1042.744) [-1041.812] (-1039.154) (-1045.997) * (-1056.897) (-1053.499) (-1047.593) [-1038.702] -- 0:00:52
841500 -- (-1047.399) (-1045.627) [-1034.591] (-1049.506) * (-1047.592) [-1045.872] (-1059.327) (-1054.264) -- 0:00:51
842000 -- (-1056.854) [-1041.254] (-1043.864) (-1052.440) * [-1036.652] (-1048.886) (-1048.628) (-1041.610) -- 0:00:51
842500 -- (-1052.927) [-1043.617] (-1040.176) (-1046.933) * [-1046.920] (-1036.367) (-1046.397) (-1045.509) -- 0:00:51
843000 -- (-1048.411) [-1042.873] (-1046.782) (-1040.624) * (-1058.231) (-1048.146) [-1036.893] (-1037.209) -- 0:00:51
843500 -- (-1056.736) (-1040.707) [-1038.549] (-1046.054) * [-1041.100] (-1050.103) (-1047.721) (-1037.943) -- 0:00:51
844000 -- (-1038.633) (-1043.120) [-1038.245] (-1053.474) * (-1045.552) (-1047.831) (-1040.463) [-1035.395] -- 0:00:51
844500 -- [-1040.245] (-1041.349) (-1037.083) (-1046.217) * (-1048.501) (-1040.077) [-1051.025] (-1045.165) -- 0:00:51
845000 -- [-1034.047] (-1045.787) (-1040.996) (-1044.149) * (-1051.019) (-1039.387) (-1045.752) [-1037.907] -- 0:00:50
Average standard deviation of split frequencies: 0.006858
845500 -- [-1044.063] (-1044.281) (-1054.787) (-1053.243) * (-1043.893) (-1044.598) (-1045.953) [-1044.405] -- 0:00:50
846000 -- (-1048.278) [-1039.080] (-1041.152) (-1041.861) * (-1058.821) (-1050.183) (-1047.611) [-1043.572] -- 0:00:50
846500 -- (-1048.118) (-1059.936) [-1036.715] (-1054.924) * (-1050.579) (-1051.550) [-1039.920] (-1035.704) -- 0:00:50
847000 -- [-1039.508] (-1039.706) (-1043.126) (-1050.023) * (-1039.580) [-1035.320] (-1042.877) (-1059.879) -- 0:00:50
847500 -- (-1050.198) [-1038.672] (-1057.710) (-1042.625) * [-1036.964] (-1056.103) (-1049.066) (-1043.256) -- 0:00:50
848000 -- (-1041.586) (-1051.508) [-1043.598] (-1042.735) * [-1037.856] (-1039.111) (-1046.038) (-1042.965) -- 0:00:49
848500 -- [-1046.817] (-1049.617) (-1052.928) (-1035.095) * [-1038.886] (-1046.639) (-1038.080) (-1040.579) -- 0:00:49
849000 -- (-1054.714) (-1049.987) (-1050.535) [-1045.518] * (-1046.984) [-1037.229] (-1045.172) (-1045.786) -- 0:00:49
849500 -- (-1046.262) (-1044.066) (-1055.951) [-1044.242] * (-1039.823) (-1046.171) (-1048.032) [-1038.306] -- 0:00:49
850000 -- (-1053.268) (-1054.040) [-1040.183] (-1042.503) * (-1045.634) (-1048.015) (-1051.460) [-1046.564] -- 0:00:49
Average standard deviation of split frequencies: 0.006735
850500 -- [-1047.692] (-1047.205) (-1054.503) (-1050.863) * [-1047.107] (-1050.551) (-1051.393) (-1042.871) -- 0:00:49
851000 -- [-1044.166] (-1062.433) (-1037.221) (-1052.462) * (-1057.235) (-1059.707) [-1042.656] (-1043.737) -- 0:00:48
851500 -- (-1047.482) [-1045.687] (-1043.580) (-1057.140) * [-1047.623] (-1049.928) (-1054.486) (-1053.518) -- 0:00:48
852000 -- (-1045.549) (-1052.905) [-1042.108] (-1045.037) * (-1040.618) [-1034.912] (-1051.506) (-1042.830) -- 0:00:48
852500 -- [-1029.625] (-1043.318) (-1044.074) (-1048.762) * (-1041.041) (-1036.870) [-1047.934] (-1058.590) -- 0:00:48
853000 -- [-1032.887] (-1053.309) (-1045.146) (-1037.546) * (-1048.433) (-1035.127) (-1055.831) [-1039.985] -- 0:00:48
853500 -- (-1036.437) (-1045.689) [-1040.716] (-1058.514) * (-1048.708) (-1050.991) (-1052.567) [-1041.071] -- 0:00:48
854000 -- (-1043.795) [-1045.803] (-1065.944) (-1049.436) * (-1048.850) (-1045.668) [-1042.204] (-1044.884) -- 0:00:47
854500 -- (-1062.589) (-1045.227) (-1041.980) [-1044.828] * (-1042.912) [-1045.865] (-1041.677) (-1049.512) -- 0:00:47
855000 -- [-1041.611] (-1043.395) (-1043.710) (-1049.112) * (-1043.750) (-1045.390) [-1041.346] (-1044.161) -- 0:00:47
Average standard deviation of split frequencies: 0.006439
855500 -- (-1052.000) (-1051.062) (-1043.506) [-1042.895] * (-1048.396) [-1038.330] (-1046.765) (-1046.801) -- 0:00:47
856000 -- (-1046.961) (-1069.510) (-1057.987) [-1043.093] * (-1055.313) (-1055.140) (-1053.759) [-1047.473] -- 0:00:47
856500 -- (-1039.485) [-1040.022] (-1046.558) (-1062.077) * [-1042.805] (-1052.155) (-1042.570) (-1039.479) -- 0:00:47
857000 -- [-1038.791] (-1045.949) (-1060.564) (-1050.713) * [-1041.655] (-1050.853) (-1052.436) (-1043.623) -- 0:00:46
857500 -- (-1045.410) [-1048.287] (-1043.656) (-1049.914) * (-1043.625) (-1042.104) [-1039.439] (-1047.434) -- 0:00:46
858000 -- (-1044.993) [-1045.644] (-1054.420) (-1045.741) * (-1048.578) [-1052.984] (-1053.423) (-1050.525) -- 0:00:46
858500 -- (-1036.402) (-1048.638) (-1053.622) [-1035.199] * (-1063.429) (-1041.805) [-1043.755] (-1049.359) -- 0:00:46
859000 -- (-1053.194) (-1031.198) (-1062.914) [-1041.293] * (-1055.482) (-1049.889) (-1043.979) [-1041.862] -- 0:00:46
859500 -- (-1043.424) (-1047.199) [-1048.549] (-1050.674) * [-1047.811] (-1047.783) (-1043.514) (-1041.794) -- 0:00:46
860000 -- (-1046.610) [-1030.380] (-1051.117) (-1046.801) * (-1056.646) (-1051.589) (-1036.154) [-1034.280] -- 0:00:45
Average standard deviation of split frequencies: 0.006531
860500 -- (-1045.839) (-1038.099) [-1049.532] (-1048.533) * (-1044.501) (-1041.697) [-1036.545] (-1051.542) -- 0:00:45
861000 -- (-1051.367) [-1044.389] (-1052.683) (-1039.714) * (-1061.921) [-1047.688] (-1047.069) (-1062.211) -- 0:00:45
861500 -- [-1045.244] (-1043.002) (-1051.433) (-1041.858) * [-1043.891] (-1055.474) (-1036.664) (-1047.786) -- 0:00:45
862000 -- [-1037.925] (-1046.938) (-1048.621) (-1039.409) * (-1040.579) (-1043.181) [-1039.144] (-1050.188) -- 0:00:45
862500 -- (-1046.757) (-1043.332) [-1048.316] (-1038.506) * (-1055.394) [-1042.865] (-1057.632) (-1049.610) -- 0:00:45
863000 -- (-1044.890) (-1047.770) (-1042.103) [-1040.919] * (-1061.242) [-1052.743] (-1061.967) (-1047.122) -- 0:00:44
863500 -- (-1061.268) [-1039.264] (-1047.036) (-1046.288) * (-1061.077) (-1052.340) (-1041.812) [-1054.131] -- 0:00:44
864000 -- (-1048.644) [-1043.562] (-1050.887) (-1038.274) * (-1048.922) (-1045.960) [-1033.258] (-1044.025) -- 0:00:44
864500 -- (-1054.826) (-1035.166) [-1043.514] (-1044.449) * [-1047.073] (-1052.253) (-1041.275) (-1035.460) -- 0:00:44
865000 -- (-1037.949) (-1047.307) (-1036.465) [-1038.972] * (-1052.039) (-1054.332) (-1045.819) [-1049.585] -- 0:00:44
Average standard deviation of split frequencies: 0.006323
865500 -- (-1036.859) (-1047.362) (-1037.328) [-1038.799] * (-1036.137) [-1043.854] (-1046.287) (-1044.901) -- 0:00:44
866000 -- (-1045.105) [-1032.681] (-1038.254) (-1047.648) * (-1066.250) [-1037.222] (-1044.947) (-1044.385) -- 0:00:43
866500 -- (-1048.551) [-1046.453] (-1051.681) (-1063.223) * (-1060.665) (-1041.595) [-1036.367] (-1060.512) -- 0:00:43
867000 -- (-1042.196) (-1041.432) (-1055.477) [-1042.932] * (-1041.792) (-1048.137) [-1040.187] (-1048.243) -- 0:00:43
867500 -- [-1036.104] (-1041.320) (-1045.279) (-1048.854) * [-1044.143] (-1034.437) (-1045.686) (-1053.664) -- 0:00:43
868000 -- (-1041.829) [-1040.053] (-1036.759) (-1050.548) * [-1042.511] (-1034.713) (-1040.537) (-1052.582) -- 0:00:43
868500 -- [-1037.842] (-1053.847) (-1042.510) (-1043.065) * (-1038.601) (-1057.957) [-1034.039] (-1053.808) -- 0:00:43
869000 -- (-1036.124) (-1048.332) (-1041.705) [-1036.520] * (-1045.300) [-1038.702] (-1043.586) (-1041.951) -- 0:00:42
869500 -- [-1041.885] (-1060.289) (-1056.478) (-1047.177) * (-1041.590) [-1042.564] (-1046.514) (-1043.109) -- 0:00:42
870000 -- (-1045.332) (-1062.053) [-1033.628] (-1041.709) * [-1051.110] (-1043.286) (-1045.929) (-1049.507) -- 0:00:42
Average standard deviation of split frequencies: 0.005581
870500 -- [-1035.814] (-1046.842) (-1046.903) (-1041.283) * (-1052.431) [-1033.924] (-1040.054) (-1046.420) -- 0:00:42
871000 -- (-1041.698) [-1047.693] (-1041.123) (-1059.387) * (-1058.551) (-1051.625) [-1047.312] (-1041.533) -- 0:00:42
871500 -- (-1049.654) (-1052.026) (-1071.895) [-1038.254] * (-1070.195) (-1053.391) (-1040.392) [-1041.326] -- 0:00:42
872000 -- [-1039.464] (-1040.408) (-1052.674) (-1044.887) * (-1053.201) [-1045.735] (-1046.708) (-1047.758) -- 0:00:41
872500 -- (-1052.165) (-1051.602) [-1045.345] (-1041.984) * (-1052.554) (-1057.449) (-1054.021) [-1039.186] -- 0:00:41
873000 -- (-1040.841) (-1046.527) (-1044.071) [-1042.477] * (-1047.911) (-1048.987) (-1041.177) [-1042.481] -- 0:00:41
873500 -- (-1040.576) (-1046.918) [-1051.364] (-1041.093) * (-1062.584) [-1049.098] (-1046.175) (-1042.066) -- 0:00:41
874000 -- [-1042.000] (-1041.207) (-1055.869) (-1030.680) * [-1045.394] (-1040.030) (-1058.057) (-1049.168) -- 0:00:41
874500 -- (-1045.984) [-1032.053] (-1041.104) (-1040.674) * (-1057.454) (-1046.843) (-1045.512) [-1040.852] -- 0:00:41
875000 -- (-1060.956) (-1043.714) (-1039.985) [-1048.345] * (-1040.003) (-1047.203) (-1044.415) [-1042.447] -- 0:00:41
Average standard deviation of split frequencies: 0.005381
875500 -- (-1041.742) (-1036.497) (-1045.685) [-1044.287] * (-1043.962) [-1043.694] (-1039.036) (-1052.697) -- 0:00:40
876000 -- (-1047.280) [-1038.064] (-1039.789) (-1053.860) * (-1036.625) (-1048.951) (-1038.270) [-1040.735] -- 0:00:40
876500 -- [-1050.193] (-1049.336) (-1038.063) (-1046.906) * (-1060.675) (-1045.231) [-1042.886] (-1045.628) -- 0:00:40
877000 -- (-1053.534) (-1043.083) (-1035.829) [-1034.127] * (-1039.327) (-1039.750) (-1038.529) [-1041.532] -- 0:00:40
877500 -- (-1051.334) (-1051.162) (-1042.891) [-1036.595] * (-1047.132) (-1049.026) (-1041.551) [-1043.954] -- 0:00:40
878000 -- (-1051.082) (-1056.020) [-1049.266] (-1031.660) * (-1037.390) (-1053.137) (-1039.455) [-1045.998] -- 0:00:40
878500 -- (-1054.558) (-1046.229) [-1035.163] (-1043.709) * (-1054.146) (-1048.129) [-1045.362] (-1042.404) -- 0:00:39
879000 -- (-1046.246) (-1046.730) [-1041.460] (-1047.264) * [-1049.893] (-1043.111) (-1051.887) (-1050.418) -- 0:00:39
879500 -- [-1036.089] (-1048.123) (-1046.001) (-1043.648) * (-1051.638) (-1039.818) (-1046.065) [-1043.281] -- 0:00:39
880000 -- (-1052.357) [-1050.912] (-1048.067) (-1047.104) * (-1042.820) [-1038.265] (-1062.960) (-1047.167) -- 0:00:39
Average standard deviation of split frequencies: 0.005765
880500 -- (-1054.412) (-1043.928) [-1042.499] (-1038.460) * (-1065.945) (-1046.350) (-1050.871) [-1039.593] -- 0:00:39
881000 -- (-1049.288) (-1038.192) [-1036.545] (-1046.539) * (-1049.773) (-1037.989) (-1061.690) [-1043.736] -- 0:00:39
881500 -- (-1052.788) (-1055.790) (-1052.035) [-1052.179] * (-1044.819) [-1044.183] (-1054.597) (-1043.791) -- 0:00:38
882000 -- (-1066.318) (-1043.045) (-1044.132) [-1046.249] * [-1036.343] (-1050.498) (-1039.459) (-1050.440) -- 0:00:38
882500 -- (-1065.128) (-1039.087) (-1047.985) [-1053.697] * (-1051.321) (-1043.723) [-1035.116] (-1049.087) -- 0:00:38
883000 -- (-1042.351) (-1042.615) [-1039.909] (-1058.685) * (-1060.999) (-1043.547) [-1032.684] (-1053.345) -- 0:00:38
883500 -- (-1043.260) (-1039.305) (-1036.108) [-1049.429] * [-1050.672] (-1047.393) (-1050.645) (-1044.608) -- 0:00:38
884000 -- (-1049.254) (-1046.137) (-1044.636) [-1039.672] * (-1048.120) (-1054.658) [-1033.353] (-1053.162) -- 0:00:38
884500 -- (-1046.521) [-1033.663] (-1048.518) (-1059.245) * (-1047.245) [-1055.029] (-1043.588) (-1054.364) -- 0:00:37
885000 -- (-1042.945) (-1047.917) [-1044.696] (-1064.146) * [-1036.785] (-1059.640) (-1039.792) (-1064.534) -- 0:00:37
Average standard deviation of split frequencies: 0.005853
885500 -- (-1048.571) (-1041.963) (-1054.677) [-1043.533] * (-1047.598) [-1039.762] (-1036.310) (-1047.803) -- 0:00:37
886000 -- (-1055.137) (-1058.980) [-1043.548] (-1045.734) * (-1057.743) (-1044.658) [-1034.841] (-1048.119) -- 0:00:37
886500 -- [-1044.162] (-1051.711) (-1046.929) (-1047.697) * (-1047.989) [-1041.021] (-1036.149) (-1053.586) -- 0:00:37
887000 -- (-1052.326) (-1058.326) [-1046.121] (-1042.505) * [-1051.697] (-1050.571) (-1043.248) (-1053.693) -- 0:00:37
887500 -- (-1063.908) [-1037.711] (-1039.180) (-1054.661) * (-1047.974) (-1041.702) [-1041.177] (-1056.832) -- 0:00:36
888000 -- (-1045.064) [-1036.256] (-1041.368) (-1053.316) * (-1045.729) (-1045.797) [-1037.640] (-1039.897) -- 0:00:36
888500 -- (-1051.906) (-1040.992) [-1040.204] (-1050.895) * (-1045.110) [-1034.139] (-1050.265) (-1044.625) -- 0:00:36
889000 -- [-1039.291] (-1042.100) (-1055.479) (-1053.507) * [-1040.260] (-1036.202) (-1043.914) (-1043.107) -- 0:00:36
889500 -- (-1045.101) [-1052.859] (-1056.856) (-1052.298) * (-1049.355) [-1036.032] (-1037.191) (-1060.575) -- 0:00:36
890000 -- (-1056.080) [-1040.965] (-1041.275) (-1059.943) * [-1043.426] (-1042.811) (-1040.684) (-1054.498) -- 0:00:36
Average standard deviation of split frequencies: 0.005781
890500 -- (-1049.794) (-1053.535) [-1054.251] (-1053.003) * (-1052.186) [-1036.048] (-1043.291) (-1038.405) -- 0:00:35
891000 -- (-1053.236) [-1042.805] (-1048.409) (-1052.921) * (-1047.295) [-1043.005] (-1066.635) (-1047.485) -- 0:00:35
891500 -- [-1034.486] (-1053.212) (-1042.637) (-1050.180) * (-1041.161) (-1044.747) (-1058.195) [-1041.717] -- 0:00:35
892000 -- [-1038.236] (-1046.531) (-1038.000) (-1050.574) * [-1051.417] (-1052.155) (-1067.414) (-1039.838) -- 0:00:35
892500 -- (-1043.427) (-1041.866) [-1043.685] (-1052.584) * (-1033.557) [-1040.216] (-1047.538) (-1042.148) -- 0:00:35
893000 -- (-1041.515) (-1044.317) (-1056.311) [-1040.984] * (-1040.514) (-1037.398) [-1053.655] (-1047.387) -- 0:00:35
893500 -- (-1041.452) [-1047.341] (-1058.743) (-1063.177) * (-1049.645) [-1048.995] (-1042.496) (-1042.802) -- 0:00:34
894000 -- (-1044.971) [-1047.750] (-1056.222) (-1053.947) * (-1054.358) (-1047.571) (-1037.180) [-1047.705] -- 0:00:34
894500 -- (-1047.673) [-1041.654] (-1051.596) (-1048.841) * (-1053.889) [-1049.242] (-1043.628) (-1052.320) -- 0:00:34
895000 -- (-1046.553) (-1043.423) [-1036.371] (-1047.633) * (-1044.774) (-1059.385) (-1056.397) [-1039.247] -- 0:00:34
Average standard deviation of split frequencies: 0.006192
895500 -- (-1055.290) (-1044.305) (-1052.009) [-1046.234] * (-1047.550) (-1049.338) (-1041.597) [-1045.063] -- 0:00:34
896000 -- (-1064.250) (-1039.357) [-1042.891] (-1035.932) * (-1043.848) (-1066.161) [-1044.983] (-1039.291) -- 0:00:34
896500 -- (-1056.467) (-1046.102) [-1042.576] (-1042.508) * (-1047.632) (-1050.828) [-1035.576] (-1045.004) -- 0:00:33
897000 -- (-1048.140) (-1043.405) (-1039.057) [-1037.193] * (-1062.704) (-1047.668) [-1031.963] (-1054.128) -- 0:00:33
897500 -- (-1057.394) (-1043.225) [-1044.751] (-1046.840) * (-1052.825) (-1057.361) (-1049.095) [-1042.775] -- 0:00:33
898000 -- (-1045.312) (-1036.490) [-1037.416] (-1034.521) * (-1050.847) (-1040.254) [-1051.002] (-1035.665) -- 0:00:33
898500 -- (-1037.110) (-1036.560) [-1035.529] (-1052.856) * (-1049.205) (-1048.025) (-1051.765) [-1032.366] -- 0:00:33
899000 -- (-1054.929) (-1044.134) [-1039.587] (-1052.839) * (-1053.956) (-1046.384) (-1038.899) [-1044.713] -- 0:00:33
