--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Nov 14 15:50:18 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/220/Cyp6t3-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3541.22 -3552.13 2 -3541.14 -3552.42 -------------------------------------- TOTAL -3541.18 -3552.28 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.306823 0.000918 0.251915 0.368816 0.305493 1501.00 1501.00 1.000 r(A<->C){all} 0.099048 0.000461 0.059178 0.141958 0.097445 903.74 951.53 1.000 r(A<->G){all} 0.322856 0.001454 0.248305 0.395419 0.322123 841.02 896.43 1.001 r(A<->T){all} 0.107142 0.000554 0.062969 0.153902 0.104788 922.67 1063.86 1.001 r(C<->G){all} 0.069355 0.000255 0.038664 0.099628 0.068212 1197.40 1216.17 1.001 r(C<->T){all} 0.353381 0.001547 0.274643 0.427615 0.351781 938.69 985.94 1.000 r(G<->T){all} 0.048219 0.000233 0.019635 0.078227 0.046957 1084.34 1087.78 1.000 pi(A){all} 0.228692 0.000104 0.208559 0.248449 0.228523 1279.22 1310.41 1.000 pi(C){all} 0.264865 0.000117 0.244399 0.286586 0.264825 942.90 1024.96 1.000 pi(G){all} 0.254527 0.000112 0.234557 0.275404 0.254733 1065.81 1161.66 1.001 pi(T){all} 0.251917 0.000116 0.232302 0.273697 0.251638 1132.96 1176.92 1.000 alpha{1,2} 0.066417 0.002276 0.000120 0.153973 0.057681 1036.77 1105.33 1.000 alpha{3} 2.373539 0.651968 1.026741 3.991329 2.260256 1182.19 1212.28 1.000 pinvar{all} 0.253643 0.007739 0.071771 0.425814 0.257013 1369.16 1404.36 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3389.292457 Model 2: PositiveSelection -3389.292457 Model 0: one-ratio -3395.269138 Model 3: discrete -3387.21108 Model 7: beta -3387.750548 Model 8: beta&w>1 -3387.750627 Model 0 vs 1 11.953362000000197 Model 2 vs 1 0.0 Model 8 vs 7 1.5799999982846202E-4
>C1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYAR YMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISI LGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLRFCRSS L >C2 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPAIMIRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLKRVLPLERMCQLYTTDVTGSLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKAKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHFLKQYWVETCERTVSEIRFNPKSFMLESQNEIYLRFCRSS L >C3 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKPKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASAGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGNRLG VLQLKLGIAHILKQYWVETCERTVSEIRFNPKSFMLESQDEIYLRFCRNS L >C4 MLLLWLLLLTIVSLNFWLRHKYDYFRSRGIPYLAPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRLVLIKNFN SFLNRYESADAGDPMGALTLPLAKYHQWKESRQCMSQLFTSGRMRDVMYG QMLNVAIDLENYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHKEPTKGDLINQLQHFQLSRSSNHYSQHPDFVSSQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELREVFNSSATLSYDTLMALPY LKMVCLEALRLYPAAAFVNRECTSSAPEGFTLQPHVDFVVPPGMPAYISI LGLHRDERYWPEPGLFNPERFAPERFKHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEVCERTVSEIRFNPKSFMLESQDEIYLRFCSSN L >C5 MLLIWLLLLTIVSLNFWLRHKYDYFRSRGIPFLAPSFWSPMGNLGQLLFL RISFGDLFRQLYADPQNGEAKIVGFFIFQTPALMVRDPELIRQVLIKNFN HFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAMDLENYLHRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHHEPSKGDLINQLQHFQLSRSSSHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELRDAFISCATLSYDALMDLPY LKMVCLEALRLYPAAAFVNRECTSPASEGFSLQPHVNFVVPPGMPAYISI LGLHRDERYWPEPDLFNPERFAPERSRYIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEACERTVSEIRFNPKSFMLESQNEIYLRFCRSS L CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=501 C1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL C2 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL C3 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL C4 MLLLWLLLLTIVSLNFWLRHKYDYFRSRGIPYLAPSSWSPMGNLGQLLFL C5 MLLIWLLLLTIVSLNFWLRHKYDYFRSRGIPFLAPSFWSPMGNLGQLLFL ***:********:******************.*.** ************* C1 RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN C2 RISFGDLFRQLYADPRNGQAKIVGFFIFQTPAIMIRDPELIRQVLIKNFN C3 RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN C4 RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRLVLIKNFN C5 RISFGDLFRQLYADPQNGEAKIVGFFIFQTPALMVRDPELIRQVLIKNFN ***************:**:*************:*:******* ******* C1 NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS C2 NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR C3 NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR C4 SFLNRYESADAGDPMGALTLPLAKYHQWKESRQCMSQLFTSGRMRDVMYG C5 HFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR ****:********************:********************** C1 QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG C2 QMLDVAIDLEQYLNRKLGDRLKRVLPLERMCQLYTTDVTGSLFYSLNVGG C3 QMLDVAIDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG C4 QMLNVAIDLENYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG C5 QMLDVAMDLENYLHRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG ***:** ***:**:*******:***** ************.