899500 -- (-1053.841) [-1038.139] (-1052.105) (-1055.737) * (-1036.923) (-1042.890) (-1038.001) [-1034.493] -- 0:00:32
900000 -- [-1046.848] (-1048.084) (-1051.661) (-1038.312) * [-1036.979] (-1053.652) (-1044.289) (-1039.905) -- 0:00:32
Average standard deviation of split frequencies: 0.005878
900500 -- [-1043.914] (-1051.289) (-1050.037) (-1045.800) * (-1041.715) (-1059.544) (-1048.144) [-1046.774] -- 0:00:32
901000 -- (-1054.620) (-1045.906) [-1043.023] (-1063.130) * (-1051.650) (-1043.793) (-1045.390) [-1038.408] -- 0:00:32
901500 -- (-1050.639) (-1055.042) [-1045.589] (-1055.186) * [-1036.220] (-1051.345) (-1041.040) (-1046.649) -- 0:00:32
902000 -- [-1043.166] (-1044.513) (-1052.522) (-1045.986) * (-1051.652) [-1036.201] (-1047.956) (-1043.393) -- 0:00:32
902500 -- (-1043.968) (-1041.961) (-1049.904) [-1042.226] * (-1048.431) [-1035.419] (-1043.070) (-1051.999) -- 0:00:31
903000 -- (-1046.988) [-1037.686] (-1055.593) (-1045.166) * (-1049.313) (-1034.026) (-1041.715) [-1042.488] -- 0:00:31
903500 -- (-1044.312) [-1033.269] (-1061.641) (-1040.354) * (-1047.289) (-1041.147) [-1039.356] (-1052.899) -- 0:00:31
904000 -- (-1044.673) [-1036.198] (-1051.064) (-1044.913) * (-1048.924) (-1046.993) [-1043.421] (-1038.757) -- 0:00:31
904500 -- [-1040.411] (-1040.957) (-1049.068) (-1042.159) * (-1053.729) (-1045.638) (-1043.597) [-1037.206] -- 0:00:31
905000 -- (-1046.792) (-1045.891) [-1038.798] (-1051.909) * [-1045.357] (-1046.450) (-1039.677) (-1042.479) -- 0:00:31
Average standard deviation of split frequencies: 0.006404
905500 -- (-1050.344) (-1036.812) (-1047.650) [-1036.132] * (-1041.953) [-1041.643] (-1045.418) (-1044.305) -- 0:00:30
906000 -- (-1047.496) (-1039.668) (-1061.561) [-1039.227] * (-1043.152) (-1042.443) [-1039.725] (-1044.500) -- 0:00:30
906500 -- (-1049.357) [-1043.786] (-1046.630) (-1043.042) * [-1036.447] (-1038.240) (-1047.279) (-1037.866) -- 0:00:30
907000 -- (-1054.586) (-1056.933) (-1046.790) [-1043.104] * (-1053.707) [-1035.614] (-1038.460) (-1039.374) -- 0:00:30
907500 -- (-1045.500) (-1056.890) (-1035.207) [-1046.032] * (-1061.571) (-1045.136) [-1043.181] (-1046.127) -- 0:00:30
908000 -- (-1041.928) (-1055.300) [-1037.573] (-1045.657) * (-1046.359) (-1050.045) [-1037.648] (-1040.801) -- 0:00:30
908500 -- (-1044.585) [-1038.408] (-1045.576) (-1061.411) * (-1044.516) (-1048.542) [-1038.805] (-1044.792) -- 0:00:30
909000 -- (-1058.993) (-1047.716) [-1046.319] (-1055.660) * (-1046.115) (-1040.343) (-1041.919) [-1038.298] -- 0:00:29
909500 -- (-1048.481) (-1048.668) [-1039.695] (-1051.841) * [-1035.482] (-1048.808) (-1046.458) (-1044.431) -- 0:00:29
910000 -- (-1049.954) [-1044.874] (-1034.738) (-1052.794) * (-1042.482) (-1059.090) [-1033.683] (-1045.547) -- 0:00:29
Average standard deviation of split frequencies: 0.006331
910500 -- (-1053.394) (-1037.343) [-1032.679] (-1045.757) * (-1037.438) (-1046.005) (-1049.738) [-1042.751] -- 0:00:29
911000 -- [-1047.559] (-1051.338) (-1048.101) (-1049.164) * (-1045.187) (-1041.482) [-1039.925] (-1055.588) -- 0:00:29
911500 -- (-1042.742) (-1045.785) (-1050.676) [-1043.023] * (-1047.008) [-1040.788] (-1035.604) (-1048.766) -- 0:00:29
912000 -- (-1047.745) [-1039.664] (-1055.118) (-1040.898) * (-1051.324) (-1050.343) [-1041.603] (-1059.136) -- 0:00:28
912500 -- (-1044.651) (-1050.867) (-1046.805) [-1036.177] * (-1046.796) (-1054.126) [-1044.383] (-1053.392) -- 0:00:28
913000 -- (-1047.588) [-1036.752] (-1042.960) (-1043.420) * (-1048.333) (-1042.620) (-1043.849) [-1038.328] -- 0:00:28
913500 -- [-1037.930] (-1044.354) (-1041.473) (-1057.932) * [-1042.859] (-1045.930) (-1043.173) (-1044.359) -- 0:00:28
914000 -- (-1035.267) (-1044.279) [-1041.867] (-1040.285) * [-1037.326] (-1044.824) (-1040.504) (-1048.705) -- 0:00:28
914500 -- (-1041.236) (-1044.663) (-1049.214) [-1040.675] * (-1049.789) [-1040.545] (-1039.834) (-1052.589) -- 0:00:28
915000 -- [-1038.613] (-1040.508) (-1040.306) (-1038.835) * (-1057.911) [-1059.109] (-1050.518) (-1038.368) -- 0:00:27
Average standard deviation of split frequencies: 0.006017
915500 -- (-1042.104) (-1045.536) [-1038.715] (-1037.998) * (-1049.535) (-1053.573) (-1036.880) [-1042.163] -- 0:00:27
916000 -- (-1059.012) (-1044.632) (-1046.385) [-1036.052] * (-1044.784) (-1045.968) (-1046.584) [-1047.247] -- 0:00:27
916500 -- (-1051.590) (-1041.076) [-1044.766] (-1039.153) * [-1042.197] (-1052.335) (-1051.099) (-1036.696) -- 0:00:27
917000 -- (-1034.715) [-1045.400] (-1042.508) (-1041.774) * (-1047.073) [-1051.338] (-1047.798) (-1074.918) -- 0:00:27
917500 -- [-1037.617] (-1063.793) (-1041.777) (-1039.598) * [-1049.843] (-1051.899) (-1052.199) (-1053.991) -- 0:00:27
918000 -- (-1042.392) (-1035.335) (-1039.689) [-1040.371] * [-1041.562] (-1049.069) (-1043.993) (-1033.720) -- 0:00:26
918500 -- (-1039.982) [-1042.811] (-1047.567) (-1035.477) * (-1042.471) (-1041.284) [-1032.963] (-1043.229) -- 0:00:26
919000 -- (-1041.372) (-1055.307) [-1047.710] (-1042.401) * (-1041.598) (-1049.702) [-1044.258] (-1056.320) -- 0:00:26
919500 -- [-1041.576] (-1044.225) (-1043.946) (-1059.082) * (-1045.388) [-1041.556] (-1040.172) (-1057.802) -- 0:00:26
920000 -- (-1036.981) (-1056.867) [-1048.580] (-1054.119) * (-1037.064) (-1046.589) (-1042.561) [-1039.327] -- 0:00:26
Average standard deviation of split frequencies: 0.006066
920500 -- (-1052.329) (-1051.182) [-1044.975] (-1044.830) * (-1043.299) (-1047.157) (-1034.300) [-1038.172] -- 0:00:26
921000 -- (-1047.599) (-1048.932) (-1043.857) [-1051.407] * (-1043.276) [-1038.562] (-1041.781) (-1050.720) -- 0:00:25
921500 -- (-1040.842) [-1042.882] (-1050.057) (-1045.215) * [-1035.684] (-1042.328) (-1039.545) (-1058.508) -- 0:00:25
922000 -- (-1036.464) (-1041.325) [-1042.403] (-1046.133) * (-1036.447) [-1040.855] (-1046.400) (-1049.235) -- 0:00:25
922500 -- [-1034.656] (-1034.602) (-1046.303) (-1044.538) * (-1048.647) (-1041.512) (-1047.560) [-1036.205] -- 0:00:25
923000 -- (-1053.688) (-1044.868) (-1040.533) [-1029.829] * (-1045.433) [-1042.615] (-1043.901) (-1048.640) -- 0:00:25
923500 -- (-1049.684) [-1036.821] (-1045.759) (-1040.934) * (-1056.017) (-1049.127) (-1051.183) [-1053.441] -- 0:00:25
924000 -- (-1048.769) (-1039.545) (-1048.055) [-1038.817] * [-1043.551] (-1048.296) (-1039.005) (-1049.047) -- 0:00:25
924500 -- (-1034.980) (-1036.515) [-1036.126] (-1048.639) * [-1036.864] (-1058.425) (-1047.474) (-1046.636) -- 0:00:24
925000 -- (-1049.935) [-1037.199] (-1038.210) (-1044.871) * (-1038.369) [-1038.474] (-1047.775) (-1045.567) -- 0:00:24
Average standard deviation of split frequencies: 0.006109
925500 -- [-1036.784] (-1046.729) (-1046.555) (-1047.397) * [-1037.639] (-1054.176) (-1061.205) (-1050.171) -- 0:00:24
926000 -- [-1040.081] (-1041.232) (-1058.669) (-1038.388) * (-1041.716) [-1050.472] (-1043.096) (-1046.295) -- 0:00:24
926500 -- [-1040.380] (-1039.454) (-1046.615) (-1047.980) * [-1051.885] (-1048.718) (-1045.140) (-1042.292) -- 0:00:24
927000 -- (-1046.161) (-1046.397) (-1048.261) [-1046.260] * [-1038.177] (-1052.065) (-1039.974) (-1055.273) -- 0:00:24
927500 -- (-1044.218) (-1042.274) [-1042.327] (-1038.313) * (-1042.820) (-1057.983) (-1045.788) [-1042.072] -- 0:00:23
928000 -- (-1058.895) (-1043.826) (-1047.909) [-1031.763] * (-1047.724) (-1045.712) (-1036.304) [-1040.318] -- 0:00:23
928500 -- (-1050.236) [-1049.044] (-1049.015) (-1049.138) * (-1057.198) (-1050.779) (-1046.486) [-1038.415] -- 0:00:23
929000 -- (-1049.191) [-1042.578] (-1045.274) (-1049.490) * (-1040.277) [-1034.247] (-1055.600) (-1052.612) -- 0:00:23
929500 -- [-1045.694] (-1040.229) (-1051.620) (-1039.119) * (-1040.470) [-1045.708] (-1052.609) (-1062.034) -- 0:00:23
930000 -- (-1047.258) (-1050.027) [-1038.336] (-1048.499) * (-1044.561) (-1039.029) [-1047.210] (-1051.356) -- 0:00:23
Average standard deviation of split frequencies: 0.005728
930500 -- [-1042.071] (-1052.432) (-1049.050) (-1042.836) * (-1045.207) (-1044.205) [-1036.567] (-1059.251) -- 0:00:22
931000 -- (-1044.576) [-1039.384] (-1035.518) (-1039.219) * [-1038.975] (-1039.079) (-1055.102) (-1050.779) -- 0:00:22
931500 -- (-1038.152) (-1042.534) (-1049.204) [-1036.272] * (-1039.059) (-1037.360) [-1036.695] (-1041.760) -- 0:00:22
932000 -- [-1031.870] (-1043.225) (-1042.541) (-1049.063) * (-1048.233) (-1047.810) [-1041.038] (-1058.162) -- 0:00:22
932500 -- (-1040.891) [-1045.938] (-1046.637) (-1048.445) * [-1049.465] (-1052.069) (-1038.404) (-1046.211) -- 0:00:22
933000 -- (-1044.775) (-1050.208) (-1046.774) [-1039.586] * (-1045.365) (-1050.638) (-1046.845) [-1046.929] -- 0:00:21
933500 -- (-1043.793) (-1043.294) (-1067.407) [-1044.492] * [-1040.530] (-1050.095) (-1047.480) (-1048.180) -- 0:00:21
934000 -- (-1050.654) (-1042.663) (-1053.792) [-1036.475] * [-1040.243] (-1049.776) (-1044.150) (-1043.824) -- 0:00:21
934500 -- (-1040.636) [-1037.920] (-1057.023) (-1046.610) * (-1045.458) (-1046.790) [-1045.737] (-1054.191) -- 0:00:21
935000 -- (-1049.852) [-1035.692] (-1053.826) (-1037.453) * [-1049.910] (-1059.246) (-1039.766) (-1042.353) -- 0:00:21
Average standard deviation of split frequencies: 0.005734
935500 -- (-1044.166) [-1043.127] (-1051.474) (-1047.738) * [-1044.242] (-1036.872) (-1052.880) (-1057.565) -- 0:00:21
936000 -- (-1047.171) (-1032.804) (-1059.146) [-1038.702] * [-1035.903] (-1051.697) (-1049.339) (-1037.330) -- 0:00:20
936500 -- [-1037.093] (-1051.045) (-1059.495) (-1038.012) * (-1037.581) [-1045.924] (-1039.966) (-1036.213) -- 0:00:20
937000 -- (-1048.427) (-1054.272) [-1051.037] (-1043.251) * [-1037.926] (-1052.533) (-1051.197) (-1042.419) -- 0:00:20
937500 -- (-1033.499) (-1046.590) (-1048.851) [-1035.849] * [-1045.917] (-1039.633) (-1058.329) (-1047.849) -- 0:00:20
938000 -- (-1041.861) (-1068.655) (-1057.012) [-1040.524] * (-1058.971) [-1033.534] (-1061.932) (-1036.831) -- 0:00:20
938500 -- (-1041.148) (-1035.845) [-1044.307] (-1044.239) * (-1044.733) [-1031.293] (-1040.881) (-1040.704) -- 0:00:20
939000 -- [-1036.523] (-1046.328) (-1048.637) (-1054.159) * (-1043.446) (-1038.805) [-1043.760] (-1038.627) -- 0:00:20
939500 -- (-1037.533) (-1055.696) [-1035.665] (-1049.940) * (-1053.139) [-1048.350] (-1047.873) (-1048.745) -- 0:00:19
940000 -- (-1046.779) [-1050.204] (-1044.874) (-1041.849) * [-1037.103] (-1047.452) (-1067.293) (-1047.573) -- 0:00:19
Average standard deviation of split frequencies: 0.005551
940500 -- (-1050.295) (-1046.507) [-1044.261] (-1049.629) * [-1032.021] (-1048.492) (-1071.457) (-1042.578) -- 0:00:19
941000 -- (-1052.793) (-1040.625) (-1050.265) [-1046.165] * [-1043.012] (-1053.383) (-1048.732) (-1047.658) -- 0:00:19
941500 -- (-1046.341) (-1043.728) (-1039.744) [-1038.462] * [-1036.274] (-1047.472) (-1039.562) (-1039.890) -- 0:00:19
942000 -- (-1053.097) (-1056.463) (-1046.377) [-1037.531] * (-1039.745) (-1038.176) [-1038.874] (-1043.551) -- 0:00:19
942500 -- (-1043.255) (-1048.326) (-1052.790) [-1035.660] * (-1046.050) [-1040.377] (-1079.067) (-1051.486) -- 0:00:18
943000 -- (-1062.193) (-1031.289) (-1041.030) [-1038.247] * (-1036.315) (-1041.630) (-1053.970) [-1033.800] -- 0:00:18
943500 -- (-1042.470) [-1041.876] (-1041.975) (-1039.533) * (-1043.055) (-1041.263) (-1050.560) [-1037.402] -- 0:00:18
944000 -- (-1037.059) [-1043.759] (-1037.335) (-1040.402) * (-1037.689) (-1045.991) (-1046.435) [-1044.231] -- 0:00:18
944500 -- [-1042.376] (-1046.958) (-1052.451) (-1040.165) * (-1042.415) (-1042.967) (-1047.195) [-1044.997] -- 0:00:18
945000 -- [-1034.466] (-1044.009) (-1044.230) (-1046.738) * (-1052.021) (-1037.706) (-1054.064) [-1043.196] -- 0:00:18
Average standard deviation of split frequencies: 0.005635
945500 -- [-1034.034] (-1047.220) (-1039.835) (-1045.478) * (-1043.440) [-1037.815] (-1049.847) (-1041.355) -- 0:00:17
946000 -- (-1043.462) (-1044.555) (-1038.931) [-1046.418] * [-1051.387] (-1044.474) (-1051.604) (-1048.800) -- 0:00:17
946500 -- (-1049.102) (-1045.905) [-1045.964] (-1053.754) * (-1053.978) (-1039.463) [-1033.202] (-1043.503) -- 0:00:17
947000 -- (-1052.649) [-1039.740] (-1057.305) (-1048.137) * (-1056.161) [-1038.420] (-1042.454) (-1049.132) -- 0:00:17
947500 -- (-1043.428) (-1053.196) [-1049.838] (-1040.889) * (-1053.953) [-1043.300] (-1043.242) (-1046.675) -- 0:00:17
948000 -- [-1041.659] (-1056.173) (-1038.129) (-1039.882) * (-1053.376) [-1031.372] (-1042.817) (-1044.865) -- 0:00:17
948500 -- [-1040.329] (-1056.398) (-1041.129) (-1041.386) * (-1049.498) (-1051.140) (-1043.457) [-1044.285] -- 0:00:16
949000 -- [-1045.701] (-1063.707) (-1047.409) (-1048.207) * (-1046.435) [-1039.930] (-1051.819) (-1053.894) -- 0:00:16
949500 -- (-1059.737) (-1053.591) (-1040.123) [-1038.986] * (-1049.503) (-1040.406) (-1052.996) [-1037.367] -- 0:00:16
950000 -- (-1035.262) (-1063.175) [-1039.162] (-1053.464) * (-1056.109) (-1041.594) (-1052.200) [-1044.106] -- 0:00:16
Average standard deviation of split frequencies: 0.005798
950500 -- (-1050.199) (-1052.326) [-1044.972] (-1042.263) * (-1048.718) (-1047.227) [-1044.475] (-1049.709) -- 0:00:16
951000 -- (-1052.018) [-1037.227] (-1034.789) (-1048.622) * (-1047.006) [-1041.088] (-1050.571) (-1050.947) -- 0:00:16
951500 -- (-1051.624) (-1051.466) (-1046.800) [-1045.639] * (-1049.942) [-1035.760] (-1045.554) (-1054.375) -- 0:00:15
952000 -- (-1047.098) [-1034.433] (-1044.926) (-1055.647) * (-1040.256) [-1046.904] (-1044.063) (-1044.511) -- 0:00:15
952500 -- (-1052.223) [-1041.646] (-1053.553) (-1039.947) * (-1044.616) [-1039.019] (-1044.908) (-1042.212) -- 0:00:15
953000 -- (-1049.480) (-1053.688) (-1043.794) [-1042.642] * [-1038.270] (-1040.686) (-1054.422) (-1050.328) -- 0:00:15
953500 -- (-1049.450) (-1047.637) (-1046.842) [-1044.510] * (-1038.080) (-1047.595) (-1053.621) [-1038.252] -- 0:00:15
954000 -- (-1043.015) (-1042.655) (-1045.987) [-1035.629] * (-1039.456) (-1042.560) (-1045.960) [-1040.883] -- 0:00:15
954500 -- (-1048.835) (-1052.406) [-1047.014] (-1041.256) * (-1040.762) [-1041.605] (-1045.835) (-1045.981) -- 0:00:14
955000 -- (-1062.990) [-1041.667] (-1039.614) (-1042.943) * [-1051.644] (-1034.375) (-1045.829) (-1061.948) -- 0:00:14
Average standard deviation of split frequencies: 0.005386
955500 -- (-1039.159) [-1040.366] (-1039.070) (-1047.148) * (-1040.597) (-1045.398) [-1045.693] (-1062.244) -- 0:00:14
956000 -- [-1039.826] (-1054.208) (-1058.722) (-1045.808) * [-1046.374] (-1045.113) (-1049.189) (-1051.800) -- 0:00:14
956500 -- (-1053.451) (-1045.844) (-1055.850) [-1040.857] * (-1059.641) (-1042.953) (-1036.955) [-1046.349] -- 0:00:14
957000 -- (-1047.663) [-1042.030] (-1058.237) (-1047.173) * (-1063.387) [-1040.817] (-1061.227) (-1065.049) -- 0:00:14
957500 -- [-1036.275] (-1052.141) (-1062.457) (-1046.984) * (-1047.505) (-1036.672) (-1056.362) [-1052.192] -- 0:00:13
958000 -- (-1042.224) [-1041.212] (-1048.002) (-1040.867) * (-1050.220) [-1032.541] (-1047.408) (-1050.824) -- 0:00:13
958500 -- (-1043.833) (-1048.208) [-1045.505] (-1036.668) * (-1048.974) [-1042.182] (-1061.790) (-1040.632) -- 0:00:13
959000 -- [-1039.168] (-1044.242) (-1048.453) (-1044.416) * (-1047.524) [-1040.451] (-1036.936) (-1050.776) -- 0:00:13
959500 -- [-1036.479] (-1043.409) (-1059.397) (-1048.606) * (-1045.270) (-1051.176) (-1054.652) [-1038.457] -- 0:00:13
960000 -- (-1064.208) (-1039.310) [-1047.488] (-1039.766) * (-1040.082) (-1060.266) (-1049.589) [-1045.261] -- 0:00:13
Average standard deviation of split frequencies: 0.005020
960500 -- (-1039.709) (-1050.834) [-1037.390] (-1052.693) * (-1050.575) (-1042.100) (-1049.335) [-1038.110] -- 0:00:12
961000 -- (-1052.660) [-1055.036] (-1041.259) (-1043.586) * [-1042.627] (-1056.619) (-1042.523) (-1040.259) -- 0:00:12
961500 -- (-1039.207) [-1040.884] (-1055.903) (-1046.998) * (-1048.072) [-1034.371] (-1041.238) (-1029.353) -- 0:00:12
962000 -- [-1043.610] (-1047.336) (-1058.100) (-1043.097) * [-1042.929] (-1055.388) (-1040.482) (-1044.669) -- 0:00:12
962500 -- (-1041.861) (-1038.711) (-1050.974) [-1036.082] * [-1040.113] (-1037.747) (-1039.791) (-1049.972) -- 0:00:12
963000 -- (-1040.108) [-1038.129] (-1061.244) (-1044.686) * (-1058.568) [-1052.759] (-1042.070) (-1054.687) -- 0:00:12
963500 -- (-1035.650) (-1051.841) (-1047.800) [-1052.306] * [-1041.607] (-1050.189) (-1048.717) (-1046.166) -- 0:00:11
964000 -- [-1044.514] (-1068.190) (-1046.962) (-1042.859) * (-1041.623) [-1052.039] (-1045.997) (-1042.002) -- 0:00:11
964500 -- [-1042.423] (-1044.626) (-1068.964) (-1041.559) * (-1047.879) (-1035.767) (-1045.934) [-1049.869] -- 0:00:11
965000 -- (-1043.804) (-1036.455) [-1040.797] (-1053.250) * [-1042.785] (-1050.807) (-1065.142) (-1043.144) -- 0:00:11
Average standard deviation of split frequencies: 0.005593
965500 -- (-1062.644) [-1039.032] (-1036.378) (-1050.119) * (-1047.154) (-1048.816) (-1045.932) [-1041.157] -- 0:00:11
966000 -- (-1044.195) (-1054.443) (-1034.242) [-1045.795] * [-1036.236] (-1054.296) (-1040.071) (-1047.288) -- 0:00:11
966500 -- (-1043.455) (-1036.031) (-1060.723) [-1044.690] * (-1039.680) (-1046.257) [-1046.291] (-1038.706) -- 0:00:10
967000 -- (-1052.683) (-1052.788) [-1046.048] (-1046.666) * [-1036.304] (-1047.508) (-1040.588) (-1036.565) -- 0:00:10
967500 -- (-1043.793) (-1046.168) (-1050.391) [-1044.653] * (-1050.350) [-1034.786] (-1044.106) (-1045.668) -- 0:00:10
968000 -- [-1039.481] (-1063.047) (-1043.586) (-1038.533) * (-1049.108) [-1040.334] (-1052.946) (-1049.575) -- 0:00:10
968500 -- [-1035.137] (-1042.987) (-1049.874) (-1048.615) * (-1042.907) (-1046.579) (-1044.724) [-1039.063] -- 0:00:10
969000 -- (-1044.723) (-1044.639) (-1046.580) [-1043.489] * (-1046.127) [-1047.161] (-1054.958) (-1055.538) -- 0:00:10
969500 -- (-1045.582) (-1039.438) (-1045.855) [-1037.816] * (-1053.791) (-1037.253) [-1042.540] (-1047.422) -- 0:00:10
970000 -- (-1047.928) (-1045.815) [-1042.027] (-1047.089) * (-1065.501) (-1045.492) [-1050.188] (-1048.612) -- 0:00:09
Average standard deviation of split frequencies: 0.005193
970500 -- (-1042.220) [-1046.490] (-1045.671) (-1038.206) * (-1057.954) (-1049.846) [-1039.802] (-1054.887) -- 0:00:09
971000 -- (-1047.418) (-1043.022) (-1045.489) [-1040.213] * (-1043.908) [-1039.710] (-1046.696) (-1052.961) -- 0:00:09
971500 -- (-1050.326) [-1039.630] (-1043.627) (-1038.432) * (-1039.512) [-1046.264] (-1043.100) (-1049.950) -- 0:00:09
972000 -- (-1043.967) (-1046.376) (-1051.579) [-1039.876] * (-1046.767) [-1035.884] (-1038.297) (-1044.469) -- 0:00:09
972500 -- (-1057.430) [-1034.564] (-1041.442) (-1040.407) * [-1032.221] (-1029.326) (-1047.591) (-1055.427) -- 0:00:09
973000 -- (-1042.287) [-1035.163] (-1044.859) (-1050.885) * (-1036.948) (-1041.283) [-1043.127] (-1054.969) -- 0:00:08
973500 -- (-1047.387) [-1041.943] (-1041.928) (-1045.315) * (-1042.569) (-1053.764) (-1047.364) [-1041.687] -- 0:00:08
974000 -- (-1041.923) (-1045.133) [-1034.625] (-1078.385) * [-1039.816] (-1042.002) (-1074.877) (-1043.672) -- 0:00:08
974500 -- (-1048.269) (-1048.072) (-1052.182) [-1040.594] * (-1048.474) (-1045.447) [-1042.754] (-1044.624) -- 0:00:08
975000 -- (-1049.047) (-1043.751) [-1041.889] (-1047.962) * [-1041.033] (-1040.183) (-1041.105) (-1045.291) -- 0:00:08
Average standard deviation of split frequencies: 0.004756
975500 -- (-1039.511) (-1048.247) [-1038.537] (-1043.431) * (-1036.444) [-1036.558] (-1043.554) (-1051.154) -- 0:00:08
976000 -- (-1048.239) (-1045.374) (-1053.816) [-1036.219] * (-1053.230) (-1042.675) [-1035.484] (-1040.112) -- 0:00:07
976500 -- [-1049.677] (-1052.635) (-1047.587) (-1040.774) * (-1051.712) (-1044.456) [-1042.035] (-1045.177) -- 0:00:07
977000 -- [-1036.133] (-1049.315) (-1060.305) (-1041.790) * (-1051.869) (-1044.348) [-1037.477] (-1043.978) -- 0:00:07
977500 -- (-1036.980) (-1054.499) (-1046.699) [-1045.236] * [-1039.156] (-1043.856) (-1052.224) (-1047.008) -- 0:00:07
978000 -- (-1028.844) (-1047.119) [-1048.995] (-1044.694) * (-1039.196) (-1046.059) (-1048.555) [-1046.405] -- 0:00:07
978500 -- [-1037.588] (-1049.376) (-1049.947) (-1037.063) * (-1041.134) (-1040.016) [-1037.616] (-1051.590) -- 0:00:07
979000 -- (-1048.348) [-1044.698] (-1038.554) (-1048.709) * (-1052.259) (-1034.569) [-1032.952] (-1057.684) -- 0:00:06
979500 -- (-1062.216) (-1052.907) (-1041.008) [-1039.932] * (-1048.240) (-1038.914) [-1038.946] (-1045.400) -- 0:00:06
980000 -- (-1054.864) (-1036.448) (-1044.444) [-1040.900] * (-1067.756) (-1042.516) [-1047.074] (-1041.367) -- 0:00:06
Average standard deviation of split frequencies: 0.004437
980500 -- (-1047.122) [-1053.505] (-1051.301) (-1043.521) * (-1054.332) (-1048.729) [-1038.497] (-1047.453) -- 0:00:06
981000 -- (-1046.123) [-1039.014] (-1052.259) (-1056.271) * (-1047.472) [-1047.823] (-1053.040) (-1038.611) -- 0:00:06
981500 -- [-1041.590] (-1046.389) (-1044.730) (-1055.108) * (-1046.462) [-1032.615] (-1050.591) (-1041.802) -- 0:00:06
982000 -- [-1045.275] (-1040.101) (-1041.257) (-1038.843) * (-1043.771) (-1046.195) [-1040.356] (-1048.222) -- 0:00:05
982500 -- [-1038.622] (-1055.403) (-1050.175) (-1047.017) * (-1048.098) (-1046.061) (-1045.398) [-1041.094] -- 0:00:05
983000 -- [-1042.445] (-1042.069) (-1041.579) (-1051.691) * (-1046.404) [-1033.930] (-1043.686) (-1052.064) -- 0:00:05
983500 -- [-1040.080] (-1050.303) (-1053.882) (-1049.651) * (-1044.014) (-1044.172) [-1043.607] (-1042.776) -- 0:00:05
984000 -- (-1034.551) (-1059.054) [-1035.126] (-1030.054) * (-1044.120) (-1040.030) (-1054.431) [-1038.117] -- 0:00:05
984500 -- (-1052.611) [-1043.819] (-1034.756) (-1045.196) * (-1043.292) [-1044.305] (-1063.192) (-1053.487) -- 0:00:05
985000 -- [-1040.591] (-1054.865) (-1045.365) (-1037.307) * (-1050.431) [-1046.194] (-1052.181) (-1037.044) -- 0:00:04
Average standard deviation of split frequencies: 0.004671
985500 -- (-1052.996) (-1038.874) (-1059.041) [-1049.835] * (-1041.199) [-1039.481] (-1053.252) (-1043.304) -- 0:00:04
986000 -- (-1044.089) (-1035.562) (-1051.131) [-1045.046] * (-1039.749) [-1039.588] (-1063.963) (-1043.448) -- 0:00:04
986500 -- [-1045.825] (-1039.836) (-1041.699) (-1044.472) * (-1042.317) (-1046.889) (-1043.972) [-1038.862] -- 0:00:04
987000 -- (-1041.730) (-1042.167) (-1044.025) [-1038.937] * (-1041.167) [-1053.787] (-1057.103) (-1033.540) -- 0:00:04
987500 -- (-1036.801) (-1039.392) [-1037.780] (-1039.448) * (-1042.670) (-1047.476) (-1041.330) [-1044.392] -- 0:00:04
988000 -- (-1059.012) (-1044.678) (-1061.929) [-1039.878] * [-1053.625] (-1052.808) (-1043.825) (-1042.265) -- 0:00:03
988500 -- (-1052.613) (-1061.041) (-1053.391) [-1050.286] * (-1044.830) [-1043.231] (-1052.724) (-1043.640) -- 0:00:03
989000 -- [-1048.304] (-1047.891) (-1045.107) (-1045.415) * (-1045.276) (-1048.785) [-1043.199] (-1043.551) -- 0:00:03
989500 -- (-1052.270) (-1054.977) [-1032.244] (-1040.562) * (-1049.050) (-1058.826) [-1041.349] (-1040.272) -- 0:00:03
990000 -- (-1062.511) (-1042.802) [-1040.944] (-1044.951) * (-1036.316) (-1045.471) [-1042.407] (-1046.192) -- 0:00:03
Average standard deviation of split frequencies: 0.004758
990500 -- (-1058.742) (-1045.743) (-1048.434) [-1043.576] * (-1047.133) (-1044.140) (-1046.463) [-1035.226] -- 0:00:03
991000 -- (-1052.356) (-1062.518) [-1038.097] (-1045.434) * (-1044.955) [-1041.658] (-1051.770) (-1052.353) -- 0:00:02
991500 -- (-1046.815) [-1045.100] (-1043.645) (-1034.839) * [-1038.087] (-1050.720) (-1039.374) (-1042.453) -- 0:00:02
992000 -- (-1036.803) [-1039.262] (-1057.848) (-1042.288) * (-1043.749) (-1042.777) [-1041.744] (-1058.550) -- 0:00:02
992500 -- (-1040.311) [-1038.586] (-1049.514) (-1041.210) * (-1040.066) [-1041.909] (-1052.104) (-1040.499) -- 0:00:02
993000 -- (-1052.652) (-1043.522) (-1045.820) [-1036.465] * (-1045.749) (-1047.827) [-1043.077] (-1051.466) -- 0:00:02
993500 -- (-1038.499) (-1046.301) (-1056.550) [-1034.643] * (-1052.911) (-1040.294) [-1041.182] (-1044.431) -- 0:00:02
994000 -- (-1054.734) (-1042.164) [-1035.282] (-1036.206) * (-1056.711) (-1048.298) (-1041.653) [-1044.293] -- 0:00:01
994500 -- [-1037.144] (-1044.305) (-1045.078) (-1044.577) * (-1044.145) (-1050.561) [-1044.865] (-1056.562) -- 0:00:01
995000 -- (-1053.470) [-1037.021] (-1039.320) (-1059.537) * [-1044.237] (-1048.097) (-1042.635) (-1048.953) -- 0:00:01
Average standard deviation of split frequencies: 0.004187
995500 -- [-1043.857] (-1053.617) (-1045.693) (-1049.896) * (-1044.121) (-1047.752) (-1045.890) [-1044.142] -- 0:00:01
996000 -- (-1044.540) [-1043.362] (-1045.765) (-1041.808) * (-1050.673) (-1047.487) (-1040.445) [-1045.463] -- 0:00:01
996500 -- [-1042.578] (-1049.470) (-1044.324) (-1045.734) * [-1045.256] (-1047.546) (-1047.270) (-1043.711) -- 0:00:01
997000 -- (-1049.453) (-1046.480) [-1042.396] (-1041.808) * (-1049.405) [-1040.711] (-1049.517) (-1048.710) -- 0:00:00
997500 -- (-1045.439) (-1056.311) [-1044.200] (-1040.691) * [-1043.667] (-1046.858) (-1046.205) (-1052.918) -- 0:00:00
998000 -- [-1045.944] (-1053.973) (-1047.451) (-1046.378) * (-1046.794) [-1043.364] (-1043.496) (-1060.677) -- 0:00:00
998500 -- (-1045.891) (-1062.432) (-1045.102) [-1044.994] * [-1037.681] (-1052.524) (-1046.083) (-1043.202) -- 0:00:00
999000 -- [-1038.340] (-1055.448) (-1046.843) (-1044.184) * (-1048.816) (-1037.595) (-1048.322) [-1045.723] -- 0:00:00
999500 -- (-1045.015) (-1046.779) (-1041.329) [-1040.397] * (-1042.130) (-1046.601) (-1045.858) [-1048.647] -- 0:00:00
1000000 -- (-1048.049) [-1042.225] (-1040.282) (-1042.224) * (-1049.823) [-1041.978] (-1051.832) (-1046.055) -- 0:00:00
Average standard deviation of split frequencies: 0.004349
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1048.048859 -- 16.017177
Chain 1 -- -1048.048860 -- 16.017177
Chain 2 -- -1042.224928 -- 21.990032
Chain 2 -- -1042.224918 -- 21.990032
Chain 3 -- -1040.281940 -- 19.699099
Chain 3 -- -1040.281935 -- 19.699099
Chain 4 -- -1042.224394 -- 19.932461
Chain 4 -- -1042.224395 -- 19.932461
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1049.822804 -- 23.201640
Chain 1 -- -1049.822815 -- 23.201640
Chain 2 -- -1041.977975 -- 23.399991
Chain 2 -- -1041.977980 -- 23.399991
Chain 3 -- -1051.831934 -- 20.985156
Chain 3 -- -1051.831932 -- 20.985156
Chain 4 -- -1046.054545 -- 20.576463
Chain 4 -- -1046.054573 -- 20.576463
Analysis completed in 5 mins 28 seconds
Analysis used 328.36 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1027.10
Likelihood of best state for "cold" chain of run 2 was -1026.86
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
51.5 % ( 45 %) Dirichlet(Revmat{all})
66.8 % ( 50 %) Slider(Revmat{all})
32.0 % ( 28 %) Dirichlet(Pi{all})
32.7 % ( 29 %) Slider(Pi{all})
36.9 % ( 24 %) Multiplier(Alpha{1,2})
46.7 % ( 25 %) Multiplier(Alpha{3})
61.5 % ( 38 %) Slider(Pinvar{all})
12.8 % ( 14 %) ExtSPR(Tau{all},V{all})
3.8 % ( 7 %) ExtTBR(Tau{all},V{all})
19.7 % ( 20 %) NNI(Tau{all},V{all})
14.0 % ( 12 %) ParsSPR(Tau{all},V{all})
27.0 % ( 30 %) Multiplier(V{all})
53.4 % ( 57 %) Nodeslider(V{all})
25.8 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
52.4 % ( 44 %) Dirichlet(Revmat{all})
65.9 % ( 55 %) Slider(Revmat{all})
32.0 % ( 19 %) Dirichlet(Pi{all})
32.5 % ( 27 %) Slider(Pi{all})
36.1 % ( 35 %) Multiplier(Alpha{1,2})
47.1 % ( 28 %) Multiplier(Alpha{3})
62.0 % ( 31 %) Slider(Pinvar{all})
12.7 % ( 11 %) ExtSPR(Tau{all},V{all})
3.7 % ( 2 %) ExtTBR(Tau{all},V{all})
20.1 % ( 27 %) NNI(Tau{all},V{all})
14.1 % ( 12 %) ParsSPR(Tau{all},V{all})
26.9 % ( 24 %) Multiplier(V{all})
53.2 % ( 59 %) Nodeslider(V{all})
26.0 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.71 0.47 0.29
2 | 166646 0.72 0.48
3 | 166780 166707 0.73
4 | 166214 166786 166867
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.71 0.46 0.28
2 | 166866 0.72 0.49
3 | 166361 167231 0.74
4 | 166180 166047 167315
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1039.34
| 1 2 |
|1 2 |
| 2 1 1 |
| 1 2 2 1 |
|2 12 2 2 1 12 1 2 22 1 1 2 |
| 1 2 1 * 2 1 * *2 2111 1 * 1 1|
| 1 1 2 1 2 1 1 |
| * 1222 1 2 1 1 1 1 1 |
| 21 2 1 * 2 2** 2 2 12 1 2 |
| 2 1 2 1 11 2 1 2 2 2 22 |
| 2 2 1 2 2 1 |
| 2 2 |
| 1 1 2 2 * 22 2|
| 1 1 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1043.77
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1034.72 -1052.43
2 -1034.72 -1057.95
--------------------------------------
TOTAL -1034.72 -1057.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.864909 0.021560 0.606028 1.166137 0.850675 1069.18 1219.70 1.000
r(A<->C){all} 0.059170 0.000645 0.014575 0.109451 0.055984 730.17 756.21 1.000
r(A<->G){all} 0.161766 0.002844 0.068365 0.263594 0.154507 481.83 510.35 1.000
r(A<->T){all} 0.147841 0.004031 0.039627 0.276007 0.139888 526.97 537.51 1.000
r(C<->G){all} 0.027423 0.000152 0.006259 0.052005 0.025608 1111.26 1117.14 1.000
r(C<->T){all} 0.560160 0.007372 0.400017 0.728563 0.558670 368.66 405.90 1.000
r(G<->T){all} 0.043640 0.000607 0.004498 0.091908 0.039432 851.11 898.79 1.000
pi(A){all} 0.263122 0.000539 0.216968 0.305883 0.262279 906.51 945.46 1.000
pi(C){all} 0.320799 0.000553 0.271287 0.365587 0.321433 766.66 1033.94 1.000
pi(G){all} 0.296338 0.000547 0.249027 0.340836 0.296156 1061.71 1100.42 1.000
pi(T){all} 0.119740 0.000274 0.088736 0.153414 0.118758 623.80 807.86 1.000
alpha{1,2} 0.108833 0.000752 0.062121 0.165628 0.106103 1249.72 1375.36 1.000
alpha{3} 2.167137 0.669027 0.897424 3.785750 2.036796 1351.95 1374.40 1.000
pinvar{all} 0.329113 0.007477 0.162861 0.494978 0.333377 1282.45 1317.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- ......**....