********* C1 LRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYAR C2 LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKAKVFTEDYAR C3 LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKPKVFTEDYAR C4 LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR C5 LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR ********:***************************.:**.********* C1 YMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA C2 YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA C3 YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA C4 YMRHLVEDHKEPTKGDLINQLQHFQLSRSSNHYSQHPDFVSSQAGIILLA C5 YMRHLVEDHHEPSKGDLINQLQHFQLSRSSSHYSQHPDFVASQAGIILLA ******:**:**:*****************.*********:********* C1 GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPY C2 GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY C3 GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY C4 GFETSSALMGFTLYELAKAPDIQDRLRRELREVFNSSATLSYDTLMALPY C5 GFETSSALMGFTLYELAKAPDIQDRLRRELRDAFISCATLSYDALMDLPY ***********************:*** ***:.* * ******:** *** C1 LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISI C2 LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFVIPPGMPAYISI C3 LKMVCLEALRLYPAAAFVNRECTSSASAGFSLQPHVDFVIPPGMPAYISI C4 LKMVCLEALRLYPAAAFVNRECTSSAPEGFTLQPHVDFVVPPGMPAYISI C5 LKMVCLEALRLYPAAAFVNRECTSPASEGFSLQPHVNFVVPPGMPAYISI ************************.*. **:*****:*::********** C1 LGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLG C2 LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGSRLG C3 LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGNRLG C4 LGLHRDERYWPEPGLFNPERFAPERFKHIHPMTYIPFGAGPHGCIGSRLG C5 LGLHRDERYWPEPDLFNPERFAPERSRYIHPMTYIPFGAGPHGCIGSRLG ********:**** :*:****.*** ::******************.*** C1 VLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLRFCRSS C2 VLQLKLGIAHFLKQYWVETCERTVSEIRFNPKSFMLESQNEIYLRFCRSS C3 VLQLKLGIAHILKQYWVETCERTVSEIRFNPKSFMLESQDEIYLRFCRNS C4 VLQLKLGIAHILKQYWVEVCERTVSEIRFNPKSFMLESQDEIYLRFCSSN C5 VLQLKLGIAHILKQYWVEACERTVSEIRFNPKSFMLESQNEIYLRFCRSS ********.*:*******.*******************::******* .. C1 L C2 L C3 L C4 L C5 L * PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 501 type PROTEIN Struct Unchecked Input File /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 501 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [72] Relaxation Summary: [10020]--->[10020] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.323 Mb, Max= 30.766 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYAR YMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISI LGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLRFCRSS L >C2 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPAIMIRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLKRVLPLERMCQLYTTDVTGSLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKAKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHFLKQYWVETCERTVSEIRFNPKSFMLESQNEIYLRFCRSS L >C3 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKPKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASAGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGNRLG VLQLKLGIAHILKQYWVETCERTVSEIRFNPKSFMLESQDEIYLRFCRNS L >C4 MLLLWLLLLTIVSLNFWLRHKYDYFRSRGIPYLAPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRLVLIKNFN SFLNRYESADAGDPMGALTLPLAKYHQWKESRQCMSQLFTSGRMRDVMYG QMLNVAIDLENYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHKEPTKGDLINQLQHFQLSRSSNHYSQHPDFVSSQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELREVFNSSATLSYDTLMALPY LKMVCLEALRLYPAAAFVNRECTSSAPEGFTLQPHVDFVVPPGMPAYISI LGLHRDERYWPEPGLFNPERFAPERFKHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEVCERTVSEIRFNPKSFMLESQDEIYLRFCSSN L >C5 MLLIWLLLLTIVSLNFWLRHKYDYFRSRGIPFLAPSFWSPMGNLGQLLFL RISFGDLFRQLYADPQNGEAKIVGFFIFQTPALMVRDPELIRQVLIKNFN HFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAMDLENYLHRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHHEPSKGDLINQLQHFQLSRSSSHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELRDAFISCATLSYDALMDLPY LKMVCLEALRLYPAAAFVNRECTSPASEGFSLQPHVNFVVPPGMPAYISI LGLHRDERYWPEPDLFNPERFAPERSRYIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEACERTVSEIRFNPKSFMLESQNEIYLRFCRSS