14 -- .....***....
15 -- .........***
16 -- .....*******
17 -- ...**.......
18 -- ...*********
19 -- ..........**
20 -- .**.........
21 -- .....***.***
22 -- ........****
23 -- .....****...
24 -- ..**********
25 -- .*.*********
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 2996 0.998001 0.000000 0.998001 0.998001 2
14 2976 0.991339 0.000000 0.991339 0.991339 2
15 2946 0.981346 0.002827 0.979347 0.983344 2
16 2910 0.969354 0.001884 0.968021 0.970686 2
17 2661 0.886409 0.004240 0.883411 0.889407 2
18 2628 0.875416 0.010364 0.868088 0.882745 2
19 2561 0.853098 0.003298 0.850766 0.855430 2
20 2047 0.681879 0.009893 0.674883 0.688874 2
21 1501 0.500000 0.008951 0.493671 0.506329 2
22 889 0.296136 0.005182 0.292472 0.299800 2
23 581 0.193538 0.002355 0.191872 0.195203 2
24 473 0.157562 0.006124 0.153231 0.161892 2
25 443 0.147568 0.001413 0.146569 0.148568 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.029368 0.000226 0.005951 0.060572 0.026753 1.000 2
length{all}[2] 0.012015 0.000073 0.000583 0.028104 0.010133 1.000 2
length{all}[3] 0.005999 0.000038 0.000004 0.018116 0.004168 1.000 2
length{all}[4] 0.044102 0.000439 0.010485 0.084381 0.040585 1.000 2
length{all}[5] 0.049881 0.000447 0.012793 0.091140 0.046571 1.000 2
length{all}[6] 0.034757 0.000313 0.006633 0.069952 0.031832 1.001 2
length{all}[7] 0.011478 0.000104 0.000000 0.031989 0.008883 1.000 2
length{all}[8] 0.044741 0.000397 0.011258 0.083085 0.041412 1.000 2
length{all}[9] 0.126731 0.001553 0.057971 0.206747 0.121447 1.000 2
length{all}[10] 0.118345 0.001618 0.049100 0.200120 0.112693 1.000 2
length{all}[11] 0.068789 0.000906 0.019475 0.127975 0.063892 1.000 2
length{all}[12] 0.102103 0.001351 0.039812 0.176156 0.096683 1.000 2
length{all}[13] 0.030738 0.000294 0.004305 0.064456 0.027367 1.000 2
length{all}[14] 0.025472 0.000260 0.001992 0.056442 0.022070 1.000 2
length{all}[15] 0.046639 0.000646 0.005313 0.096292 0.042054 1.001 2
length{all}[16] 0.024013 0.000231 0.001164 0.053649 0.020915 1.000 2
length{all}[17] 0.019847 0.000197 0.000075 0.045875 0.016722 1.000 2
length{all}[18] 0.018202 0.000155 0.000178 0.043621 0.015522 1.000 2
length{all}[19] 0.037031 0.000608 0.000013 0.082942 0.032382 1.000 2
length{all}[20] 0.011222 0.000084 0.000025 0.030391 0.008918 1.000 2
length{all}[21] 0.013992 0.000160 0.000000 0.038361 0.010884 1.002 2
length{all}[22] 0.012174 0.000166 0.000001 0.038292 0.008297 1.000 2
length{all}[23] 0.007993 0.000070 0.000009 0.025161 0.005468 0.998 2
length{all}[24] 0.006013 0.000038 0.000002 0.018144 0.003913 0.998 2
length{all}[25] 0.006398 0.000051 0.000003 0.020198 0.003873 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004349
Maximum standard deviation of split frequencies = 0.010364
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /------------ C4 (4)
| /----------------------89---------------------+
| | \------------ C5 (5)
| |
| | /----------------------- C6 (6)
| | |
| | /-----99----+ /------------ C7 (7)
|-----88----+ | \----100---+
| | | \------------ C8 (8)
+ | /-----50----+
| | | | /----------------------- C10 (10)
| | | | |
| | | \-----98----+ /------------ C11 (11)
| \----97----+ \----85----+
| | \------------ C12 (12)
| |
| \----------------------------------------------- C9 (9)
|
| /------------ C2 (2)
\----------------------------68---------------------------+
\------------ C3 (3)
Phylogram (based on average branch lengths):
/--------- C1 (1)
|
| /------------- C4 (4)
| /----+
| | \--------------- C5 (5)
| |
| | /---------- C6 (6)
| | |
| | /------+ /--- C7 (7)
|----+ | \--------+
| | | \------------- C8 (8)
+ | /--+
| | | | /------------------------------------ C10 (10)
| | | | |
| | | \-------------+ /-------------------- C11 (11)
| \------+ \---------+
| | \------------------------------- C12 (12)
| |
| \--------------------------------------- C9 (9)
|
| /--- C2 (2)
\--+
\- C3 (3)
|---------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (263 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 54 trees
95 % credible set contains 116 trees
99 % credible set contains 233 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 360
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
3 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
3 ambiguity characters in seq. 7
3 ambiguity characters in seq. 8
3 ambiguity characters in seq. 9
3 ambiguity characters in seq. 10
3 ambiguity characters in seq. 11
6 ambiguity characters in seq. 12
3 sites are removed. 18 62 120
codon 38: TCC TCC TCC TCG TCC TCC TCC TCC AGC TCC TCC TCC
Sequences read..
Counting site patterns.. 0:00
85 patterns at 117 / 117 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
82960 bytes for conP
11560 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
1 0.062116
2 0.009409
3 0.008465
4 0.008366
5 0.008348
6 0.008345
7 0.008345
8 0.008345
9 0.008345
414800 bytes for conP, adjusted
0.020836 0.010408 0.021134 0.049273 0.061696 0.021934 0.006495 0.017808 0.046903 0.019896 0.015969 0.046363 0.055225 0.148686 0.023134 0.085210 0.103189 0.162332 0.005846 0.010116 0.000000 0.300000 1.300000
ntime & nrate & np: 21 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 23
lnL0 = -1172.893703
Iterating by ming2
Initial: fx= 1172.893703
x= 0.02084 0.01041 0.02113 0.04927 0.06170 0.02193 0.00649 0.01781 0.04690 0.01990 0.01597 0.04636 0.05523 0.14869 0.02313 0.08521 0.10319 0.16233 0.00585 0.01012 0.00000 0.30000 1.30000
1 h-m-p 0.0000 0.0000 276.9642 ++ 1172.893186 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 16389.2638 ++ 1168.957844 m 0.0000 54 | 2/23
3 h-m-p 0.0001 0.0005 150.6932 +YYCYCCC 1164.642668 6 0.0004 90 | 2/23
4 h-m-p 0.0000 0.0001 2142.6455 YCCCC 1161.802695 4 0.0000 123 | 2/23
5 h-m-p 0.0001 0.0003 306.1647 YCCCCC 1160.281102 5 0.0001 158 | 2/23
6 h-m-p 0.0001 0.0003 327.7685 +YCYCCC 1157.835767 5 0.0002 193 | 2/23
7 h-m-p 0.0001 0.0006 100.2845 CCCC 1157.294950 3 0.0002 225 | 2/23
8 h-m-p 0.0003 0.0014 40.9908 YCC 1157.217877 2 0.0001 254 | 2/23
9 h-m-p 0.0001 0.0029 35.5135 YCC 1157.114650 2 0.0003 283 | 2/23
10 h-m-p 0.0008 0.0058 12.1363 CCC 1157.092195 2 0.0003 313 | 2/23
11 h-m-p 0.0002 0.0100 18.1467 YC 1157.047942 1 0.0004 340 | 2/23
12 h-m-p 0.0013 0.0092 5.6716 CCC 1156.967962 2 0.0015 370 | 2/23
13 h-m-p 0.0006 0.0132 14.4049 +YCC 1156.576246 2 0.0018 400 | 2/23
14 h-m-p 0.0009 0.0045 19.1650 YCCCC 1155.359310 4 0.0021 433 | 2/23
15 h-m-p 0.0004 0.0018 41.7751 +YYCCCC 1152.625653 5 0.0012 468 | 2/23
16 h-m-p 0.0000 0.0002 157.8628 +YYYCCC 1150.813177 5 0.0002 502 | 2/23
17 h-m-p 0.0000 0.0001 154.5552 +YYCCCC 1150.045256 5 0.0001 537 | 2/23
18 h-m-p 0.0001 0.0004 234.7379 +YYYYC 1147.453756 4 0.0002 568 | 2/23
19 h-m-p 0.0008 0.0040 11.6691 CCCC 1147.364636 3 0.0009 600 | 2/23
20 h-m-p 0.0039 0.0411 2.6734 YCCC 1146.927574 3 0.0094 631 | 2/23
21 h-m-p 0.0008 0.0103 31.5744 +YYCC 1144.523486 3 0.0028 662 | 2/23
22 h-m-p 0.0015 0.0074 31.3378 CCCC 1142.816893 3 0.0019 694 | 2/23
23 h-m-p 0.0009 0.0045 55.3555 CYCCCC 1140.750072 5 0.0013 729 | 2/23
24 h-m-p 0.1555 1.4798 0.4708 +YYYYYC 1130.987312 5 0.6130 761 | 2/23
25 h-m-p 0.8669 5.3386 0.3330 CYCCC 1126.163222 4 0.6942 815 | 2/23
26 h-m-p 0.9039 4.5194 0.1233 +YCCC 1122.652755 3 2.3338 868 | 2/23
27 h-m-p 0.8798 4.3988 0.1121 YCCCC 1120.709333 4 1.6624 922 | 2/23
28 h-m-p 0.6570 3.2849 0.0630 CCCCC 1120.010609 4 1.0965 977 | 1/23
29 h-m-p 0.0328 0.4730 2.1027 ---YC 1120.010323 1 0.0001 1028 | 1/23
30 h-m-p 0.0140 6.9928 0.1080 +++YCCC 1118.517929 3 1.5239 1062 | 1/23
31 h-m-p 0.8925 4.4623 0.0981 YCCCC 1116.052429 4 2.1078 1117 | 1/23
32 h-m-p 0.7722 3.8608 0.1221 +YYYYCC 1107.908481 5 2.9531 1172 | 1/23
33 h-m-p 0.0595 0.2975 1.1414 +YYYCCC 1100.024808 5 0.2273 1228 | 1/23
34 h-m-p 0.1313 0.6566 1.8618 ++ 1008.532655 m 0.6566 1254 | 1/23
35 h-m-p 0.3795 1.8976 1.1151 YCYYCCC 1000.246807 6 0.0276 1290 | 1/23
36 h-m-p 0.0399 0.4408 0.7700 +CCCCC 978.852967 4 0.1747 1325 | 1/23
37 h-m-p 1.0824 5.4119 0.0523 +YCYCCC 969.580868 5 3.1106 1382 | 1/23
38 h-m-p 0.5915 2.9575 0.0692 +YYCCCC 964.998888 5 1.9539 1439 | 1/23
39 h-m-p 0.3806 1.9032 0.0675 +CYCC 961.578724 3 1.3858 1493 | 1/23
40 h-m-p 0.2143 1.0716 0.0522 +CCCC 960.063937 3 0.8589 1548 | 1/23
41 h-m-p 0.2051 1.0253 0.0685 +YCCC 959.065976 3 0.7072 1602 | 1/23
42 h-m-p 0.7345 7.8634 0.0660 YYCC 958.926129 3 0.2717 1654 | 1/23
43 h-m-p 0.5197 8.0000 0.0345 ++ 958.456224 m 8.0000 1702 | 1/23
44 h-m-p 1.4642 7.3208 0.0233 CCCCC 957.502498 4 2.1071 1758 | 1/23
45 h-m-p 0.5996 5.1183 0.0820 ++ 955.951822 m 5.1183 1806 | 1/23
46 h-m-p 1.3245 6.6224 0.0144 CYC 955.603995 2 1.3758 1857 | 1/23
47 h-m-p 0.2682 4.0858 0.0738 +YCCC 955.340039 3 2.3156 1911 | 1/23
48 h-m-p 1.6000 8.0000 0.1015 YCCC 955.031872 3 3.3041 1964 | 1/23
49 h-m-p 1.6000 8.0000 0.0634 CCC 954.893909 2 2.3622 2016 | 1/23
50 h-m-p 1.6000 8.0000 0.0344 CCC 954.821526 2 2.2213 2068 | 1/23
51 h-m-p 1.6000 8.0000 0.0036 CY 954.789182 1 1.6755 2118 | 1/23
52 h-m-p 1.2320 8.0000 0.0049 CC 954.767376 1 1.8205 2168 | 1/23
53 h-m-p 1.2917 8.0000 0.0069 YC 954.758968 1 2.8324 2217 | 1/23
54 h-m-p 1.4216 8.0000 0.0138 CC 954.755783 1 2.2406 2267 | 1/23
55 h-m-p 1.6000 8.0000 0.0045 YC 954.753261 1 3.3801 2316 | 1/23
56 h-m-p 1.6000 8.0000 0.0010 YC 954.751844 1 3.8794 2365 | 1/23
57 h-m-p 1.6000 8.0000 0.0006 YC 954.750658 1 2.9473 2414 | 1/23
58 h-m-p 0.7494 8.0000 0.0024 +YC 954.750075 1 2.3364 2464 | 1/23
59 h-m-p 1.6000 8.0000 0.0015 CC 954.749929 1 2.1897 2514 | 1/23
60 h-m-p 1.6000 8.0000 0.0007 Y 954.749884 0 2.5600 2562 | 1/23
61 h-m-p 1.6000 8.0000 0.0005 +YC 954.749822 1 4.2054 2612 | 1/23
62 h-m-p 1.6000 8.0000 0.0006 Y 954.749782 0 2.6174 2660 | 1/23
63 h-m-p 1.6000 8.0000 0.0003 C 954.749777 0 2.1399 2708 | 1/23
64 h-m-p 1.6000 8.0000 0.0000 Y 954.749772 0 3.5265 2756 | 1/23
65 h-m-p 1.6000 8.0000 0.0001 +Y 954.749768 0 4.7341 2805 | 1/23
66 h-m-p 1.3350 8.0000 0.0002 C 954.749766 0 1.5729 2853 | 1/23
67 h-m-p 1.6000 8.0000 0.0000 C 954.749766 0 2.0693 2901 | 1/23
68 h-m-p 1.6000 8.0000 0.0000 Y 954.749766 0 2.7159 2949 | 1/23
69 h-m-p 1.6000 8.0000 0.0000 C 954.749766 0 1.6000 2997 | 1/23
70 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/23
71 h-m-p 0.0160 8.0000 0.0074 ------------- | 1/23
72 h-m-p 0.0160 8.0000 0.0074 -------------
Out..
lnL = -954.749766
3178 lfun, 3178 eigenQcodon, 66738 P(t)
Time used: 0:20
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
1 0.042521
2 0.017587
3 0.013197
4 0.012840
5 0.012806
6 0.012798
7 0.012796
8 0.012796
9 0.012796
10 0.012796
11 0.008120
12 0.008120
0.020949 0.010298 0.020455 0.049495 0.061294 0.021132 0.006055 0.017394 0.046369 0.019806 0.015366 0.046461 0.055439 0.149988 0.023080 0.085176 0.103413 0.163627 0.005159 0.009706 0.000000 3.883616 0.630989 0.207592
ntime & nrate & np: 21 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.536226
np = 24
lnL0 = -1015.400960
Iterating by ming2
Initial: fx= 1015.400960
x= 0.02095 0.01030 0.02046 0.04950 0.06129 0.02113 0.00606 0.01739 0.04637 0.01981 0.01537 0.04646 0.05544 0.14999 0.02308 0.08518 0.10341 0.16363 0.00516 0.00971 0.00000 3.88362 0.63099 0.20759
1 h-m-p 0.0000 0.0000 238.2110 ++ 1015.400029 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0001 435.9084 ++ 1011.580378 m 0.0001 104 | 1/24
3 h-m-p 0.0000 0.0000 1530.7879 ++ 1005.429461 m 0.0000 154 | 1/24
4 h-m-p -0.0000 -0.0000 292501.1240
h-m-p: -2.41111418e-24 -1.20555709e-23 2.92501124e+05 1005.429461
.. | 1/24
5 h-m-p 0.0000 0.0012 382.5603 +++YCYCCCC 986.070616 6 0.0011 265 | 1/24
6 h-m-p 0.0000 0.0001 205.9727 YCYCCC 985.131167 5 0.0000 323 | 1/24
7 h-m-p 0.0001 0.0008 181.5460 ++ 980.048137 m 0.0008 373 | 2/24
8 h-m-p 0.0001 0.0005 74.4081 +YCCC 979.620050 3 0.0003 429 | 2/24
9 h-m-p 0.0000 0.0001 101.4934 ++ 979.043573 m 0.0001 478 | 3/24
10 h-m-p 0.0008 0.0042 14.8049 +CCC 978.246098 2 0.0035 532 | 3/24
11 h-m-p 0.0021 0.0103 23.4924 YCCC 976.819613 3 0.0037 585 | 3/24
12 h-m-p 0.0017 0.0083 35.7942 +YYCCC 970.569823 4 0.0062 640 | 3/24
13 h-m-p 0.0005 0.0026 58.9470 +YYCCC 967.182181 4 0.0019 695 | 2/24
14 h-m-p 0.0001 0.0003 148.6935 ++ 965.422536 m 0.0003 743 | 2/24
15 h-m-p 0.0000 0.0000 78.0864
h-m-p: 4.88818794e-20 2.44409397e-19 7.80863995e+01 965.422536
.. | 2/24
16 h-m-p 0.0000 0.0001 174.0931 +YYCCCCC 964.606332 6 0.0000 849 | 2/24
17 h-m-p 0.0001 0.0007 137.3362 ++ 958.401367 m 0.0007 898 | 2/24
18 h-m-p 0.0001 0.0003 124.4959 +YYCYCC 957.330087 5 0.0002 955 | 2/24
19 h-m-p 0.0001 0.0005 297.1340 +YYCCC 954.240512 4 0.0003 1011 | 2/24
20 h-m-p 0.0001 0.0007 97.4920 YCYCCC 953.529641 5 0.0003 1068 | 1/24
21 h-m-p 0.0000 0.0001 337.6917 YCC 952.995053 2 0.0000 1120 | 1/24
22 h-m-p 0.0002 0.0011 79.5833 CCCC 952.656793 3 0.0003 1176 | 1/24
23 h-m-p 0.0001 0.0010 155.0595 +YYCCC 951.436917 4 0.0005 1233 | 1/24
24 h-m-p 0.0005 0.0026 108.5015 CYC 950.783316 2 0.0005 1286 | 1/24
25 h-m-p 0.0003 0.0014 95.0781 YCCCC 950.118796 4 0.0006 1343 | 1/24
26 h-m-p 0.0005 0.0024 42.6532 YC 950.023444 1 0.0003 1394 | 1/24
27 h-m-p 0.0011 0.0073 10.1098 YC 949.997877 1 0.0006 1445 | 1/24
28 h-m-p 0.0011 0.0171 5.1411 YC 949.988671 1 0.0006 1496 | 1/24
29 h-m-p 0.0011 0.0489 2.5450 YC 949.956509 1 0.0027 1547 | 1/24
30 h-m-p 0.0008 0.0187 8.1091 YC 949.838925 1 0.0020 1598 | 1/24
31 h-m-p 0.0007 0.0172 21.6316 +CC 949.256255 1 0.0028 1651 | 1/24
32 h-m-p 0.0004 0.0020 50.9132 CCCC 948.895251 3 0.0007 1707 | 1/24
33 h-m-p 0.0011 0.0063 30.2144 YCCC 948.060003 3 0.0026 1762 | 1/24
34 h-m-p 0.0003 0.0017 20.0499 YCCC 947.976330 3 0.0006 1817 | 1/24
35 h-m-p 0.0015 0.0084 8.0416 CCC 947.964164 2 0.0005 1871 | 1/24
36 h-m-p 0.0008 0.0209 4.7823 CC 947.953732 1 0.0011 1923 | 1/24
37 h-m-p 0.0034 0.0616 1.6139 YC 947.949715 1 0.0018 1974 | 1/24
38 h-m-p 0.0119 0.6815 0.2450 +CCC 947.833204 2 0.0559 2029 | 1/24
39 h-m-p 0.0013 0.0145 10.3664 CCC 947.660519 2 0.0017 2083 | 1/24
40 h-m-p 0.3507 2.5132 0.0490 CCC 947.533003 2 0.3138 2137 | 1/24
41 h-m-p 0.3236 8.0000 0.0475 +CCC 947.484038 2 1.2726 2192 | 1/24
42 h-m-p 1.6000 8.0000 0.0268 YC 947.478818 1 0.8556 2243 | 1/24
43 h-m-p 1.6000 8.0000 0.0134 YC 947.478017 1 1.0803 2294 | 1/24
44 h-m-p 1.6000 8.0000 0.0043 Y 947.477913 0 1.2719 2344 | 1/24
45 h-m-p 1.6000 8.0000 0.0002 Y 947.477907 0 1.1466 2394 | 1/24
46 h-m-p 0.6416 8.0000 0.0004 Y 947.477906 0 1.4322 2444 | 1/24
47 h-m-p 1.6000 8.0000 0.0002 C 947.477906 0 1.6000 2494 | 1/24
48 h-m-p 1.6000 8.0000 0.0001 Y 947.477906 0 1.1113 2544 | 1/24
49 h-m-p 1.6000 8.0000 0.0000 Y 947.477906 0 0.7093 2594 | 1/24
50 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/24
51 h-m-p 0.0160 8.0000 0.0011 -------------
Out..
lnL = -947.477906
2720 lfun, 8160 eigenQcodon, 114240 P(t)
Time used: 0:53
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
1 0.093547
2 0.010167
3 0.008674
4 0.008622
5 0.008613
6 0.008612
7 0.008612
8 0.008612
initial w for M2:NSpselection reset.
0.021428 0.010687 0.021312 0.049579 0.061337 0.021961 0.006459 0.018453 0.047006 0.020716 0.016434 0.046440 0.055137 0.148798 0.022952 0.084352 0.102314 0.162498 0.005817 0.010688 0.000000 4.129224 1.237723 0.153992 0.218428 2.873198
ntime & nrate & np: 21 3 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.898639
np = 26
lnL0 = -1034.641462
Iterating by ming2
Initial: fx= 1034.641462
x= 0.02143 0.01069 0.02131 0.04958 0.06134 0.02196 0.00646 0.01845 0.04701 0.02072 0.01643 0.04644 0.05514 0.14880 0.02295 0.08435 0.10231 0.16250 0.00582 0.01069 0.00000 4.12922 1.23772 0.15399 0.21843 2.87320
1 h-m-p 0.0000 0.0000 245.0700 ++ 1034.640259 m 0.0000 57 | 1/26
2 h-m-p 0.0000 0.0001 274.1049 ++ 1032.161305 m 0.0001 112 | 1/26
3 h-m-p -0.0000 -0.0000 406.1111
h-m-p: -1.17477001e-20 -5.87385003e-20 4.06111109e+02 1032.161305
.. | 1/26
4 h-m-p 0.0000 0.0023 423.8370 ++YYYCCC 1027.140315 5 0.0002 226 | 1/26
5 h-m-p 0.0003 0.0016 168.7563 ++ 990.420597 m 0.0016 280 | 2/26
6 h-m-p 0.0005 0.0026 110.8770 +YYYYC 982.268355 4 0.0020 339 | 1/26
7 h-m-p 0.0000 0.0001 1034.1254 +YCCC 980.786655 3 0.0001 398 | 1/26
8 h-m-p 0.0001 0.0007 473.7764 YCCC 977.221202 3 0.0003 457 | 1/26
9 h-m-p 0.0006 0.0031 142.3677 YCCC 973.429608 3 0.0015 516 | 1/26
10 h-m-p 0.0002 0.0012 83.3313 YCYCCC 972.292672 5 0.0005 578 | 1/26
11 h-m-p 0.0002 0.0012 167.0106 ++ 968.482991 m 0.0012 632 | 1/26
12 h-m-p 0.0005 0.0027 79.2149 +YYCC 966.380617 3 0.0019 691 | 1/26
13 h-m-p 0.0006 0.0032 76.4556 +YCCC 964.925418 3 0.0020 751 | 1/26
14 h-m-p 0.0012 0.0058 42.5096 YCCCC 964.108288 4 0.0022 812 | 1/26
15 h-m-p 0.0035 0.0174 16.5927 CCC 963.728870 2 0.0043 870 | 1/26
16 h-m-p 0.0037 0.0229 19.4552 CCCC 963.257044 3 0.0055 930 | 1/26
17 h-m-p 0.0060 0.0298 8.9307 CCYC 963.072108 3 0.0059 989 | 1/26
18 h-m-p 0.0048 0.0391 10.9787 CCC 962.936206 2 0.0039 1047 | 1/26
19 h-m-p 0.0039 0.0271 10.8567 +YCCC 962.424332 3 0.0127 1107 | 1/26
20 h-m-p 0.0024 0.0120 38.7029 +YCCC 961.476785 3 0.0064 1167 | 1/26
21 h-m-p 0.0025 0.0123 60.8983 +YYCCC 959.245724 4 0.0087 1228 | 1/26
22 h-m-p 0.0004 0.0020 143.1755 ++ 957.696372 m 0.0020 1282 | 1/26
23 h-m-p 0.0043 0.0217 9.1791 YCC 957.608218 2 0.0031 1339 | 1/26
24 h-m-p 0.0024 0.0120 6.7087 ++ 957.380298 m 0.0120 1393 | 1/26
25 h-m-p 0.0052 0.0341 15.5253 CC 957.188440 1 0.0052 1449 | 1/26
26 h-m-p 0.0044 0.1930 18.4427 ++CYCCCC 953.402168 5 0.0846 1514 | 1/26
27 h-m-p 0.0041 0.0204 18.6359 CCC 953.262803 2 0.0036 1572 | 1/26
28 h-m-p 0.0594 0.2969 0.9377 ++ 951.925593 m 0.2969 1626 | 1/26
29 h-m-p 0.0000 0.0000 1.4215
h-m-p: 6.96412380e-17 3.48206190e-16 1.42152129e+00 951.925593
.. | 1/26
30 h-m-p 0.0000 0.0003 55.8989 +CCCC 951.839341 3 0.0001 1738 | 1/26
31 h-m-p 0.0001 0.0027 40.0834 ++YYCC 951.339773 3 0.0008 1798 | 1/26
32 h-m-p 0.0005 0.0026 62.9820 CYC 951.034527 2 0.0004 1855 | 1/26
33 h-m-p 0.0004 0.0018 43.2823 CCCC 950.821546 3 0.0005 1915 | 1/26
34 h-m-p 0.0007 0.0033 17.6955 CC 950.744148 1 0.0008 1971 | 1/26
35 h-m-p 0.0005 0.0023 16.9510 CCC 950.707244 2 0.0005 2029 | 1/26
36 h-m-p 0.0010 0.0298 8.7803 +YC 950.650252 1 0.0026 2085 | 1/26
37 h-m-p 0.0010 0.0082 23.9581 YCCC 950.548349 3 0.0018 2144 | 1/26
38 h-m-p 0.0007 0.0091 57.4686 YC 950.362162 1 0.0015 2199 | 1/26
39 h-m-p 0.0011 0.0065 76.8079 CCC 950.129592 2 0.0014 2257 | 1/26
40 h-m-p 0.0023 0.0113 46.8967 YYC 949.950053 2 0.0018 2313 | 1/26
41 h-m-p 0.0025 0.0178 34.1776 YCC 949.831865 2 0.0018 2370 | 1/26
42 h-m-p 0.0009 0.0045 38.1507 YYC 949.776147 2 0.0008 2426 | 1/26
43 h-m-p 0.0039 0.0260 7.3940 CC 949.764047 1 0.0011 2482 | 1/26
44 h-m-p 0.0030 0.0683 2.6751 YC 949.759656 1 0.0017 2537 | 1/26
45 h-m-p 0.0015 0.0917 2.9252 YC 949.751358 1 0.0034 2592 | 1/26
46 h-m-p 0.0011 0.0493 9.1419 +CCC 949.714092 2 0.0049 2651 | 1/26
47 h-m-p 0.0011 0.0142 39.4608 CC 949.671681 1 0.0013 2707 | 1/26
48 h-m-p 0.0016 0.0405 33.0193 +CCCC 949.348497 3 0.0112 2768 | 1/26
49 h-m-p 0.0008 0.0043 466.0339 YCCC 948.776961 3 0.0015 2827 | 1/26
50 h-m-p 0.0027 0.0133 60.0939 YC 948.712135 1 0.0014 2882 | 1/26
51 h-m-p 0.0107 0.0535 4.0121 -CC 948.709772 1 0.0008 2939 | 1/26
52 h-m-p 0.0021 0.6972 1.6184 +CC 948.701372 1 0.0070 2996 | 1/26
53 h-m-p 0.0100 5.0141 1.9076 ++CYC 948.353406 2 0.1916 3055 | 1/26
54 h-m-p 0.5156 7.6747 0.7089 YCCC 948.064489 3 1.1110 3114 | 1/26
55 h-m-p 0.4552 2.2760 0.8339 YCCC 947.824349 3 0.9000 3173 | 1/26
56 h-m-p 1.1752 8.0000 0.6386 YYC 947.727950 2 0.9419 3229 | 1/26
57 h-m-p 0.8444 8.0000 0.7124 CYC 947.624561 2 1.0552 3286 | 1/26
58 h-m-p 0.8754 8.0000 0.8586 CCC 947.558818 2 1.2348 3344 | 1/26
59 h-m-p 1.6000 8.0000 0.6520 CCC 947.522990 2 1.5314 3402 | 1/26
60 h-m-p 1.6000 8.0000 0.6107 CCC 947.505086 2 1.2791 3460 | 1/26
61 h-m-p 0.8611 8.0000 0.9071 CC 947.492041 1 1.1568 3516 | 1/26
62 h-m-p 1.4248 7.7378 0.7365 YC 947.487006 1 1.0010 3571 | 1/26
63 h-m-p 0.8843 8.0000 0.8337 CCC 947.482678 2 1.2577 3629 | 1/26
64 h-m-p 1.3421 8.0000 0.7813 CC 947.480603 1 1.2250 3685 | 1/26
65 h-m-p 1.0977 8.0000 0.8719 CC 947.479520 1 0.9181 3741 | 1/26
66 h-m-p 0.9643 8.0000 0.8301 CC 947.478791 1 1.1940 3797 | 1/26
67 h-m-p 1.2558 8.0000 0.7892 C 947.478416 0 1.2032 3851 | 1/26
68 h-m-p 1.1318 8.0000 0.8391 C 947.478179 0 1.1318 3905 | 1/26
69 h-m-p 1.2531 8.0000 0.7578 C 947.478057 0 1.2531 3959 | 1/26
70 h-m-p 1.2049 8.0000 0.7881 C 947.477984 0 1.5417 4013 | 1/26
71 h-m-p 1.5905 8.0000 0.7639 Y 947.477947 0 1.2315 4067 | 1/26
72 h-m-p 1.3604 8.0000 0.6916 C 947.477928 0 1.3604 4121 | 1/26
73 h-m-p 1.1459 8.0000 0.8210 C 947.477919 0 1.2861 4175 | 1/26
74 h-m-p 1.3209 8.0000 0.7994 C 947.477912 0 1.6515 4229 | 1/26
75 h-m-p 1.6000 8.0000 0.6314 C 947.477909 0 1.5193 4283 | 1/26
76 h-m-p 1.4604 8.0000 0.6569 C 947.477908 0 1.9291 4337 | 1/26
77 h-m-p 1.6000 8.0000 0.3257 C 947.477907 0 1.4050 4391 | 1/26
78 h-m-p 1.1974 8.0000 0.3822 Y 947.477907 0 2.9370 4445 | 1/26
79 h-m-p 1.6000 8.0000 0.4828 C 947.477906 0 2.0521 4499 | 1/26
80 h-m-p 1.6000 8.0000 0.1642 C 947.477906 0 0.4000 4553 | 1/26
81 h-m-p 0.1164 8.0000 0.5641 C 947.477906 0 0.1080 4607 | 1/26
82 h-m-p 1.6000 8.0000 0.0163 Y 947.477906 0 1.6000 4661 | 1/26
83 h-m-p 0.6852 8.0000 0.0382 ++ 947.477906 m 8.0000 4715 | 1/26
84 h-m-p 0.8338 8.0000 0.3662 --Y 947.477906 0 0.0084 4771 | 1/26
85 h-m-p 0.9712 8.0000 0.0032 +C 947.477906 0 3.8846 4826 | 1/26
86 h-m-p 1.5379 8.0000 0.0080 --C 947.477906 0 0.0240 4882 | 1/26
87 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 1/26
88 h-m-p 0.0136 6.8224 0.0081 --C 947.477906 0 0.0002 5006 | 1/26
89 h-m-p 0.0047 2.3408 0.0069 -Y 947.477906 0 0.0003 5061 | 1/26
90 h-m-p 0.0149 7.4456 0.0035 -------------.. | 1/26
91 h-m-p 0.0053 2.6612 0.0078 ---Y 947.477906 0 0.0000 5183 | 1/26
92 h-m-p 0.0160 8.0000 0.0021 -------------.. | 1/26
93 h-m-p 0.0069 3.4560 0.0063 -------------
Out..
lnL = -947.477906
5314 lfun, 21256 eigenQcodon, 334782 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -964.321495 S = -931.051174 -25.182219
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 85 patterns 2:29
did 20 / 85 patterns 2:29
did 30 / 85 patterns 2:29
did 40 / 85 patterns 2:30
did 50 / 85 patterns 2:30
did 60 / 85 patterns 2:30
did 70 / 85 patterns 2:30
did 80 / 85 patterns 2:30
did 85 / 85 patterns 2:30
Time used: 2:30
Model 3: discrete
TREE # 1
(1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
1 0.080268
2 0.009847
3 0.008586
4 0.008453
5 0.008421
6 0.008420
7 0.008420
8 0.008420
0.021800 0.011240 0.020997 0.049559 0.061605 0.021365 0.006607 0.018078 0.046066 0.020625 0.015336 0.046104 0.055357 0.148899 0.023812 0.085339 0.103406 0.162512 0.005277 0.009831 0.000000 4.129235 0.387814 0.891300 0.017593 0.040081 0.073178
ntime & nrate & np: 21 4 27
Bounds (np=27):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.601295
np = 27
lnL0 = -956.221286
Iterating by ming2
Initial: fx= 956.221286
x= 0.02180 0.01124 0.02100 0.04956 0.06161 0.02137 0.00661 0.01808 0.04607 0.02063 0.01534 0.04610 0.05536 0.14890 0.02381 0.08534 0.10341 0.16251 0.00528 0.00983 0.00000 4.12924 0.38781 0.89130 0.01759 0.04008 0.07318
1 h-m-p 0.0000 0.0000 186.7834 ++ 956.220768 m 0.0000 59 | 1/27
2 h-m-p 0.0000 0.0001 286.8858 ++ 954.292967 m 0.0001 116 | 1/27
3 h-m-p 0.0000 0.0000 886.8466 ++ 953.316108 m 0.0000 172 | 2/27
4 h-m-p 0.0000 0.0000 8172.4921 +CCCC 950.915337 3 0.0000 235 | 2/27
5 h-m-p 0.0000 0.0000 422.9522 ++ 950.372376 m 0.0000 290 | 3/27
6 h-m-p 0.0000 0.0002 67.5622 +YCCC 950.150057 3 0.0001 351 | 3/27
7 h-m-p 0.0001 0.0007 38.1489 ++ 949.459080 m 0.0007 405 | 3/27
8 h-m-p 0.0001 0.0005 41.9144 +CCC 949.126349 2 0.0004 464 | 3/27
9 h-m-p 0.0005 0.0037 32.6348 CYCC 948.936347 3 0.0003 523 | 3/27
10 h-m-p 0.0003 0.0014 28.2790 CCCC 948.712900 3 0.0004 583 | 3/27
11 h-m-p 0.0003 0.0017 30.9958 CCCC 948.357192 3 0.0006 643 | 3/27
12 h-m-p 0.0002 0.0012 23.5108 +YCCC 947.981828 3 0.0007 703 | 3/27
13 h-m-p 0.0010 0.0083 17.8065 CCC 947.790219 2 0.0011 761 | 3/27
14 h-m-p 0.0010 0.0052 17.2819 YCC 947.702474 2 0.0008 818 | 3/27
15 h-m-p 0.0012 0.0100 12.2622 YC 947.675090 1 0.0006 873 | 3/27
16 h-m-p 0.0019 0.0221 3.6823 YC 947.662962 1 0.0015 928 | 3/27
17 h-m-p 0.0006 0.0085 9.1292 +YC 947.628705 1 0.0017 984 | 3/27
18 h-m-p 0.0006 0.0385 26.2812 +YCCC 947.300263 3 0.0056 1044 | 3/27
19 h-m-p 0.0019 0.0166 75.5972 CYC 946.955161 2 0.0022 1101 | 3/27
20 h-m-p 0.0011 0.0091 149.2476 CCC 946.426449 2 0.0017 1159 | 3/27
21 h-m-p 0.0018 0.0090 6.4556 CC 946.420277 1 0.0005 1215 | 3/27
22 h-m-p 0.0013 0.0541 2.7130 CC 946.413086 1 0.0017 1271 | 3/27
23 h-m-p 0.0034 0.1371 1.3826 YC 946.394323 1 0.0067 1326 | 3/27
24 h-m-p 0.0028 0.0744 3.2584 +YCCC 946.235425 3 0.0174 1386 | 3/27
25 h-m-p 0.0017 0.0370 34.2536 +CYC 945.565344 2 0.0066 1444 | 3/27
26 h-m-p 0.9480 8.0000 0.2379 CC 945.192764 1 1.4917 1500 | 2/27
27 h-m-p 0.0002 0.0033 1561.5163 YCCC 945.063437 3 0.0001 1559 | 2/27
28 h-m-p 1.0550 6.7524 0.1849 CCC 944.938884 2 1.3712 1618 | 1/27
29 h-m-p 0.0030 0.0150 66.6897 -YC 944.936101 1 0.0001 1675 | 1/27
30 h-m-p 0.1205 8.0000 0.0715 ++CC 944.915664 1 1.7111 1735 | 1/27
31 h-m-p 1.6000 8.0000 0.0278 YC 944.902750 1 3.0328 1792 | 1/27
32 h-m-p 1.6000 8.0000 0.0235 CC 944.897443 1 1.7069 1850 | 1/27
33 h-m-p 1.6000 8.0000 0.0098 C 944.896591 0 1.6861 1906 | 1/27
34 h-m-p 1.6000 8.0000 0.0032 +YC 944.894807 1 5.0986 1964 | 1/27
35 h-m-p 1.6000 8.0000 0.0090 CC 944.892912 1 2.3607 2022 | 1/27
36 h-m-p 1.6000 8.0000 0.0071 CC 944.892504 1 1.2972 2080 | 1/27
37 h-m-p 1.6000 8.0000 0.0027 C 944.892428 0 1.8260 2136 | 1/27
38 h-m-p 1.6000 8.0000 0.0025 YC 944.892332 1 3.9767 2193 | 1/27
39 h-m-p 1.6000 8.0000 0.0028 Y 944.892317 0 1.2149 2249 | 1/27
40 h-m-p 1.6000 8.0000 0.0003 Y 944.892316 0 1.1896 2305 | 1/27
41 h-m-p 1.6000 8.0000 0.0001 C 944.892316 0 1.3773 2361 | 1/27
42 h-m-p 1.6000 8.0000 0.0000 Y 944.892316 0 3.0952 2417 | 1/27
43 h-m-p 1.6000 8.0000 0.0001 +Y 944.892316 0 5.0374 2474 | 1/27
44 h-m-p 1.6000 8.0000 0.0001 C 944.892316 0 1.3085 2530 | 1/27
45 h-m-p 1.6000 8.0000 0.0000 C 944.892316 0 1.6000 2586 | 1/27
46 h-m-p 1.6000 8.0000 0.0000 --------------C 944.892316 0 0.0000 2656
Out..