L FORMAT of file /tmp/tmp3115753234244125542aln Not Supported[FATAL:T-COFFEE] >C1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYAR YMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISI LGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLRFCRSS L >C2 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPAIMIRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLKRVLPLERMCQLYTTDVTGSLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKAKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHFLKQYWVETCERTVSEIRFNPKSFMLESQNEIYLRFCRSS L >C3 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKPKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASAGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGNRLG VLQLKLGIAHILKQYWVETCERTVSEIRFNPKSFMLESQDEIYLRFCRNS L >C4 MLLLWLLLLTIVSLNFWLRHKYDYFRSRGIPYLAPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRLVLIKNFN SFLNRYESADAGDPMGALTLPLAKYHQWKESRQCMSQLFTSGRMRDVMYG QMLNVAIDLENYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHKEPTKGDLINQLQHFQLSRSSNHYSQHPDFVSSQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELREVFNSSATLSYDTLMALPY LKMVCLEALRLYPAAAFVNRECTSSAPEGFTLQPHVDFVVPPGMPAYISI LGLHRDERYWPEPGLFNPERFAPERFKHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEVCERTVSEIRFNPKSFMLESQDEIYLRFCSSN L >C5 MLLIWLLLLTIVSLNFWLRHKYDYFRSRGIPFLAPSFWSPMGNLGQLLFL RISFGDLFRQLYADPQNGEAKIVGFFIFQTPALMVRDPELIRQVLIKNFN HFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAMDLENYLHRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHHEPSKGDLINQLQHFQLSRSSSHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELRDAFISCATLSYDALMDLPY LKMVCLEALRLYPAAAFVNRECTSPASEGFSLQPHVNFVVPPGMPAYISI LGLHRDERYWPEPDLFNPERFAPERSRYIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEACERTVSEIRFNPKSFMLESQNEIYLRFCRSS L input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:501 S:100 BS:501 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 96.01 C1 C2 96.01 TOP 1 0 96.01 C2 C1 96.01 BOT 0 2 96.61 C1 C3 96.61 TOP 2 0 96.61 C3 C1 96.61 BOT 0 3 92.02 C1 C4 92.02 TOP 3 0 92.02 C4 C1 92.02 BOT 0 4 93.01 C1 C5 93.01 TOP 4 0 93.01 C5 C1 93.01 BOT 1 2 97.80 C2 C3 97.80 TOP 2 1 97.80 C3 C2 97.80 BOT 1 3 92.61 C2 C4 92.61 TOP 3 1 92.61 C4 C2 92.61 BOT 1 4 93.21 C2 C5 93.21 TOP 4 1 93.21 C5 C2 93.21 BOT 2 3 93.61 C3 C4 93.61 TOP 3 2 93.61 C4 C3 93.61 BOT 2 4 93.81 C3 C5 93.81 TOP 4 2 93.81 C5 C3 93.81 BOT 3 4 93.01 C4 C5 93.01 TOP 4 3 93.01 C5 C4 93.01 AVG 0 C1 * 94.41 AVG 1 C2 * 94.91 AVG 2 C3 * 95.46 AVG 3 C4 * 92.81 AVG 4 C5 * 93.26 TOT TOT * 94.17 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCTGCTCATCTGGCTGCTGTTGCTCACCATTGTGACTCTGAATTTTTG C2 ATGCTGCTCATCTGGCTGCTATTGCTCACCATTGTGACACTTAATTTTTG C3 ATGCTGCTCATCTGGCTGCTGTTGCTCACCATTGTGACACTTAATTTTTG C4 ATGCTGCTCCTCTGGCTGCTGTTGCTCACTATTGTGTCGCTAAATTTTTG C5 ATGCTGCTCATCTGGCTGCTCTTGCTCACCATTGTGTCGCTAAACTTTTG *********.********** ******** ******:* ** ** ***** C1 GTTAAGGCACAAGTACGATTACTTCAGGAGCCGTGGGATTCCGCACCTGC C2 GTTGAGACACAAGTACGACTACTTCAGGAGTCGTGGGATTCCGCACCTGC C3 GTTGAGACACAAGTACGACTACTTCAGGAGTCGTGGCATTCCGCACCTGC C4 GTTGAGGCACAAGTACGACTACTTTAGGAGCCGCGGGATTCCGTACTTGG C5 GTTGAGACACAAGTACGACTACTTTAGGAGCCGCGGGATTCCATTCTTGG ***.**.*********** ***** ***** ** ** *****. :* ** C1 CACCCTCCTCTTGGTCACCAATGGGCAATTTGGGACAACTTCTATTTCTG C2 CACCCTCCTCTTGGTCACCAATGGGCAATCTGGGACAACTTCTATTCCTG C3 CACCCTCCTCCTGGTCACCAATGGGCAATCTGGGACAACTTCTATTCCTG C4 CACCCTCCTCCTGGTCACCAATGGGCAATCTGGGGCAACTCCTCTTTCTG C5 CACCCTCCTTCTGGTCGCCAATGGGCAATCTGGGACAACTTCTATTCCTG ********* *****.************ ****.***** **.** *** C1 CGCATTTCTTTTGGCGATCTCTTTCGGCAGCTCTACGCAGATCCACGAAA C2 CGCATTTCTTTTGGCGATCTCTTTCGGCAGCTCTACGCAGATCCACGAAA C3 CGCATTTCTTTTGGCGATCTCTTTCGGCAGCTCTACGCCGATCCACGAAA C4 CGTATTTCTTTCGGCGATCTCTTTCGGCAGCTCTACGCAGATCCCCGAAA C5 CGTATTTCCTTCGGCGATCTCTTTCGGCAGCTCTACGCAGATCCCCAAAA ** ***** ** **************************.*****.*.*** C1 TGGTCAGGCGAAGATCGTTGGCTTCTTCATATTCCAAACGCCGGCGCTTA C2 TGGTCAGGCGAAGATCGTTGGCTTCTTTATCTTCCAAACACCGGCGATTA C3 TGGTCAGGCGAAGATCGTTGGCTTCTTCATATTCCAAACGCCGGCGCTTA C4 TGGCCAGGCGAAGATCGTTGGCTTCTTTATCTTTCAAACGCCGGCCCTTA C5 TGGTGAGGCGAAGATCGTGGGCTTCTTCATCTTTCAAACGCCAGCCCTTA *** ************* ******** **.** *****.**.** .*** C1 TGGTTCGGGATCCGGAGCTAATCCGCCAGGTGTTGATTAAGAATTTCAAC C2 TGATTCGGGATCCGGAGCTAATCCGCCAGGTGTTGATTAAGAATTTCAAC C3 TGGTTCGGGATCCGGAGCTAATCCGCCAGGTGTTGATTAAGAATTTCAAC C4 TGGTTCGAGATCCGGAGCTGATCCGCCTGGTGTTGATCAAGAATTTCAAC C5 TGGTGCGAGATCCGGAGCTGATACGCCAGGTGTTGATTAAGAATTTCAAC **.* **.***********.**.