lnL = -944.892316
2657 lfun, 10628 eigenQcodon, 167391 P(t)
Time used: 3:18
Model 7: beta
TREE # 1
(1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
1 0.041515
2 0.008912
3 0.008329
4 0.008320
5 0.008319
6 0.008319
7 0.008319
0.021529 0.010430 0.020759 0.050242 0.060881 0.021370 0.006661 0.018144 0.046197 0.019690 0.015750 0.046552 0.055179 0.148597 0.023065 0.085193 0.103310 0.162029 0.006250 0.009784 0.000000 3.916643 0.275304 1.140227
ntime & nrate & np: 21 1 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.029952
np = 24
lnL0 = -969.899955
Iterating by ming2
Initial: fx= 969.899955
x= 0.02153 0.01043 0.02076 0.05024 0.06088 0.02137 0.00666 0.01814 0.04620 0.01969 0.01575 0.04655 0.05518 0.14860 0.02306 0.08519 0.10331 0.16203 0.00625 0.00978 0.00000 3.91664 0.27530 1.14023
1 h-m-p 0.0000 0.0000 213.8107 ++ 969.899187 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0001 234.6701 ++ 967.665827 m 0.0001 104 | 1/24
3 h-m-p 0.0000 0.0001 651.6979 ++ 963.940404 m 0.0001 154 | 1/24
4 h-m-p -0.0000 -0.0000 2095.1262
h-m-p: -2.15715604e-22 -1.07857802e-21 2.09512620e+03 963.940404
.. | 1/24
5 h-m-p 0.0000 0.0012 569.0437 +YCYCCC 959.746066 5 0.0001 260 | 1/24
6 h-m-p 0.0001 0.0006 134.8103 ++ 952.146059 m 0.0006 310 | 1/24
7 h-m-p 0.0001 0.0004 424.2230 YCYCCC 946.862884 5 0.0002 368 | 1/24
8 h-m-p 0.0001 0.0006 89.5252 YCCCC 946.089194 4 0.0003 425 | 1/24
9 h-m-p 0.0001 0.0005 34.7145 CYCCC 946.015585 4 0.0001 482 | 1/24
10 h-m-p 0.0003 0.0030 16.1421 YC 945.962147 1 0.0005 533 | 1/24
11 h-m-p 0.0006 0.0091 15.0709 CCC 945.930353 2 0.0005 587 | 1/24
12 h-m-p 0.0004 0.0022 20.5146 CYC 945.904282 2 0.0004 640 | 1/24
13 h-m-p 0.0006 0.0087 11.3077 C 945.885755 0 0.0006 690 | 1/24
14 h-m-p 0.0005 0.0121 15.9442 +YC 945.841731 1 0.0012 742 | 1/24
15 h-m-p 0.0006 0.0093 31.1113 +CCC 945.665804 2 0.0025 797 | 1/24
16 h-m-p 0.0009 0.0043 79.0356 CCCC 945.508493 3 0.0009 853 | 1/24
17 h-m-p 0.0015 0.0082 45.9955 YYC 945.392379 2 0.0012 905 | 1/24
18 h-m-p 0.0012 0.0060 36.1810 YCC 945.336674 2 0.0008 958 | 1/24
19 h-m-p 0.0009 0.0046 11.9267 YC 945.325092 1 0.0006 1009 | 1/24
20 h-m-p 0.0021 0.0365 3.2351 C 945.323209 0 0.0006 1059 | 1/24
21 h-m-p 0.0022 0.0750 0.8437 CC 945.322877 1 0.0009 1111 | 1/24
22 h-m-p 0.0013 0.4157 0.5562 YC 945.322438 1 0.0022 1162 | 1/24
23 h-m-p 0.0037 0.2650 0.3261 YC 945.321925 1 0.0028 1213 | 1/24
24 h-m-p 0.0029 0.0812 0.3118 +YC 945.317556 1 0.0074 1265 | 1/24
25 h-m-p 0.0011 0.1070 2.0502 ++CCC 945.172095 2 0.0169 1321 | 1/24
26 h-m-p 0.0034 0.0168 6.1978 CCC 945.150359 2 0.0013 1375 | 1/24
27 h-m-p 0.0091 0.2345 0.9054 CC 945.149062 1 0.0026 1427 | 1/24
28 h-m-p 0.2267 5.4677 0.0105 +CCCC 944.994406 3 1.3230 1484 | 1/24
29 h-m-p 0.4793 8.0000 0.0291 YC 944.955814 1 1.0546 1535 | 1/24
30 h-m-p 0.7893 8.0000 0.0389 C 944.948713 0 0.7893 1585 | 1/24
31 h-m-p 1.6000 8.0000 0.0175 CC 944.946257 1 1.4590 1637 | 1/24
32 h-m-p 1.0694 8.0000 0.0239 +YC 944.941423 1 2.9318 1689 | 1/24
33 h-m-p 1.6000 8.0000 0.0184 YC 944.940148 1 0.9895 1740 | 1/24
34 h-m-p 1.6000 8.0000 0.0009 YC 944.940118 1 0.8244 1791 | 1/24
35 h-m-p 1.6000 8.0000 0.0002 Y 944.940117 0 0.8894 1841 | 1/24
36 h-m-p 1.6000 8.0000 0.0000 Y 944.940117 0 0.8926 1891 | 1/24
37 h-m-p 1.6000 8.0000 0.0000 Y 944.940117 0 1.6000 1941 | 1/24
38 h-m-p 1.6000 8.0000 0.0000 Y 944.940117 0 1.6000 1991 | 1/24
39 h-m-p 0.6360 8.0000 0.0000 --------------C 944.940117 0 0.0000 2055
Out..
lnL = -944.940117
2056 lfun, 22616 eigenQcodon, 431760 P(t)
Time used: 5:24
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
1 0.092485
2 0.010142
3 0.009199
4 0.009098
5 0.009088
6 0.009088
7 0.009088
8 0.009088
9 0.009088
initial w for M8:NSbetaw>1 reset.
0.021357 0.011924 0.021812 0.049467 0.061350 0.022500 0.007492 0.017758 0.046600 0.020449 0.015869 0.047263 0.054837 0.149238 0.023503 0.084599 0.102025 0.161914 0.005677 0.010371 0.000000 3.908869 0.900000 1.017971 1.440735 2.095350
ntime & nrate & np: 21 2 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.047576
np = 26
lnL0 = -1020.173427
Iterating by ming2
Initial: fx= 1020.173427
x= 0.02136 0.01192 0.02181 0.04947 0.06135 0.02250 0.00749 0.01776 0.04660 0.02045 0.01587 0.04726 0.05484 0.14924 0.02350 0.08460 0.10202 0.16191 0.00568 0.01037 0.00000 3.90887 0.90000 1.01797 1.44073 2.09535
1 h-m-p 0.0000 0.0000 216.9936 ++ 1020.172613 m 0.0000 57 | 1/26
2 h-m-p 0.0000 0.0001 287.7569 ++ 1018.124956 m 0.0001 112 | 1/26
3 h-m-p 0.0000 0.0001 590.8318 ++ 1013.893879 m 0.0001 166 | 1/26
4 h-m-p 0.0000 0.0000 2533.5376 ++ 1007.517114 m 0.0000 220 | 2/26
5 h-m-p 0.0001 0.0003 195.6992 +YCC 1006.794934 2 0.0002 278 | 2/26
6 h-m-p 0.0002 0.0009 180.0656 +YCYCCC 1004.775854 5 0.0005 340 | 2/26
7 h-m-p 0.0001 0.0004 585.0131 +YYCCCC 1000.353160 5 0.0003 402 | 2/26
8 h-m-p 0.0000 0.0001 3252.6118 +YCYCCC 995.722330 5 0.0001 464 | 2/26
9 h-m-p 0.0000 0.0001 2145.4603 +YYCYCC 990.092896 5 0.0001 525 | 2/26
10 h-m-p 0.0000 0.0000 5638.9127 +CYCCC 984.365845 4 0.0000 586 | 2/26
11 h-m-p 0.0000 0.0000 3813.3527 +YC 982.996333 1 0.0000 641 | 2/26
12 h-m-p 0.0000 0.0000 1432.0664 ++ 982.827082 m 0.0000 694 | 2/26
13 h-m-p 0.0000 0.0000 5275318.8085
h-m-p: 4.15303457e-27 2.07651728e-26 5.27531881e+06 982.827082
.. | 2/26
14 h-m-p 0.0000 0.0012 1783.9540 +YYCYCCC 958.393481 6 0.0001 807 | 2/26
15 h-m-p 0.0001 0.0005 168.7106 +YYYYYYCCCC 952.665385 10 0.0004 874 | 2/26
16 h-m-p 0.0000 0.0001 387.2676 +YCCC 950.966227 3 0.0001 933 | 2/26
17 h-m-p 0.0001 0.0004 81.1555 ++ 950.090255 m 0.0004 986 | 1/26
18 h-m-p 0.0001 0.0003 147.2412 +CCC 948.588627 2 0.0003 1044 | 1/26
19 h-m-p 0.0002 0.0010 109.1910 CCCCC 947.857506 4 0.0003 1106 | 1/26
20 h-m-p 0.0001 0.0007 71.0797 +YYCC 947.266745 3 0.0005 1165 | 1/26
21 h-m-p 0.0000 0.0001 172.5818 ++ 946.801520 m 0.0001 1219 | 1/26
22 h-m-p -0.0000 -0.0000 90.8101
h-m-p: -1.49860366e-22 -7.49301831e-22 9.08101239e+01 946.801520
.. | 1/26
23 h-m-p 0.0000 0.0001 86.1105 ++ 946.273915 m 0.0001 1324 | 2/26
24 h-m-p 0.0001 0.0003 109.5633 YCYCCC 945.748939 5 0.0002 1386 | 2/26
25 h-m-p 0.0001 0.0006 120.5637 CCC 945.444115 2 0.0001 1443 | 2/26
26 h-m-p 0.0005 0.0054 28.4240 CCC 945.297697 2 0.0005 1500 | 2/26
27 h-m-p 0.0002 0.0010 27.1191 CCCC 945.232345 3 0.0003 1559 | 2/26
28 h-m-p 0.0003 0.0024 32.5459 C 945.183384 0 0.0003 1612 | 2/26
29 h-m-p 0.0006 0.0065 13.2585 YC 945.162939 1 0.0004 1666 | 2/26
30 h-m-p 0.0007 0.0045 8.2516 YC 945.152541 1 0.0005 1720 | 2/26
31 h-m-p 0.0008 0.0180 5.0213 YC 945.149697 1 0.0004 1774 | 2/26
32 h-m-p 0.0007 0.0094 2.8330 YC 945.148671 1 0.0004 1828 | 2/26
33 h-m-p 0.0009 0.0605 1.1787 YC 945.148316 1 0.0007 1882 | 2/26
34 h-m-p 0.0008 0.2159 0.9182 YC 945.147920 1 0.0014 1936 | 2/26
35 h-m-p 0.0008 0.1159 1.7151 YC 945.147254 1 0.0015 1990 | 2/26
36 h-m-p 0.0009 0.1421 2.6960 +YC 945.145243 1 0.0031 2045 | 2/26
37 h-m-p 0.0006 0.0358 13.4802 +CC 945.136068 1 0.0028 2101 | 2/26
38 h-m-p 0.0008 0.0357 46.5544 +CCC 945.082787 2 0.0046 2159 | 2/26
39 h-m-p 0.0007 0.0050 313.2597 CYCCC 944.988646 4 0.0011 2219 | 2/26
40 h-m-p 0.0017 0.0084 143.7742 YC 944.962805 1 0.0007 2273 | 2/26
41 h-m-p 0.0115 0.0577 4.1360 -YC 944.962309 1 0.0005 2328 | 2/26
42 h-m-p 0.0040 0.1449 0.5218 YC 944.962092 1 0.0018 2382 | 2/26
43 h-m-p 0.0017 0.3337 0.5585 YC 944.961977 1 0.0009 2436 | 2/26
44 h-m-p 0.0023 1.0787 0.2227 +YC 944.961089 1 0.0185 2491 | 2/26
45 h-m-p 0.0012 0.5269 3.3906 ++CC 944.943425 1 0.0247 2548 | 2/26
46 h-m-p 1.6000 8.0000 0.0338 YC 944.941407 1 0.7913 2602 | 2/26
47 h-m-p 1.6000 8.0000 0.0053 YC 944.941196 1 1.0531 2656 | 2/26
48 h-m-p 1.5390 8.0000 0.0036 YC 944.941180 1 0.7706 2710 | 2/26
49 h-m-p 1.6000 8.0000 0.0004 Y 944.941179 0 0.9488 2763 | 2/26
50 h-m-p 1.6000 8.0000 0.0002 ++ 944.941179 m 8.0000 2816 | 2/26
51 h-m-p 0.6596 8.0000 0.0024 ++ 944.941176 m 8.0000 2869 | 2/26
52 h-m-p 0.2675 8.0000 0.0722 +++ 944.941142 m 8.0000 2923 | 2/26
53 h-m-p 0.1202 0.6009 0.8981 ++ 944.940987 m 0.6009 2976 | 3/26
54 h-m-p 0.3644 8.0000 0.0082 +YC 944.940556 1 0.9900 3031 | 3/26
55 h-m-p 1.6000 8.0000 0.0001 Y 944.940556 0 0.9521 3083 | 3/26
56 h-m-p 1.6000 8.0000 0.0000 Y 944.940556 0 0.8796 3135 | 3/26
57 h-m-p 1.6000 8.0000 0.0000 --Y 944.940556 0 0.0250 3189 | 3/26
58 h-m-p 0.0160 8.0000 0.0002 -------C 944.940556 0 0.0000 3248
Out..