****:********* ************ C1 AACTTTCTCAACCGGTTCGAATCGGCGGACGCCGGAGATCCCATGGGTGC C2 AACTTTCTCAACCGATTCGAATCGGCGGACGCCGGAGATCCCATGGGTGC C3 AACTTTCTCAACCGATTCGAATCGGCGGACGCCGGAGATCCCATGGGTGC C4 AGCTTCCTCAACCGATACGAGTCGGCGGACGCTGGAGATCCCATGGGTGC C5 CACTTCCTTAACCGATTCGAATCGGCGGACGCTGGTGATCCCATGGGCGC ..*** ** *****.*:***.*********** **:*********** ** C1 ACTGACGCTACCGCTGGCTAAGTACCATCACTGGAAGGAGAGTCGGCAAT C2 ACTGACGCTACCGCTGGCTAAGTACCATCACTGGAAGGAAAGTCGGCAGT C3 ACTGACGCTACCGCTGGCTAAGTACCATCACTGGAAGGAGAGTCGGCAGT C4 ACTGACGCTGCCGCTGGCCAAGTACCATCAGTGGAAAGAGAGTCGGCAGT C5 ACTGACGCTCCCGCTGGCTAAGTACCACCACTGGAAAGAGAGTCGGCAGT ********* ******** ******** ** *****.**.********.* C1 GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTCATGTACAGC C2 GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTCATGTACCGC C3 GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTCATGTACCGC C4 GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTAATGTATGGC C5 GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTAATGTATCGC ****************************************.***** ** C1 CAAATGTTGGATGTGGCCAGCGACTTGGAGCAGTACCTCAACAGGAAGCT C2 CAAATGTTGGATGTGGCCATCGACCTGGAGCAGTACCTGAACAGGAAGCT C3 CAAATGTTGGATGTGGCCATCGACCTGGAGCAGTACCTGAACAGGAAGCT C4 CAAATGTTGAATGTGGCAATTGACCTGGAGAACTACCTCAATAGGAAGCT C5 CAAATGTTGGATGTGGCTATGGACCTGGAGAATTACCTCCATAGGAAGCT *********.******* * *** *****.* ***** .* ******** C1 GGGGGATCGGCTGGAGCGCGTTCTCCCGTTGGGAAGAATGTGCCAGTTGT C2 GGGGGATCGGCTGAAGCGCGTTCTGCCACTGGAAAGAATGTGCCAGTTGT C3 GGGGGATCGGCTGGAGCGCGTTCTGCCACTGGGTAGAATGTGCCAGTTGT C4 GGGTGATCGGCTGGAGCGTGTCCTCCCATTGGGAAGAATGTGCCAGTTGT C5 GGGGGATCGGCTGGAGCGCGTTCTCCCATTGGGAAGAATGTGCCAGTTGT *** *********.**** ** ** **. ***.:**************** C1 ACACCACCGACGTGACGGGGAATCTCTTCTACAGCCTGAATGTCGGCGGA C2 ACACCACCGACGTGACGGGAAGTCTCTTCTATAGCCTGAATGTCGGCGGA C3 ACACCACCGACGTGACGGGGAATCTCTTCTACAGCCTGAATGTCGGCGGA C4 ATACCACCGACGTGACGGGAAATCTCTTCTATAGTCTGAATGTCGGCGGA C5 ATACCACCGACGTGACGGGTAATCTCTTCTATAGCCTAAATGTCGGCGGA * ***************** *.********* ** **.************ C1 TTGCGTCGTGGTCGATCCGAGTTGATAACAAAAACCAAGGAGCTATTTAA C2 TTGCGTCGTGGGCGATCCGAGTTGCTAACGAAAACCAAGGAACTATTTAA C3 TTGCGTCGTGGGCGATCCGAGTTGCTAACGAAAACCAAGGAACTATTTAA C4 TTGCGTCGTGGGCGGTCTGAGCTGCTTACGAAAACCAAAGAACTATTTAA C5 TTGCGTCGTGGGCGGTCTGAGCTGCTTACGAAAACGAAGGAACTATTTAA *********** **.** *** **.*:**.***** **.**.******** C1 CACCAATCCCCGCAAGGTTTTGGACTTCATGAGTGTATTCTTTCTGCCCA C2 CACCAATCCTCGCAAGGTTCTTGACTTCATGAGTGTATTCTTTCTGCCCA C3 CACCAATCCTCGCAAGGTTCTGGACTTCATGAGTGTATTCTTTCTGCCCA C4 CACCAATCCCCGCAAGGTTCTGGACTTCATGAGTGTGTTTTTTCTGCCCA C5 CACCAATCCCCGCAAGGTTCTGGACTTCATGAGTGTATTCTTTCTGCCAA ********* ********* * **************.** ********.* C1 AGTGGACGGGTGTGCTGAAGCCCAAAGTTTTTACCGAAGACTATGCGCGC C2 AGTGGACGGGTCTGCTGAAGGCGAAAGTTTTTACCGAAGACTATGCGCGC C3 AGTGGACGGGTCTGCTGAAGCCCAAAGTTTTTACCGAAGACTATGCGCGC C4 AGTGGACAAATCTGCTCAAGCCAAAAGTTTTTACCGAAGACTATGCGCGG C5 AGTGGACGAATCTGCTTAAGCCTAAAGTTTTTACCGAAGACTATGCGCGC *******...* **** *** * ************************** C1 TATATGAGGCACTTGGTAGATGATCATCACGAGCCCACCAAAGGAGATCT C2 TATATGAGGCACTTGGTGGAGGATCATCACGAGCCCACCAAAGGAGATCT C3 TATATGCGGCACTTGGTAGAGGATCATCACGAGCCCACCAAAGGAGATCT C4 TATATGAGGCACTTGGTGGAGGATCACAAAGAGCCCACGAAGGGAGATCT C5 TATATGAGGCACTTGGTGGAGGATCACCACGAGCCCTCGAAGGGAGATCT ******.**********.** ***** .*.******:* **.******** C1 CATCAATCAATTGCAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT C2 CATCAATCAATTACAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT C3 CATCAATCAATTGCAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT C4 CATCAATCAACTGCAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT C5 CATCAATCAATTGCAGCACTTTCAGTTAAGCCGCTCATCCAGCCACTATT ********** *.**************.*************.******** C1 CCCAGCATCCGGACTTTGTTGCTTCGCAGGCGGGTATCATACTGCTGGCC C2 CCCAGCATCCGGACTTTGTTGCCTCGCAGGCGGGCATTATACTGCTGGCC C3 CCCAGCATCCGGACTTTGTAGCCTCGCAGGCGGGCATTATACTGCTGGCC C4 CCCAACATCCGGATTTTGTTTCCTCCCAGGCAGGGATTATTCTGCTGGCC C5 CCCAACATCCGGATTTTGTAGCCTCCCAGGCAGGCATTATTCTGCTGGCC ****.******** *****: * ** *****.** ** **:********* C1 GGATTTGAAACCTCCTCAGCCCTGATGGGATTCACTCTCTATGAGTTGGC C2 GGATTTGAAACATCCTCAGCCCTGATGGGATTCACTCTCTATGAGCTGGC C3 GGATTTGAAACATCCTCAGCCCTGATGGGATTCACTCTCTATGAGCTGGC C4 GGATTTGAAACCTCCTCGGCTCTGATGGGATTCACTCTCTATGAACTGGC C5 GGATTTGAAACCTCCTCGGCCCTGATGGGATTCACCCTCTATGAGCTGGC ***********.*****.** ************** ********. **** C1 CAAGGCTCCGGATATTCAAGAACGACTGAGGAGTGAGCTACGAGAAGCCT C2 CAAGGCGCCGGATATTCAAGAACGACTGAGGAGGGAGCTACGAGAAGCCT C3 CAAGGCGCCGGATATTCAAGAACGACTGAGGAGGGAGCTACGAGAAGCCT C4 CAAGGCACCGGATATTCAAGACCGACTGAGGAGGGAGCTAAGGGAAGTCT C5 CAAGGCACCGGATATTCAAGACCGACTGAGGAGGGAGCTAAGGGACGCCT ****** **************.