lnL = -944.940556
3249 lfun, 38988 eigenQcodon, 750519 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -968.619105 S = -932.759401 -28.723022
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 85 patterns 9:02
did 20 / 85 patterns 9:02
did 30 / 85 patterns 9:02
did 40 / 85 patterns 9:03
did 50 / 85 patterns 9:03
did 60 / 85 patterns 9:03
did 70 / 85 patterns 9:03
did 80 / 85 patterns 9:03
did 85 / 85 patterns 9:03
Time used: 9:04
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=12, Len=120
D_melanogaster_endos-PA MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_sechellia_endos-PA MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_simulans_endos-PA MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_yakuba_endos-PA MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG
D_erecta_endos-PA MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
D_takahashii_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_biarmipes_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_suzukii_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_eugracilis_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_ficusphila_endos-PA MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG
D_rhopaloa_endos-PA MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG
D_elegans_endos-PA MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG
***:****** ****** *.:*: **************************
D_melanogaster_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_sechellia_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_simulans_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_yakuba_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_erecta_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_takahashii_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_biarmipes_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_suzukii_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET
D_eugracilis_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_ficusphila_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET
D_rhopaloa_endos-PA HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET
D_elegans_endos-PA HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET
**********: *****************.******** .**********
D_melanogaster_endos-PA VPARKTSIIQPCNKFPATS-
D_sechellia_endos-PA VPARKTSIIQPCNKFPATS-
D_simulans_endos-PA VPARKTSIIQPCNKFPATS-
D_yakuba_endos-PA VPARKTSIIQPCNKFPATS-
D_erecta_endos-PA VPARKTSIIQPCNKFPATSo
D_takahashii_endos-PA VPARKTSIIQPCNKFPATS-
D_biarmipes_endos-PA VPARKTSIIQPCNKFPATS-
D_suzukii_endos-PA VPARKTSIIQPCNKFPATS-
D_eugracilis_endos-PA VPARKTSIIQPCNKFPATS-
D_ficusphila_endos-PA VPARKTSIIQPCNKFPATS-
D_rhopaloa_endos-PA VPARKTSIIQPCNKFPATS-
D_elegans_endos-PA VPARKTSIIQPCNKFPATSo
*******************
>D_melanogaster_endos-PA ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CACCGAGACCACCGAGCAGGCTAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_sechellia_endos-PA ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACTCCCCAGGA CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_simulans_endos-PA ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGCCCACCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_yakuba_endos-PA ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAACAGCCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAACTCAAGTCGAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAAGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGGGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAAGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_erecta_endos-PA ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA C---GAGGCCGCCGAACAGGTCAACCTCACGGATCTGGAGAAGATCGAGG AGGAGAAACTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCGGGCGGT CATTCGGCCTTCCTTCAGAAGAGGTTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGATTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_takahashii_endos-PA ATGAGCTCCGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGAATGCGCGTGCCCGGCGGA CACTCGGCTTTCCTACAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTTAAGCAGG TCTTTGCCAACAAGGTTACCACTGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_biarmipes_endos-PA ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCTGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGAGACTACCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTTACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC GACGAGC--- >D_suzukii_endos-PA ATGAGCTCAGCGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGCGGGATGCGCGTGCCCGGCGGG CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGAGACTACCAGATGGCCAAACAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGAACACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATCATCCAACCCTGTAACAAGTTCCCCGC GACGAGC--- >D_eugracilis_endos-PA ATGAGCTCTGCGGAGGAAAACAGCAATAGCCCGGCTACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGCCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGAGCAAGTATCCCAGCGGAATGCGTGTACCCGGTGGA CACTCGGCCTTTCTGCAAAAAAGGCTCCAGAAGGGGCAAAAATTCTTCGA CTCGGGCGATTACCAAATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAATAAGGTGACCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACTTCGATTATCCAACCCTGTAACAAGTTCCCGGC GACGAGC--- >D_ficusphila_endos-PA ATGAGCTCCACGGAGGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA TAACGAGGCTGCAGAGCAGGCAAACCTCACGGATCTCGAGAAGATTGAGG AGGAGAAGCTGAAGTCCAAGTACCCTAGTGGAATGCGAGTGCCCGGCGGA CACTCGGCCTTCCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA TTCGGGCGACTATCAGATGGCCAAGCAGAAGGGTGGCGGCGTCAAGCAGG TCTTTGCCAACAAGGTGACCACCGGGGAGGCTATTCCCACGCCCGAAACC GTGCCGGCGCGCAAGACCTCGATCATCCAACCATGCAACAAGTTCCCAGC GACGAGC--- >D_rhopaloa_endos-PA ATGAGCTCCGCGGAAGAAAACAGCAACAGCCCGGCCACCACGCCCCAGGA CAACGAGGCCGCCGAGCAGGTCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTACCCCAGTGGAATGCGAGTACCCGGAGGT CACTCGGCCTTTCTCCAGAAAAGGCTGCAGAAGGGGCAAAAGTTCTTCGA CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG TCTTTGCCAACAAGGTGACCACCGGAGAGGCCATTCCCACGCCCGAAACC GTGCCGGCACGAAAGACTTCGATCATCCAACCCTGCAACAAGTTCCCAGC GACAAGC--- >D_elegans_endos-PA ATGAGTTCCGCGGAGGAAAACAGCAACAGCCAGGCCACCACGCCCCAGGA CAACGAGACCGCTGAGAATGTCAACCTCACGGATCTCGAGAAGATCGAGG AGGAGAAGCTCAAGTCCAAGTATCCCAGTGGAATGCGAGTGCCGGGCGGT CACTCGGCCTTCCTCCAAAAAAGGCTGCAGAGG---CAAAAGTTCTTCGA CTCGGGCGACTACCAGATGGCCAAGCAGAAGGGTGGCAGCGTTAAGCAGG TCTTTGCCAACAAGGTGCCCACCGGGGAGGCCATTCCCACGCCCGAAACC GTGCCGGCACGCAAGACCTCGATCATCCAACCCTGCAACAAATTCCCAGC GACGAGC---
>D_melanogaster_endos-PA MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_sechellia_endos-PA MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_simulans_endos-PA MSSAEENSNSPATTPQDNEPTEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_yakuba_endos-PA MSSAEENSNSPATTPQDNEAAEQPNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_erecta_endos-PA MSSAEENSNSPATTPQD-EAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_takahashii_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_biarmipes_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_suzukii_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKNTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_eugracilis_endos-PA MSSAEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_ficusphila_endos-PA MSSTEENSNSPATTPQDNEAAEQANLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGGVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_rhopaloa_endos-PA MSSAEENSNSPATTPQDNEAAEQVNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQKGQKFFDSGDYQMAKQKGGSVKQVFANKVTTGEAIPTPET VPARKTSIIQPCNKFPATS >D_elegans_endos-PA MSSAEENSNSQATTPQDNETAENVNLTDLEKIEEEKLKSKYPSGMRVPGG HSAFLQKRLQR-QKFFDSGDYQMAKQKGGSVKQVFANKVPTGEAIPTPET VPARKTSIIQPCNKFPATS
#NEXUS
[ID: 2177714925]
begin taxa;
dimensions ntax=12;
taxlabels
D_melanogaster_endos-PA
D_sechellia_endos-PA
D_simulans_endos-PA
D_yakuba_endos-PA
D_erecta_endos-PA
D_takahashii_endos-PA
D_biarmipes_endos-PA
D_suzukii_endos-PA
D_eugracilis_endos-PA
D_ficusphila_endos-PA
D_rhopaloa_endos-PA
D_elegans_endos-PA
;
end;
begin trees;
translate
1 D_melanogaster_endos-PA,
2 D_sechellia_endos-PA,
3 D_simulans_endos-PA,
4 D_yakuba_endos-PA,
5 D_erecta_endos-PA,
6 D_takahashii_endos-PA,
7 D_biarmipes_endos-PA,
8 D_suzukii_endos-PA,
9 D_eugracilis_endos-PA,
10 D_ficusphila_endos-PA,
11 D_rhopaloa_endos-PA,
12 D_elegans_endos-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02675322,((4:0.04058501,5:0.04657085)0.886:0.01672216,(((6:0.0318321,(7:0.008883248,8:0.04141171)0.998:0.02736656)0.991:0.02206952,(10:0.1126925,(11:0.06389207,12:0.0966825)0.853:0.03238171)0.981:0.04205418)0.500:0.01088382,9:0.1214467)0.969:0.02091493)0.875:0.01552159,(2:0.01013264,3:0.004167741)0.682:0.008917523);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02675322,((4:0.04058501,5:0.04657085):0.01672216,(((6:0.0318321,(7:0.008883248,8:0.04141171):0.02736656):0.02206952,(10:0.1126925,(11:0.06389207,12:0.0966825):0.03238171):0.04205418):0.01088382,9:0.1214467):0.02091493):0.01552159,(2:0.01013264,3:0.004167741):0.008917523);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1034.72 -1052.43
2 -1034.72 -1057.95
--------------------------------------
TOTAL -1034.72 -1057.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/241/endos-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.864909 0.021560 0.606028 1.166137 0.850675 1069.18 1219.70 1.000
r(A<->C){all} 0.059170 0.000645 0.014575 0.109451 0.055984 730.17 756.21 1.000
r(A<->G){all} 0.161766 0.002844 0.068365 0.263594 0.154507 481.83 510.35 1.000
r(A<->T){all} 0.147841 0.004031 0.039627 0.276007 0.139888 526.97 537.51 1.000
r(C<->G){all} 0.027423 0.000152 0.006259 0.052005 0.025608 1111.26 1117.14 1.000
r(C<->T){all} 0.560160 0.007372 0.400017 0.728563 0.558670 368.66 405.90 1.000
r(G<->T){all} 0.043640 0.000607 0.004498 0.091908 0.039432 851.11 898.79 1.000
pi(A){all} 0.263122 0.000539 0.216968 0.305883 0.262279 906.51 945.46 1.000
pi(C){all} 0.320799 0.000553 0.271287 0.365587 0.321433 766.66 1033.94 1.000
pi(G){all} 0.296338 0.000547 0.249027 0.340836 0.296156 1061.71 1100.42 1.000
pi(T){all} 0.119740 0.000274 0.088736 0.153414 0.118758 623.80 807.86 1.000
alpha{1,2} 0.108833 0.000752 0.062121 0.165628 0.106103 1249.72 1375.36 1.000
alpha{3} 2.167137 0.669027 0.897424 3.785750 2.036796 1351.95 1374.40 1.000
pinvar{all} 0.329113 0.007477 0.162861 0.494978 0.333377 1282.45 1317.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/241/endos-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 117
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 2 2 2 1 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 1 0 | TCG 3 3 3 4 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 1 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 1 0 | Arg CGT 0 0 0 0 0 0
CTC 4 4 4 4 2 3 | CCC 5 6 6 6 5 6 | CAC 1 1 1 1 0 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 1 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 4 4 4 4 4 3 | CAG 7 7 7 7 7 7 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 2 1 1 1 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 6 5 5 4 4 3 | AAC 5 5 5 5 5 5 | AGC 5 5 5 5 5 5
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 4 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 4 3 4 4 4 4 | AAG 11 11 11 9 11 11 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 2 | Ala GCT 1 0 0 0 0 1 | Asp GAT 2 2 2 2 2 1 | Gly GGT 1 1 1 1 2 1
GTC 2 2 2 2 3 1 | GCC 5 6 6 7 7 7 | GAC 2 2 2 2 2 3 | GGC 4 4 4 3 4 3
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 3 2 2 4 3 2 | GGA 2 2 2 2 1 3
GTG 3 3 3 3 3 2 | GCG 3 3 3 3 3 3 | GAG 7 8 8 6 7 8 | GGG 1 1 1 2 1 1
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 2 2 1 2 1 | Ser TCT 0 0 1 0 0 0 | Tyr TAT 1 1 1 1 0 1 | Cys TGT 1 1 1 0 0 0
TTC 4 3 3 4 3 4 | TCC 1 1 0 2 2 2 | TAC 1 1 1 1 2 1 | TGC 0 0 0 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 0 0 1 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 1 0 0 0
CTC 4 4 4 3 4 4 | CCC 6 7 6 4 6 6 | CAC 1 1 1 1 1 1 | CGC 2 2 1 1 0 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 2 1 1 | Gln CAA 2 2 4 2 2 3 | CGA 0 0 0 1 2 1
CTG 1 1 1 2 1 1 | CCG 2 2 3 2 2 2 | CAG 7 7 5 7 7 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 2 2 1 1 | Thr ACT 1 1 1 0 1 0 | Asn AAT 0 0 2 0 0 1 | Ser AGT 0 0 0 1 1 2
ATC 3 3 2 2 3 3 | ACC 4 4 4 5 4 5 | AAC 5 6 3 5 5 5 | AGC 5 5 6 4 5 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 1 0 | Lys AAA 1 2 2 1 1 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 5 3 4 | AAG 12 11 11 12 12 10 | AGG 1 1 1 1 1 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 0 0 0 1 1 | Ala GCT 0 0 1 2 0 1 | Asp GAT 1 1 2 3 1 1 | Gly GGT 1 1 2 1 2 2
GTC 2 2 2 2 2 2 | GCC 8 8 7 4 7 5 | GAC 3 3 2 1 3 3 | GGC 3 3 3 4 2 3
GTA 0 0 1 0 1 0 | GCA 0 0 0 2 1 1 | Glu GAA 2 2 2 2 3 2 | GGA 2 1 2 2 3 1
GTG 2 2 2 3 2 3 | GCG 3 3 3 2 2 2 | GAG 8 8 8 8 7 8 | GGG 2 3 1 1 0 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_endos-PA
position 1: T:0.11111 C:0.22222 A:0.35897 G:0.30769
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.43590 A:0.07692 G:0.41026
Average T:0.12536 C:0.31624 A:0.27066 G:0.28775
#2: D_sechellia_endos-PA
position 1: T:0.11111 C:0.23077 A:0.35043 G:0.30769
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.44444 A:0.06838 G:0.41026
Average T:0.12536 C:0.32194 A:0.26496 G:0.28775
#3: D_simulans_endos-PA
position 1: T:0.11111 C:0.23077 A:0.35043 G:0.30769
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.06838 C:0.44444 A:0.06838 G:0.41880
Average T:0.12251 C:0.32194 A:0.26496 G:0.29060
#4: D_yakuba_endos-PA
position 1: T:0.11111 C:0.23077 A:0.34188 G:0.31624
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.06838 C:0.42735 A:0.10256 G:0.40171
Average T:0.12251 C:0.31624 A:0.27350 G:0.28775
#5: D_erecta_endos-PA
position 1: T:0.11966 C:0.21368 A:0.34188 G:0.32479
position 2: T:0.19658 C:0.28205 A:0.37607 G:0.14530
position 3: T:0.09402 C:0.41880 A:0.06838 G:0.41880
Average T:0.13675 C:0.30484 A:0.26211 G:0.29630
#6: D_takahashii_endos-PA
position 1: T:0.11111 C:0.22222 A:0.34188 G:0.32479
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.09402 C:0.41880 A:0.08547 G:0.40171
Average T:0.13105 C:0.31054 A:0.26781 G:0.29060
#7: D_biarmipes_endos-PA
position 1: T:0.11111 C:0.22222 A:0.34188 G:0.32479
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.44444 A:0.06838 G:0.41026
Average T:0.12536 C:0.31909 A:0.26211 G:0.29345
#8: D_suzukii_endos-PA
position 1: T:0.11111 C:0.22222 A:0.35043 G:0.31624
position 2: T:0.17949 C:0.29060 A:0.38462 G:0.14530
position 3: T:0.06838 C:0.45299 A:0.06838 G:0.41026
Average T:0.11966 C:0.32194 A:0.26781 G:0.29060
#9: D_eugracilis_endos-PA
position 1: T:0.10256 C:0.22222 A:0.35043 G:0.32479
position 2: T:0.18803 C:0.28205 A:0.37607 G:0.15385
position 3: T:0.13675 C:0.38462 A:0.09402 G:0.38462
Average T:0.14245 C:0.29630 A:0.27350 G:0.28775
#10: D_ficusphila_endos-PA
position 1: T:0.11111 C:0.22222 A:0.35043 G:0.31624
position 2: T:0.18803 C:0.29060 A:0.37607 G:0.14530
position 3: T:0.10256 C:0.37607 A:0.10256 G:0.41880
Average T:0.13390 C:0.29630 A:0.27635 G:0.29345
#11: D_rhopaloa_endos-PA
position 1: T:0.11111 C:0.22222 A:0.35043 G:0.31624
position 2: T:0.19658 C:0.28205 A:0.37607 G:0.14530
position 3: T:0.07692 C:0.42735 A:0.12821 G:0.36752
Average T:0.12821 C:0.31054 A:0.28490 G:0.27635
#12: D_elegans_endos-PA
position 1: T:0.11111 C:0.22222 A:0.35897 G:0.30769
position 2: T:0.19658 C:0.27350 A:0.37607 G:0.15385
position 3: T:0.09402 C:0.42735 A:0.09402 G:0.38462
Average T:0.13390 C:0.30769 A:0.27635 G:0.28205
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 15 | Ser S TCT 1 | Tyr Y TAT 11 | Cys C TGT 9
TTC 45 | TCC 19 | TAC 13 | TGC 3
Leu L TTA 0 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 1 | TCG 37 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 2 | His H CAT 1 | Arg R CGT 1
CTC 44 | CCC 69 | CAC 11 | CGC 19
CTA 1 | CCA 4 | Gln Q CAA 27 | CGA 4
CTG 13 | CCG 36 | CAG 81 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 14 | Thr T ACT 12 | Asn N AAT 3 | Ser S AGT 4
ATC 34 | ACC 53 | AAC 59 | AGC 59
ATA 0 | ACA 1 | Lys K AAA 23 | Arg R AGA 0
Met M ATG 36 | ACG 47 | AAG 132 | AGG 13
------------------------------------------------------------------------------
Val V GTT 5 | Ala A GCT 6 | Asp D GAT 20 | Gly G GGT 16
GTC 24 | GCC 77 | GAC 28 | GGC 40
GTA 2 | GCA 4 | Glu E GAA 29 | GGA 23
GTG 31 | GCG 33 | GAG 91 | GGG 15
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11111 C:0.22365 A:0.34900 G:0.31624
position 2: T:0.18946 C:0.28704 A:0.37678 G:0.14672
position 3: T:0.08618 C:0.42521 A:0.08547 G:0.40313
Average T:0.12892 C:0.31197 A:0.27042 G:0.28870
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_endos-PA
D_sechellia_endos-PA 0.0948 (0.0037 0.0389)
D_simulans_endos-PA 0.1435 (0.0037 0.0257)-1.0000 (0.0000 0.0127)
D_yakuba_endos-PA 0.1025 (0.0111 0.1085) 0.1182 (0.0111 0.0940) 0.1392 (0.0111 0.0799)
D_erecta_endos-PA 0.0801 (0.0111 0.1387) 0.0899 (0.0111 0.1236) 0.1021 (0.0111 0.1088) 0.0533 (0.0074 0.1386)
D_takahashii_endos-PA 0.0438 (0.0074 0.1688) 0.0483 (0.0074 0.1532) 0.0536 (0.0074 0.1379) 0.0184 (0.0037 0.2010) 0.0169 (0.0037 0.2183)
D_biarmipes_endos-PA 0.0535 (0.0074 0.1382) 0.0600 (0.0074 0.1232) 0.0682 (0.0074 0.1084) 0.0183 (0.0037 0.2014) 0.0156 (0.0037 0.2359)-1.0000 (0.0000 0.1228)
D_suzukii_endos-PA 0.0989 (0.0173 0.1754) 0.1087 (0.0173 0.1596) 0.1204 (0.0173 0.1440) 0.0654 (0.0136 0.2081) 0.0602 (0.0136 0.2257) 0.0534 (0.0074 0.1385) 0.1116 (0.0074 0.0662)
D_eugracilis_endos-PA 0.0545 (0.0148 0.2724) 0.0584 (0.0148 0.2543) 0.0627 (0.0148 0.2367) 0.0383 (0.0130 0.3389) 0.0424 (0.0148 0.3501) 0.0225 (0.0074 0.3281) 0.0239 (0.0074 0.3094) 0.0580 (0.0173 0.2985)
D_ficusphila_endos-PA 0.0342 (0.0111 0.3254) 0.0342 (0.0111 0.3254) 0.0364 (0.0111 0.3063) 0.0173 (0.0074 0.4290) 0.0155 (0.0074 0.4767) 0.0096 (0.0037 0.3846) 0.0107 (0.0037 0.3446) 0.0364 (0.0136 0.3740) 0.0201 (0.0111 0.5535)
D_rhopaloa_endos-PA 0.0550 (0.0149 0.2705) 0.0515 (0.0149 0.2888) 0.0550 (0.0149 0.2705) 0.0345 (0.0130 0.3770) 0.0095 (0.0037 0.3888) 0.0242 (0.0074 0.3065) 0.0241 (0.0074 0.3072) 0.0625 (0.0174 0.2778) 0.0381 (0.0148 0.3899) 0.0323 (0.0111 0.3444)
D_elegans_endos-PA 0.1266 (0.0300 0.2369) 0.1539 (0.0338 0.2197) 0.1667 (0.0338 0.2028) 0.1190 (0.0357 0.3003) 0.0841 (0.0261 0.3108) 0.1104 (0.0300 0.2717) 0.1180 (0.0300 0.2542) 0.1436 (0.0402 0.2800) 0.0906 (0.0376 0.4151) 0.1170 (0.0339 0.2893) 0.1105 (0.0224 0.2025)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
check convergence..
lnL(ntime: 21 np: 23): -954.749766 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..19 19..7 19..8 17..20 20..10 20..21 21..11 21..12 16..9 13..22 22..2 22..3
0.024663 0.025283 0.008381 0.047544 0.069757 0.020282 0.006090 0.026664 0.037723 0.033171 0.017277 0.052320 0.059740 0.153710 0.061897 0.077308 0.132968 0.176197 0.006759 0.009412 0.000004 3.883616 0.035185
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.04715
(1: 0.024663, ((4: 0.047544, 5: 0.069757): 0.008381, (((6: 0.037723, (7: 0.017277, 8: 0.052320): 0.033171): 0.026664, (10: 0.153710, (11: 0.077308, 12: 0.132968): 0.061897): 0.059740): 0.006090, 9: 0.176197): 0.020282): 0.025283, (2: 0.009412, 3: 0.000004): 0.006759);
(D_melanogaster_endos-PA: 0.024663, ((D_yakuba_endos-PA: 0.047544, D_erecta_endos-PA: 0.069757): 0.008381, (((D_takahashii_endos-PA: 0.037723, (D_biarmipes_endos-PA: 0.017277, D_suzukii_endos-PA: 0.052320): 0.033171): 0.026664, (D_ficusphila_endos-PA: 0.153710, (D_rhopaloa_endos-PA: 0.077308, D_elegans_endos-PA: 0.132968): 0.061897): 0.059740): 0.006090, D_eugracilis_endos-PA: 0.176197): 0.020282): 0.025283, (D_sechellia_endos-PA: 0.009412, D_simulans_endos-PA: 0.000004): 0.006759);
Detailed output identifying parameters
kappa (ts/tv) = 3.88362
omega (dN/dS) = 0.03519
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.1 58.9 0.0352 0.0015 0.0417 0.4 2.5
13..14 0.025 292.1 58.9 0.0352 0.0015 0.0427 0.4 2.5
14..15 0.008 292.1 58.9 0.0352 0.0005 0.0142 0.1 0.8
15..4 0.048 292.1 58.9 0.0352 0.0028 0.0804 0.8 4.7
15..5 0.070 292.1 58.9 0.0352 0.0041 0.1179 1.2 6.9
14..16 0.020 292.1 58.9 0.0352 0.0012 0.0343 0.4 2.0
16..17 0.006 292.1 58.9 0.0352 0.0004 0.0103 0.1 0.6
17..18 0.027 292.1 58.9 0.0352 0.0016 0.0451 0.5 2.7
18..6 0.038 292.1 58.9 0.0352 0.0022 0.0638 0.7 3.8
18..19 0.033 292.1 58.9 0.0352 0.0020 0.0561 0.6 3.3
19..7 0.017 292.1 58.9 0.0352 0.0010 0.0292 0.3 1.7
19..8 0.052 292.1 58.9 0.0352 0.0031 0.0884 0.9 5.2
17..20 0.060 292.1 58.9 0.0352 0.0036 0.1010 1.0 6.0
20..10 0.154 292.1 58.9 0.0352 0.0091 0.2598 2.7 15.3
20..21 0.062 292.1 58.9 0.0352 0.0037 0.1046 1.1 6.2
21..11 0.077 292.1 58.9 0.0352 0.0046 0.1307 1.3 7.7
21..12 0.133 292.1 58.9 0.0352 0.0079 0.2248 2.3 13.2
16..9 0.176 292.1 58.9 0.0352 0.0105 0.2979 3.1 17.6
13..22 0.007 292.1 58.9 0.0352 0.0004 0.0114 0.1 0.7
22..2 0.009 292.1 58.9 0.0352 0.0006 0.0159 0.2 0.9
22..3 0.000 292.1 58.9 0.0352 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0623
tree length for dS: 1.7702
Time used: 0:20
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
check convergence..