*********** ******.*.**.* ** C1 TCATCTCCACTGCTACCCTAAGCTATGACACACTGATGACTTTGCCCTAT C2 TCAACTCCACTGCTACCCTGAGTTATGACACACTGATGACTCTGCCCTAT C3 TCAACTCCACTGCTACGCTAAGCTATGACACCCTGATGACTCTGCCCTAT C4 TTAACTCCAGTGCTACCCTAAGCTATGACACACTGATGGCGCTACCCTAC C5 TCATCTCTTGTGCCACCCTAAGCTATGATGCATTGATGGATCTACCCTAC * *:*** : *** ** **.** ***** .*. *****.. *.***** C1 CTCAAAATGGTGTGTTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCTTT C2 CTCAAAATGGTGTGTTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCTTT C3 CTCAAAATGGTGTGTTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCTTT C4 CTCAAGATGGTGTGCTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCCTT C5 CTCAAAATGGTGTGCTTAGAGGCACTGCGTCTCTATCCGGCTGCAGCCTT *****.******** **.**************************:** ** C1 CGTCAACAGAGAGTGCACCAGTTCGGCATCCGAGGGATTCTCACTGCAAC C2 CGTCAACAGAGAATGCACCAGCTCAGCATCCGAGGGATTCTCTCTGCAGC C3 CGTCAACAGAGAGTGCACCAGTTCAGCATCCGCGGGATTCTCTCTGCAGC C4 CGTCAACAGAGAGTGCACCAGTTCGGCACCCGAGGGATTCACTCTGCAGC C5 CGTCAACAGGGAGTGCACCAGTCCGGCATCCGAGGGATTCTCTCTGCAGC *********.**.******** *.*** ***.*******:*:*****.* C1 CGCATGTGGATTTCATAGTGCCACCAGGGATGCCAGCATACATCTCAATA C2 CACATGTGGATTTCGTAATTCCACCAGGGATGCCAGCATACATTTCAATA C3 CACATGTGGATTTCGTAATTCCACCAGGGATGCCAGCATACATCTCAATA C4 CGCATGTGGATTTCGTAGTGCCACCAGGAATGCCAGCGTACATCTCGATT C5 CGCATGTGAATTTCGTAGTGCCACCAGGGATGCCAGCATACATCTCGATT *.******.*****.**.* ********.********.***** **.**: C1 CTCGGCCTCCATCGCGATGAAAGGTTTTGGCCGGAGCCCTGCGTCTTTGA C2 CTCGGCCTCCACCGCGATGAAAGGTTTTGGCCGGAGCCCTGCCTCTTTGA C3 CTCGGCCTCCATCGCGATGAAAGGTTTTGGCCGGAGCCCTGCCTCTTTGA C4 CTCGGTCTCCACCGTGATGAAAGGTATTGGCCGGAACCCGGCCTCTTTAA C5 CTTGGCCTCCATCGTGATGAAAGGTATTGGCCGGAACCCGACCTCTTTAA ** ** ***** ** **********:*********.*** .* *****.* C1 TCCCGAGAGATTCGGTCCGGAGCGATCTAGGCACATCCACCCGATGACCT C2 TCCCGAGAGATTCGCTCCGGAGCGGTCTAGGCACATTCACCCGATGACCT C3 TCCCGAGAGATTCGCTCCGGAGCGGTCCAGGCACATTCACCCGATGACCT C4 TCCCGAGAGATTTGCTCCAGAGCGCTTTAAGCACATTCACCCGATGACCT C5 TCCCGAGCGATTCGCTCCAGAGCGGTCTAGGTACATTCACCCGATGACCT *******.**** * ***.***** * *.* **** ************* C1 ACATACCCTTTGGAGCAGGTCCACATGGCTGTATTGGTAGTCGCCTGGGC C2 ACATACCCTTTGGAGCTGGTCCACATGGCTGCATTGGTAGTCGCCTGGGC C3 ACATACCCTTTGGAGCTGGTCCACATGGCTGCATTGGTAATCGCCTGGGC C4 ACATACCTTTTGGAGCTGGCCCACATGGCTGTATTGGTAGTCGTCTGGGC C5 ACATACCATTTGGAGCTGGTCCACATGGCTGTATTGGTAGTCGTCTGGGC ******* ********:** *********** *******.*** ****** C1 GTACTCCAATTGAAACTGGGCATAGTGCACATTTTAAAGCAATATTGGGT C2 GTCCTCCAACTGAAACTGGGCATAGCGCACTTTTTAAAACAATATTGGGT C3 GTCCTCCAACTGAAACTGGGCATAGCGCACATTTTAAAACAATATTGGGT C4 GTTCTACAACTGAAACTGGGTATAGCCCACATTTTAAAACAATATTGGGT C5 GTCCTCCAACTGAAACTGGGTATAGCTCACATTTTAAAACAATATTGGGT ** **.*** ********** **** ***:*******.*********** C1 TGAGACTTGCGAGCGAACAGTATCGGAGATTCGCTTTAATCCAAAGTCCT C2 TGAGACTTGCGAACGAACAGTGTCGGAGATTCGCTTCAATCCAAAGTCCT C3 TGAGACTTGCGAGCGAACAGTGTCGGAGATTCGCTTCAATCCAAAGTCCT C4 TGAGGTTTGTGAGCGAACAGTCTCAGAGATTCGCTTTAATCCAAAGTCCT C5 TGAGGCATGCGAGCGAACAGTGTCGGAGATTCGCTTTAATCCAAAGTCCT ****. :** **.******** **.*********** ************* C1 TCATGTTGGAGTCTGAGAATGAGATATACCTAAGATTCTGCAGGAGTAGT C2 TCATGTTGGAGTCTCAGAATGAGATATACCTAAGATTCTGCAGGAGTAGT C3 TCATGTTGGAGTCTCAGGATGAGATATACCTAAGATTCTGCAGGAATAGT C4 TCATGTTGGAGTCTCAGGATGAGATTTACTTACGATTCTGCAGCAGTAAT C5 TCATGTTGGAGTCTCAGAATGAGATTTACTTAAGATTCTGCAGGAGCAGT ************** **.*******:*** **.********** *. *.* C1 TTG C2 TTG C3 TTG C4 TTG C5 TTG *** >C1 ATGCTGCTCATCTGGCTGCTGTTGCTCACCATTGTGACTCTGAATTTTTG GTTAAGGCACAAGTACGATTACTTCAGGAGCCGTGGGATTCCGCACCTGC CACCCTCCTCTTGGTCACCAATGGGCAATTTGGGACAACTTCTATTTCTG CGCATTTCTTTTGGCGATCTCTTTCGGCAGCTCTACGCAGATCCACGAAA TGGTCAGGCGAAGATCGTTGGCTTCTTCATATTCCAAACGCCGGCGCTTA TGGTTCGGGATCCGGAGCTAATCCGCCAGGTGTTGATTAAGAATTTCAAC AACTTTCTCAACCGGTTCGAATCGGCGGACGCCGGAGATCCCATGGGTGC ACTGACGCTACCGCTGGCTAAGTACCATCACTGGAAGGAGAGTCGGCAAT GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTCATGTACAGC CAAATGTTGGATGTGGCCAGCGACTTGGAGCAGTACCTCAACAGGAAGCT GGGGGATCGGCTGGAGCGCGTTCTCCCGTTGGGAAGAATGTGCCAGTTGT ACACCACCGACGTGACGGGGAATCTCTTCTACAGCCTGAATGTCGGCGGA TTGCGTCGTGGTCGATCCGAGTTGATAACAAAAACCAAGGAGCTATTTAA CACCAATCCCCGCAAGGTTTTGGACTTCATGAGTGTATTCTTTCTGCCCA AGTGGACGGGTGTGCTGAAGCCCAAAGTTTTTACCGAAGACTATGCGCGC TATATGAGGCACTTGGTAGATGATCATCACGAGCCCACCAAAGGAGATCT CATCAATCAATTGCAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT CCCAGCATCCGGACTTTGTTGCTTCGCAGGCGGGTATCATACTGCTGGCC GGATTTGAAACCTCCTCAGCCCTGATGGGATTCACTCTCTATGAGTTGGC CAAGGCTCCGGATATTCAAGAACGACTGAGGAGTGAGCTACGAGAAGCCT TCATCTCCACTGCTACCCTAAGCTATGACACACTGATGACTTTGCCCTAT CTCAAAATGGTGTGTTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCTTT CGTCAACAGAGAGTGCACCAGTTCGGCATCCGAGGGATTCTCACTGCAAC CGCATGTGGATTTCATAGTGCCACCAGGGATGCCAGCATACATCTCAATA CTCGGCCTCCATCGCGATGAAAGGTTTTGGCCGGAGCCCTGCGTCTTTGA TCCCGAGAGATTCGGTCCGGAGCGATCTAGGCACATCCACCCGATGACCT ACATACCCTTTGGAGCAGGTCCACATGGCTGTATTGGTAGTCGCCTGGGC GTACTCCAATTGAAACTGGGCATAGTGCACATTTTAAAGCAATATTGGGT TGAGACTTGCGAGCGAACAGTATCGGAGATTCGCTTTAATCCAAAGTCCT TCATGTTGGAGTCTGAGAATGAGATATACCTAAGATTCTGCAGGAGTAGT TTG >C2 ATGCTGCTCATCTGGCTGCTATTGCTCACCATTGTGACACTTAATTTTTG GTTGAGACACAAGTACGACTACTTCAGGAGTCGTGGGATTCCGCACCTGC CACCCTCCTCTTGGTCACCAATGGGCAATCTGGGACAACTTCTATTCCTG CGCATTTCTTTTGGCGATCTCTTTCGGCAGCTCTACGCAGATCCACGAAA TGGTCAGGCGAAGATCGTTGGCTTCTTTATCTTCCAAACACCGGCGATTA TGATTCGGGATCCGGAGCTAATCCGCCAGGTGTTGATTAAGAATTTCAAC AACTTTCTCAACCGATTCGAATCGGCGGACGCCGGAGATCCCATGGGTGC ACTGACGCTACCGCTGGCTAAGTACCATCACTGGAAGGAAAGTCGGCAGT GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTCATGTACCGC CAAATGTTGGATGTGGCCATCGACCTGGAGCAGTACCTGAACAGGAAGCT GGGGGATCGGCTGAAGCGCGTTCTGCCACTGGAAAGAATGTGCCAGTTGT ACACCACCGACGTGACGGGAAGTCTCTTCTATAGCCTGAATGTCGGCGGA TTGCGTCGTGGGCGATCCGAGTTGCTAACGAAAACCAAGGAACTATTTAA CACCAATCCTCGCAAGGTTCTTGACTTCATGAGTGTATTCTTTCTGCCCA AGTGGACGGGTCTGCTGAAGGCGAAAGTTTTTACCGAAGACTATGCGCGC TATATGAGGCACTTGGTGGAGGATCATCACGAGCCCACCAAAGGAGATCT CATCAATCAATTACAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT CCCAGCATCCGGACTTTGTTGCCTCGCAGGCGGGCATTATACTGCTGGCC GGATTTGAAACATCCTCAGCCCTGATGGGATTCACTCTCTATGAGCTGGC CAAGGCGCCGGATATTCAAGAACGACTGAGGAGGGAGCTACGAGAAGCCT TCAACTCCACTGCTACCCTGAGTTATGACACACTGATGACTCTGCCCTAT CTCAAAATGGTGTGTTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCTTT CGTCAACAGAGAATGCACCAGCTCAGCATCCGAGGGATTCTCTCTGCAGC CACATGTGGATTTCGTAATTCCACCAGGGATGCCAGCATACATTTCAATA CTCGGCCTCCACCGCGATGAAAGGTTTTGGCCGGAGCCCTGCCTCTTTGA TCCCGAGAGATTCGCTCCGGAGCGGTCTAGGCACATTCACCCGATGACCT ACATACCCTTTGGAGCTGGTCCACATGGCTGCATTGGTAGTCGCCTGGGC GTCCTCCAACTGAAACTGGGCATAGCGCACTTTTTAAAACAATATTGGGT TGAGACTTGCGAACGAACAGTGTCGGAGATTCGCTTCAATCCAAAGTCCT TCATGTTGGAGTCTCAGAATGAGATATACCTAAGATTCTGCAGGAGTAGT TTG >C3 ATGCTGCTCATCTGGCTGCTGTTGCTCACCATTGTGACACTTAATTTTTG GTTGAGACACAAGTACGACTACTTCAGGAGTCGTGGCATTCCGCACCTGC CACCCTCCTCCTGGTCACCAATGGGCAATCTGGGACAACTTCTATTCCTG CGCATTTCTTTTGGCGATCTCTTTCGGCAGCTCTACGCCGATCCACGAAA TGGTCAGGCGAAGATCGTTGGCTTCTTCATATTCCAAACGCCGGCGCTTA TGGTTCGGGATCCGGAGCTAATCCGCCAGGTGTTGATTAAGAATTTCAAC AACTTTCTCAACCGATTCGAATCGGCGGACGCCGGAGATCCCATGGGTGC ACTGACGCTACCGCTGGCTAAGTACCATCACTGGAAGGAGAGTCGGCAGT GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTCATGTACCGC CAAATGTTGGATGTGGCCATCGACCTGGAGCAGTACCTGAACAGGAAGCT GGGGGATCGGCTGGAGCGCGTTCTGCCACTGGGTAGAATGTGCCAGTTGT ACACCACCGACGTGACGGGGAATCTCTTCTACAGCCTGAATGTCGGCGGA TTGCGTCGTGGGCGATCCGAGTTGCTAACGAAAACCAAGGAACTATTTAA CACCAATCCTCGCAAGGTTCTGGACTTCATGAGTGTATTCTTTCTGCCCA AGTGGACGGGTCTGCTGAAGCCCAAAGTTTTTACCGAAGACTATGCGCGC TATATGCGGCACTTGGTAGAGGATCATCACGAGCCCACCAAAGGAGATCT CATCAATCAATTGCAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT CCCAGCATCCGGACTTTGTAGCCTCGCAGGCGGGCATTATACTGCTGGCC GGATTTGAAACATCCTCAGCCCTGATGGGATTCACTCTCTATGAGCTGGC CAAGGCGCCGGATATTCAAGAACGACTGAGGAGGGAGCTACGAGAAGCCT TCAACTCCACTGCTACGCTAAGCTATGACACCCTGATGACTCTGCCCTAT CTCAAAATGGTGTGTTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCTTT CGTCAACAGAGAGTGCACCAGTTCAGCATCCGCGGGATTCTCTCTGCAGC CACATGTGGATTTCGTAATTCCACCAGGGATGCCAGCATACATCTCAATA CTCGGCCTCCATCGCGATGAAAGGTTTTGGCCGGAGCCCTGCCTCTTTGA TCCCGAGAGATTCGCTCCGGAGCGGTCCAGGCACATTCACCCGATGACCT ACATACCCTTTGGAGCTGGTCCACATGGCTGCATTGGTAATCGCCTGGGC GTCCTCCAACTGAAACTGGGCATAGCGCACATTTTAAAACAATATTGGGT TGAGACTTGCGAGCGAACAGTGTCGGAGATTCGCTTCAATCCAAAGTCCT TCATGTTGGAGTCTCAGGATGAGATATACCTAAGATTCTGCAGGAATAGT TTG >C4 ATGCTGCTCCTCTGGCTGCTGTTGCTCACTATTGTGTCGCTAAATTTTTG GTTGAGGCACAAGTACGACTACTTTAGGAGCCGCGGGATTCCGTACTTGG CACCCTCCTCCTGGTCACCAATGGGCAATCTGGGGCAACTCCTCTTTCTG CGTATTTCTTTCGGCGATCTCTTTCGGCAGCTCTACGCAGATCCCCGAAA TGGCCAGGCGAAGATCGTTGGCTTCTTTATCTTTCAAACGCCGGCCCTTA TGGTTCGAGATCCGGAGCTGATCCGCCTGGTGTTGATCAAGAATTTCAAC AGCTTCCTCAACCGATACGAGTCGGCGGACGCTGGAGATCCCATGGGTGC ACTGACGCTGCCGCTGGCCAAGTACCATCAGTGGAAAGAGAGTCGGCAGT GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTAATGTATGGC CAAATGTTGAATGTGGCAATTGACCTGGAGAACTACCTCAATAGGAAGCT GGGTGATCGGCTGGAGCGTGTCCTCCCATTGGGAAGAATGTGCCAGTTGT ATACCACCGACGTGACGGGAAATCTCTTCTATAGTCTGAATGTCGGCGGA TTGCGTCGTGGGCGGTCTGAGCTGCTTACGAAAACCAAAGAACTATTTAA CACCAATCCCCGCAAGGTTCTGGACTTCATGAGTGTGTTTTTTCTGCCCA