lnL(ntime: 21 np: 24): -947.477906 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..19 19..7 19..8 17..20 20..10 20..21 21..11 21..12 16..9 13..22 22..2 22..3
0.025200 0.024975 0.008919 0.048451 0.069526 0.020192 0.006484 0.026317 0.038573 0.033632 0.017638 0.052589 0.060843 0.161018 0.057214 0.080773 0.133042 0.181561 0.006756 0.009485 0.000004 4.129224 0.953428 0.013641
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06319
(1: 0.025200, ((4: 0.048451, 5: 0.069526): 0.008919, (((6: 0.038573, (7: 0.017638, 8: 0.052589): 0.033632): 0.026317, (10: 0.161018, (11: 0.080773, 12: 0.133042): 0.057214): 0.060843): 0.006484, 9: 0.181561): 0.020192): 0.024975, (2: 0.009485, 3: 0.000004): 0.006756);
(D_melanogaster_endos-PA: 0.025200, ((D_yakuba_endos-PA: 0.048451, D_erecta_endos-PA: 0.069526): 0.008919, (((D_takahashii_endos-PA: 0.038573, (D_biarmipes_endos-PA: 0.017638, D_suzukii_endos-PA: 0.052589): 0.033632): 0.026317, (D_ficusphila_endos-PA: 0.161018, (D_rhopaloa_endos-PA: 0.080773, D_elegans_endos-PA: 0.133042): 0.057214): 0.060843): 0.006484, D_eugracilis_endos-PA: 0.181561): 0.020192): 0.024975, (D_sechellia_endos-PA: 0.009485, D_simulans_endos-PA: 0.000004): 0.006756);
Detailed output identifying parameters
kappa (ts/tv) = 4.12922
dN/dS (w) for site classes (K=2)
p: 0.95343 0.04657
w: 0.01364 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 291.8 59.2 0.0596 0.0023 0.0385 0.7 2.3
13..14 0.025 291.8 59.2 0.0596 0.0023 0.0381 0.7 2.3
14..15 0.009 291.8 59.2 0.0596 0.0008 0.0136 0.2 0.8
15..4 0.048 291.8 59.2 0.0596 0.0044 0.0740 1.3 4.4
15..5 0.070 291.8 59.2 0.0596 0.0063 0.1062 1.8 6.3
14..16 0.020 291.8 59.2 0.0596 0.0018 0.0308 0.5 1.8
16..17 0.006 291.8 59.2 0.0596 0.0006 0.0099 0.2 0.6
17..18 0.026 291.8 59.2 0.0596 0.0024 0.0402 0.7 2.4
18..6 0.039 291.8 59.2 0.0596 0.0035 0.0589 1.0 3.5
18..19 0.034 291.8 59.2 0.0596 0.0031 0.0514 0.9 3.0
19..7 0.018 291.8 59.2 0.0596 0.0016 0.0269 0.5 1.6
19..8 0.053 291.8 59.2 0.0596 0.0048 0.0803 1.4 4.8
17..20 0.061 291.8 59.2 0.0596 0.0055 0.0929 1.6 5.5
20..10 0.161 291.8 59.2 0.0596 0.0147 0.2459 4.3 14.6
20..21 0.057 291.8 59.2 0.0596 0.0052 0.0874 1.5 5.2
21..11 0.081 291.8 59.2 0.0596 0.0073 0.1234 2.1 7.3
21..12 0.133 291.8 59.2 0.0596 0.0121 0.2032 3.5 12.0
16..9 0.182 291.8 59.2 0.0596 0.0165 0.2773 4.8 16.4
13..22 0.007 291.8 59.2 0.0596 0.0006 0.0103 0.2 0.6
22..2 0.009 291.8 59.2 0.0596 0.0009 0.0145 0.3 0.9
22..3 0.000 291.8 59.2 0.0596 0.0000 0.0000 0.0 0.0
Time used: 0:53
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
check convergence..
lnL(ntime: 21 np: 26): -947.477906 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..19 19..7 19..8 17..20 20..10 20..21 21..11 21..12 16..9 13..22 22..2 22..3
0.025200 0.024975 0.008919 0.048451 0.069527 0.020192 0.006484 0.026317 0.038573 0.033632 0.017638 0.052589 0.060842 0.161019 0.057214 0.080773 0.133040 0.181561 0.006755 0.009485 0.000004 4.129235 0.953427 0.046573 0.013641 17.844918
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06319
(1: 0.025200, ((4: 0.048451, 5: 0.069527): 0.008919, (((6: 0.038573, (7: 0.017638, 8: 0.052589): 0.033632): 0.026317, (10: 0.161019, (11: 0.080773, 12: 0.133040): 0.057214): 0.060842): 0.006484, 9: 0.181561): 0.020192): 0.024975, (2: 0.009485, 3: 0.000004): 0.006755);
(D_melanogaster_endos-PA: 0.025200, ((D_yakuba_endos-PA: 0.048451, D_erecta_endos-PA: 0.069527): 0.008919, (((D_takahashii_endos-PA: 0.038573, (D_biarmipes_endos-PA: 0.017638, D_suzukii_endos-PA: 0.052589): 0.033632): 0.026317, (D_ficusphila_endos-PA: 0.161019, (D_rhopaloa_endos-PA: 0.080773, D_elegans_endos-PA: 0.133040): 0.057214): 0.060842): 0.006484, D_eugracilis_endos-PA: 0.181561): 0.020192): 0.024975, (D_sechellia_endos-PA: 0.009485, D_simulans_endos-PA: 0.000004): 0.006755);
Detailed output identifying parameters
kappa (ts/tv) = 4.12924
dN/dS (w) for site classes (K=3)
p: 0.95343 0.04657 0.00000
w: 0.01364 1.00000 17.84492
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 291.8 59.2 0.0596 0.0023 0.0385 0.7 2.3
13..14 0.025 291.8 59.2 0.0596 0.0023 0.0381 0.7 2.3
14..15 0.009 291.8 59.2 0.0596 0.0008 0.0136 0.2 0.8
15..4 0.048 291.8 59.2 0.0596 0.0044 0.0740 1.3 4.4
15..5 0.070 291.8 59.2 0.0596 0.0063 0.1062 1.8 6.3
14..16 0.020 291.8 59.2 0.0596 0.0018 0.0308 0.5 1.8
16..17 0.006 291.8 59.2 0.0596 0.0006 0.0099 0.2 0.6
17..18 0.026 291.8 59.2 0.0596 0.0024 0.0402 0.7 2.4
18..6 0.039 291.8 59.2 0.0596 0.0035 0.0589 1.0 3.5
18..19 0.034 291.8 59.2 0.0596 0.0031 0.0514 0.9 3.0
19..7 0.018 291.8 59.2 0.0596 0.0016 0.0269 0.5 1.6
19..8 0.053 291.8 59.2 0.0596 0.0048 0.0803 1.4 4.8
17..20 0.061 291.8 59.2 0.0596 0.0055 0.0929 1.6 5.5
20..10 0.161 291.8 59.2 0.0596 0.0147 0.2459 4.3 14.6
20..21 0.057 291.8 59.2 0.0596 0.0052 0.0874 1.5 5.2
21..11 0.081 291.8 59.2 0.0596 0.0073 0.1234 2.1 7.3
21..12 0.133 291.8 59.2 0.0596 0.0121 0.2032 3.5 12.0
16..9 0.182 291.8 59.2 0.0596 0.0165 0.2773 4.8 16.4
13..22 0.007 291.8 59.2 0.0596 0.0006 0.0103 0.2 0.6
22..2 0.009 291.8 59.2 0.0596 0.0009 0.0145 0.3 0.9
22..3 0.000 291.8 59.2 0.0596 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_endos-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.327 0.100 0.076 0.072 0.071 0.071 0.071 0.071 0.071 0.071
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.995
sum of density on p0-p1 = 1.000000
Time used: 2:30
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
lnL(ntime: 21 np: 27): -944.892316 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..19 19..7 19..8 17..20 20..10 20..21 21..11 21..12 16..9 13..22 22..2 22..3
0.024960 0.025263 0.008537 0.048083 0.069940 0.020403 0.006005 0.026879 0.038170 0.033601 0.017462 0.052734 0.061401 0.158110 0.060186 0.079490 0.135030 0.178701 0.006777 0.009464 0.000004 3.916643 0.383871 0.516813 0.005468 0.005469 0.336189
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06120
(1: 0.024960, ((4: 0.048083, 5: 0.069940): 0.008537, (((6: 0.038170, (7: 0.017462, 8: 0.052734): 0.033601): 0.026879, (10: 0.158110, (11: 0.079490, 12: 0.135030): 0.060186): 0.061401): 0.006005, 9: 0.178701): 0.020403): 0.025263, (2: 0.009464, 3: 0.000004): 0.006777);
(D_melanogaster_endos-PA: 0.024960, ((D_yakuba_endos-PA: 0.048083, D_erecta_endos-PA: 0.069940): 0.008537, (((D_takahashii_endos-PA: 0.038170, (D_biarmipes_endos-PA: 0.017462, D_suzukii_endos-PA: 0.052734): 0.033601): 0.026879, (D_ficusphila_endos-PA: 0.158110, (D_rhopaloa_endos-PA: 0.079490, D_elegans_endos-PA: 0.135030): 0.060186): 0.061401): 0.006005, D_eugracilis_endos-PA: 0.178701): 0.020403): 0.025263, (D_sechellia_endos-PA: 0.009464, D_simulans_endos-PA: 0.000004): 0.006777);
Detailed output identifying parameters
kappa (ts/tv) = 3.91664
dN/dS (w) for site classes (K=3)
p: 0.38387 0.51681 0.09932
w: 0.00547 0.00547 0.33619
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0383 0.0016 0.0416 0.5 2.5
13..14 0.025 292.0 59.0 0.0383 0.0016 0.0421 0.5 2.5
14..15 0.009 292.0 59.0 0.0383 0.0005 0.0142 0.2 0.8
15..4 0.048 292.0 59.0 0.0383 0.0031 0.0802 0.9 4.7
15..5 0.070 292.0 59.0 0.0383 0.0045 0.1166 1.3 6.9
14..16 0.020 292.0 59.0 0.0383 0.0013 0.0340 0.4 2.0
16..17 0.006 292.0 59.0 0.0383 0.0004 0.0100 0.1 0.6
17..18 0.027 292.0 59.0 0.0383 0.0017 0.0448 0.5 2.6
18..6 0.038 292.0 59.0 0.0383 0.0024 0.0636 0.7 3.8
18..19 0.034 292.0 59.0 0.0383 0.0021 0.0560 0.6 3.3
19..7 0.017 292.0 59.0 0.0383 0.0011 0.0291 0.3 1.7
19..8 0.053 292.0 59.0 0.0383 0.0034 0.0879 1.0 5.2
17..20 0.061 292.0 59.0 0.0383 0.0039 0.1024 1.1 6.0
20..10 0.158 292.0 59.0 0.0383 0.0101 0.2637 2.9 15.5
20..21 0.060 292.0 59.0 0.0383 0.0038 0.1004 1.1 5.9
21..11 0.079 292.0 59.0 0.0383 0.0051 0.1326 1.5 7.8
21..12 0.135 292.0 59.0 0.0383 0.0086 0.2252 2.5 13.3
16..9 0.179 292.0 59.0 0.0383 0.0114 0.2980 3.3 17.6
13..22 0.007 292.0 59.0 0.0383 0.0004 0.0113 0.1 0.7
22..2 0.009 292.0 59.0 0.0383 0.0006 0.0158 0.2 0.9
22..3 0.000 292.0 59.0 0.0383 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 3:18
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
lnL(ntime: 21 np: 24): -944.940117 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..19 19..7 19..8 17..20 20..10 20..21 21..11 21..12 16..9 13..22 22..2 22..3
0.024922 0.025220 0.008530 0.048020 0.069841 0.020374 0.006002 0.026825 0.038086 0.033521 0.017424 0.052639 0.061347 0.157839 0.060080 0.079408 0.134928 0.178318 0.006766 0.009449 0.000004 3.908869 0.059558 1.255361
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.05954
(1: 0.024922, ((4: 0.048020, 5: 0.069841): 0.008530, (((6: 0.038086, (7: 0.017424, 8: 0.052639): 0.033521): 0.026825, (10: 0.157839, (11: 0.079408, 12: 0.134928): 0.060080): 0.061347): 0.006002, 9: 0.178318): 0.020374): 0.025220, (2: 0.009449, 3: 0.000004): 0.006766);
(D_melanogaster_endos-PA: 0.024922, ((D_yakuba_endos-PA: 0.048020, D_erecta_endos-PA: 0.069841): 0.008530, (((D_takahashii_endos-PA: 0.038086, (D_biarmipes_endos-PA: 0.017424, D_suzukii_endos-PA: 0.052639): 0.033521): 0.026825, (D_ficusphila_endos-PA: 0.157839, (D_rhopaloa_endos-PA: 0.079408, D_elegans_endos-PA: 0.134928): 0.060080): 0.061347): 0.006002, D_eugracilis_endos-PA: 0.178318): 0.020374): 0.025220, (D_sechellia_endos-PA: 0.009449, D_simulans_endos-PA: 0.000004): 0.006766);
Detailed output identifying parameters
kappa (ts/tv) = 3.90887
Parameters in M7 (beta):
p = 0.05956 q = 1.25536
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00051 0.00567 0.04686 0.32630
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0379 0.0016 0.0416 0.5 2.5
13..14 0.025 292.0 59.0 0.0379 0.0016 0.0421 0.5 2.5
14..15 0.009 292.0 59.0 0.0379 0.0005 0.0142 0.2 0.8
15..4 0.048 292.0 59.0 0.0379 0.0030 0.0802 0.9 4.7
15..5 0.070 292.0 59.0 0.0379 0.0044 0.1167 1.3 6.9
14..16 0.020 292.0 59.0 0.0379 0.0013 0.0340 0.4 2.0
16..17 0.006 292.0 59.0 0.0379 0.0004 0.0100 0.1 0.6
17..18 0.027 292.0 59.0 0.0379 0.0017 0.0448 0.5 2.6
18..6 0.038 292.0 59.0 0.0379 0.0024 0.0636 0.7 3.8
18..19 0.034 292.0 59.0 0.0379 0.0021 0.0560 0.6 3.3
19..7 0.017 292.0 59.0 0.0379 0.0011 0.0291 0.3 1.7
19..8 0.053 292.0 59.0 0.0379 0.0033 0.0879 1.0 5.2
17..20 0.061 292.0 59.0 0.0379 0.0039 0.1025 1.1 6.0
20..10 0.158 292.0 59.0 0.0379 0.0100 0.2636 2.9 15.5
20..21 0.060 292.0 59.0 0.0379 0.0038 0.1004 1.1 5.9
21..11 0.079 292.0 59.0 0.0379 0.0050 0.1326 1.5 7.8
21..12 0.135 292.0 59.0 0.0379 0.0086 0.2254 2.5 13.3
16..9 0.178 292.0 59.0 0.0379 0.0113 0.2979 3.3 17.6
13..22 0.007 292.0 59.0 0.0379 0.0004 0.0113 0.1 0.7
22..2 0.009 292.0 59.0 0.0379 0.0006 0.0158 0.2 0.9
22..3 0.000 292.0 59.0 0.0379 0.0000 0.0000 0.0 0.0
Time used: 5:24
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), (((6, (7, 8)), (10, (11, 12))), 9)), (2, 3)); MP score: 95
lnL(ntime: 21 np: 26): -944.940556 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..19 19..7 19..8 17..20 20..10 20..21 21..11 21..12 16..9 13..22 22..2 22..3
0.024922 0.025221 0.008531 0.048021 0.069842 0.020374 0.006002 0.026825 0.038086 0.033521 0.017424 0.052640 0.061348 0.157842 0.060080 0.079410 0.134930 0.178321 0.006766 0.009449 0.000004 3.908895 0.999990 0.059558 1.255427 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.05956
(1: 0.024922, ((4: 0.048021, 5: 0.069842): 0.008531, (((6: 0.038086, (7: 0.017424, 8: 0.052640): 0.033521): 0.026825, (10: 0.157842, (11: 0.079410, 12: 0.134930): 0.060080): 0.061348): 0.006002, 9: 0.178321): 0.020374): 0.025221, (2: 0.009449, 3: 0.000004): 0.006766);
(D_melanogaster_endos-PA: 0.024922, ((D_yakuba_endos-PA: 0.048021, D_erecta_endos-PA: 0.069842): 0.008531, (((D_takahashii_endos-PA: 0.038086, (D_biarmipes_endos-PA: 0.017424, D_suzukii_endos-PA: 0.052640): 0.033521): 0.026825, (D_ficusphila_endos-PA: 0.157842, (D_rhopaloa_endos-PA: 0.079410, D_elegans_endos-PA: 0.134930): 0.060080): 0.061348): 0.006002, D_eugracilis_endos-PA: 0.178321): 0.020374): 0.025221, (D_sechellia_endos-PA: 0.009449, D_simulans_endos-PA: 0.000004): 0.006766);
Detailed output identifying parameters
kappa (ts/tv) = 3.90890
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.05956 q = 1.25543
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00051 0.00567 0.04686 0.32628 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.025 292.0 59.0 0.0379 0.0016 0.0416 0.5 2.5
13..14 0.025 292.0 59.0 0.0379 0.0016 0.0421 0.5 2.5
14..15 0.009 292.0 59.0 0.0379 0.0005 0.0142 0.2 0.8
15..4 0.048 292.0 59.0 0.0379 0.0030 0.0802 0.9 4.7
15..5 0.070 292.0 59.0 0.0379 0.0044 0.1167 1.3 6.9
14..16 0.020 292.0 59.0 0.0379 0.0013 0.0340 0.4 2.0
16..17 0.006 292.0 59.0 0.0379 0.0004 0.0100 0.1 0.6
17..18 0.027 292.0 59.0 0.0379 0.0017 0.0448 0.5 2.6
18..6 0.038 292.0 59.0 0.0379 0.0024 0.0636 0.7 3.8
18..19 0.034 292.0 59.0 0.0379 0.0021 0.0560 0.6 3.3
19..7 0.017 292.0 59.0 0.0379 0.0011 0.0291 0.3 1.7
19..8 0.053 292.0 59.0 0.0379 0.0033 0.0879 1.0 5.2
17..20 0.061 292.0 59.0 0.0379 0.0039 0.1025 1.1 6.0
20..10 0.158 292.0 59.0 0.0379 0.0100 0.2636 2.9 15.5
20..21 0.060 292.0 59.0 0.0379 0.0038 0.1004 1.1 5.9
21..11 0.079 292.0 59.0 0.0379 0.0050 0.1326 1.5 7.8
21..12 0.135 292.0 59.0 0.0379 0.0086 0.2254 2.5 13.3
16..9 0.178 292.0 59.0 0.0379 0.0113 0.2978 3.3 17.6
13..22 0.007 292.0 59.0 0.0379 0.0004 0.0113 0.1 0.7
22..2 0.009 292.0 59.0 0.0379 0.0006 0.0158 0.2 0.9
22..3 0.000 292.0 59.0 0.0379 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_endos-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.003 0.016 0.058 0.146 0.289 0.488
ws: 0.245 0.100 0.085 0.082 0.082 0.081 0.081 0.081 0.081 0.081
Time used: 9:04
Model 1: NearlyNeutral -947.477906 Model 2: PositiveSelection -947.477906 Model 0: one-ratio -954.749766 Model 3: discrete -944.892316 Model 7: beta -944.940117 Model 8: beta&w>1 -944.940556 Model 0 vs 1 14.543720000000121 Model 2 vs 1 0.0 Model 8 vs 7 8.780000000569999E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