AGTGGACAAATCTGCTCAAGCCAAAAGTTTTTACCGAAGACTATGCGCGG TATATGAGGCACTTGGTGGAGGATCACAAAGAGCCCACGAAGGGAGATCT CATCAATCAACTGCAGCACTTTCAGTTGAGCCGCTCATCCAACCACTATT CCCAACATCCGGATTTTGTTTCCTCCCAGGCAGGGATTATTCTGCTGGCC GGATTTGAAACCTCCTCGGCTCTGATGGGATTCACTCTCTATGAACTGGC CAAGGCACCGGATATTCAAGACCGACTGAGGAGGGAGCTAAGGGAAGTCT TTAACTCCAGTGCTACCCTAAGCTATGACACACTGATGGCGCTACCCTAC CTCAAGATGGTGTGCTTGGAGGCACTGCGTCTCTATCCGGCTGCTGCCTT CGTCAACAGAGAGTGCACCAGTTCGGCACCCGAGGGATTCACTCTGCAGC CGCATGTGGATTTCGTAGTGCCACCAGGAATGCCAGCGTACATCTCGATT CTCGGTCTCCACCGTGATGAAAGGTATTGGCCGGAACCCGGCCTCTTTAA TCCCGAGAGATTTGCTCCAGAGCGCTTTAAGCACATTCACCCGATGACCT ACATACCTTTTGGAGCTGGCCCACATGGCTGTATTGGTAGTCGTCTGGGC GTTCTACAACTGAAACTGGGTATAGCCCACATTTTAAAACAATATTGGGT TGAGGTTTGTGAGCGAACAGTCTCAGAGATTCGCTTTAATCCAAAGTCCT TCATGTTGGAGTCTCAGGATGAGATTTACTTACGATTCTGCAGCAGTAAT TTG >C5 ATGCTGCTCATCTGGCTGCTCTTGCTCACCATTGTGTCGCTAAACTTTTG GTTGAGACACAAGTACGACTACTTTAGGAGCCGCGGGATTCCATTCTTGG CACCCTCCTTCTGGTCGCCAATGGGCAATCTGGGACAACTTCTATTCCTG CGTATTTCCTTCGGCGATCTCTTTCGGCAGCTCTACGCAGATCCCCAAAA TGGTGAGGCGAAGATCGTGGGCTTCTTCATCTTTCAAACGCCAGCCCTTA TGGTGCGAGATCCGGAGCTGATACGCCAGGTGTTGATTAAGAATTTCAAC CACTTCCTTAACCGATTCGAATCGGCGGACGCTGGTGATCCCATGGGCGC ACTGACGCTCCCGCTGGCTAAGTACCACCACTGGAAAGAGAGTCGGCAGT GCATGTCCCAGCTCTTCACCAGCGGCCGTATGCGGGATGTAATGTATCGC CAAATGTTGGATGTGGCTATGGACCTGGAGAATTACCTCCATAGGAAGCT GGGGGATCGGCTGGAGCGCGTTCTCCCATTGGGAAGAATGTGCCAGTTGT ATACCACCGACGTGACGGGTAATCTCTTCTATAGCCTAAATGTCGGCGGA TTGCGTCGTGGGCGGTCTGAGCTGCTTACGAAAACGAAGGAACTATTTAA CACCAATCCCCGCAAGGTTCTGGACTTCATGAGTGTATTCTTTCTGCCAA AGTGGACGAATCTGCTTAAGCCTAAAGTTTTTACCGAAGACTATGCGCGC TATATGAGGCACTTGGTGGAGGATCACCACGAGCCCTCGAAGGGAGATCT CATCAATCAATTGCAGCACTTTCAGTTAAGCCGCTCATCCAGCCACTATT CCCAACATCCGGATTTTGTAGCCTCCCAGGCAGGCATTATTCTGCTGGCC GGATTTGAAACCTCCTCGGCCCTGATGGGATTCACCCTCTATGAGCTGGC CAAGGCACCGGATATTCAAGACCGACTGAGGAGGGAGCTAAGGGACGCCT TCATCTCTTGTGCCACCCTAAGCTATGATGCATTGATGGATCTACCCTAC CTCAAAATGGTGTGCTTAGAGGCACTGCGTCTCTATCCGGCTGCAGCCTT CGTCAACAGGGAGTGCACCAGTCCGGCATCCGAGGGATTCTCTCTGCAGC CGCATGTGAATTTCGTAGTGCCACCAGGGATGCCAGCATACATCTCGATT CTTGGCCTCCATCGTGATGAAAGGTATTGGCCGGAACCCGACCTCTTTAA TCCCGAGCGATTCGCTCCAGAGCGGTCTAGGTACATTCACCCGATGACCT ACATACCATTTGGAGCTGGTCCACATGGCTGTATTGGTAGTCGTCTGGGC GTCCTCCAACTGAAACTGGGTATAGCTCACATTTTAAAACAATATTGGGT TGAGGCATGCGAGCGAACAGTGTCGGAGATTCGCTTTAATCCAAAGTCCT TCATGTTGGAGTCTCAGAATGAGATTTACTTAAGATTCTGCAGGAGCAGT TTG >C1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYAR YMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISI LGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLRFCRSS L >C2 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPAIMIRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLKRVLPLERMCQLYTTDVTGSLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKAKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHFLKQYWVETCERTVSEIRFNPKSFMLESQNEIYLRFCRSS L >C3 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAIDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTGLLKPKVFTEDYAR YMRHLVEDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQERLRRELREAFNSTATLSYDTLMTLPY LKMVCLEALRLYPAAAFVNRECTSSASAGFSLQPHVDFVIPPGMPAYISI LGLHRDERFWPEPCLFDPERFAPERSRHIHPMTYIPFGAGPHGCIGNRLG VLQLKLGIAHILKQYWVETCERTVSEIRFNPKSFMLESQDEIYLRFCRNS L >C4 MLLLWLLLLTIVSLNFWLRHKYDYFRSRGIPYLAPSSWSPMGNLGQLLFL RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRLVLIKNFN SFLNRYESADAGDPMGALTLPLAKYHQWKESRQCMSQLFTSGRMRDVMYG QMLNVAIDLENYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHKEPTKGDLINQLQHFQLSRSSNHYSQHPDFVSSQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELREVFNSSATLSYDTLMALPY LKMVCLEALRLYPAAAFVNRECTSSAPEGFTLQPHVDFVVPPGMPAYISI LGLHRDERYWPEPGLFNPERFAPERFKHIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEVCERTVSEIRFNPKSFMLESQDEIYLRFCSSN L >C5 MLLIWLLLLTIVSLNFWLRHKYDYFRSRGIPFLAPSFWSPMGNLGQLLFL RISFGDLFRQLYADPQNGEAKIVGFFIFQTPALMVRDPELIRQVLIKNFN HFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYR QMLDVAMDLENYLHRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG LRRGRSELLTKTKELFNTNPRKVLDFMSVFFLPKWTNLLKPKVFTEDYAR YMRHLVEDHHEPSKGDLINQLQHFQLSRSSSHYSQHPDFVASQAGIILLA GFETSSALMGFTLYELAKAPDIQDRLRRELRDAFISCATLSYDALMDLPY LKMVCLEALRLYPAAAFVNRECTSPASEGFSLQPHVNFVVPPGMPAYISI LGLHRDERYWPEPDLFNPERFAPERSRYIHPMTYIPFGAGPHGCIGSRLG VLQLKLGIAHILKQYWVEACERTVSEIRFNPKSFMLESQNEIYLRFCRSS L MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1503 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479138295 Setting output file names to "/opt/ADOPS/220/Cyp6t3-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1784435905 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 2691154854 Seed = 1373094600 Swapseed = 1479138295 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 38 unique site patterns Division 2 has 25 unique site patterns Division 3 has 78 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4039.208201 -- -25.624409 Chain 2 -- -4241.658036 -- -25.624409 Chain 3 -- -4258.007837 -- -25.624409 Chain 4 -- -4014.303253 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4258.007837 -- -25.624409 Chain 2 -- -4210.484707 -- -25.624409 Chain 3 -- -4218.392435 -- -25.624409 Chain 4 -- -4170.555562 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4039.208] (-4241.658) (-4258.008) (-4014.303) * [-4258.008] (-4210.485) (-4218.392) (-4170.556) 500 -- (-3610.068) (-3611.075) (-3607.591) [-3591.816] * (-3602.498) (-3610.259) (-3602.257) [-3613.223] -- 0:00:00 1000 -- (-3589.718) (-3612.241) [-3583.770] (-3572.955) * [-3577.563] (-3606.911) (-3580.390) (-3597.656) -- 0:00:00 1500 -- (-3574.507) (-3598.126) (-3570.812) [-3553.692] * (-3580.917) (-3595.446) [-3563.359] (-3586.205) -- 0:00:00 2000 -- (-3560.149) (-3594.431) (-3567.621) [-3551.275] * (-3575.138) (-3582.573) [-3548.130] (-3580.234) -- 0:00:00 2500 -- [-3557.980] (-3575.846) (-3557.058) (-3544.999) * (-3556.949) (-3575.109) [-3543.117] (-3564.221) -- 0:06:39 3000 -- [-3546.396] (-3560.699) (-3550.729) (-3546.738) * (-3549.769) (-3561.800) (-3549.792) [-3563.186] -- 0:05:32 3500 -- (-3541.946) [-3546.828] (-3547.783) (-3542.408) * (-3553.979) [-3553.366] (-3550.422) (-3557.144) -- 0:04:44 4000 -- (-3542.671) (-3551.728) [-3545.530] (-3541.970) * (-3551.741) [-3541.396] (-3547.973) (-3542.376) -- 0:04:09 4500 -- (-3540.206) (-3551.927) (-3547.887) [-3544.847] * (-3546.556) (-3547.350) (-3544.065) [-3544.742] -- 0:03:41 5000 -- (-3540.658) (-3555.874) [-3545.204] (-3543.814) * (-3549.086) [-3548.029] (-3548.895) (-3543.793) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- [-3542.436] (-3551.597) (-3542.219) (-3542.234) * (-3548.786) (-3542.743) [-3542.742] (-3541.263) -- 0:03:00 6000 -- (-3542.980) (-3549.688) [-3544.298] (-3540.253) * (-3543.521) (-3550.062) [-3544.219] (-3544.250) -- 0:05:31 6500 -- [-3541.104] (-3549.630) (-3551.626) (-3548.124) * (-3548.539) (-3553.209) [-3546.222] (-3544.019) -- 0:05:05 7000 -- (-3539.938) (-3555.739) [-3550.844] (-3539.277) * (-3545.628) [-3546.739] (-3549.292) (-3551.875) -- 0:04:43 7500 -- (-3543.639) [-3552.916] (-3542.103) (-3540.291) * (-3540.504) [-3541.100] (-3545.850) (-3546.891) -- 0:04:24 8000 -- [-3546.068] (-3544.566) (-3546.211) (-3541.881) * (-3544.863) (-3545.565) (-3546.975) [-3546.012] -- 0:04:08 8500 -- [-3545.681] (-3547.639) (-3546.944) (-3542.050) * (-3545.665) [-3546.547] (-3546.779) (-3543.081) -- 0:03:53 9000 -- (-3553.812) (-3548.062) [-3546.136] (-3544.049) * [-3542.015] (-3550.607) (-3542.165) (-3543.139) -- 0:03:40 9500 -- [-3546.176] (-3543.860) (-3550.336) (-3540.868) * [-3545.108] (-3545.615) (-3542.546) (-3544.418) -- 0:03:28 10000 -- (-3552.253) [-3543.590] (-3545.999) (-3543.174) * [-3546.553] (-3540.798) (-3544.148) (-3547.828) -- 0:04:57 Average standard deviation of split frequencies: 0.000000 10500 -- (-3539.745) (-3540.489) (-3543.052) [-3541.205] * (-3547.952) (-3551.341) (-3543.444) [-3544.606] -- 0:04:42 11000 -- (-3546.145) (-3539.010) (-3548.661) [-3545.705] * (-3557.850) (-3552.941) [-3540.822] (-3544.990) -- 0:04:29 11500 -- (-3549.764) (-3543.483) (-3541.593) [-3547.303] * (-3541.455) (-3551.371) (-3548.844) [-3544.286] -- 0:04:17 12000 -- (-3550.501) [-3541.760] (-3542.120) (-3552.782) * (-3543.396) (-3544.241) (-3546.864) [-3547.411] -- 0:04:07 12500 -- [-3545.759] (-3552.727) (-3541.990) (-3547.642) * (-3544.888) [-3549.344] (-3545.775) (-3544.377) -- 0:03:57 13000 -- (-3545.944) (-3543.914) (-3547.198) [-3543.394] * (-3540.547) [-3539.732] (-3553.240) (-3542.694) -- 0:03:47 13500 -- (-3549.082) (-3544.707) (-3542.106) [-3543.678] * (-3545.376) (-3544.729) (-3546.697) [-3541.636] -- 0:03:39 14000 -- (-3551.358) (-3543.347) (-3549.434) [-3547.584] * (-3545.653) [-3541.509] (-3544.991) (-3545.148) -- 0:04:41 14500 -- (-3542.005) (-3550.139) (-3548.864) [-3546.598] * [-3554.706] (-3542.472) (-3544.838) (-3555.014) -- 0:04:31 15000 -- [-3548.333] (-3543.070) (-3545.171) (-3542.837) * [-3545.786] (-3547.091) (-3544.005) (-3543.220) -- 0:04:22 Average standard deviation of split frequencies: 0.000000 15500 -- (-3545.659) [-3542.066] (-3546.888) (-3544.276) * [-3541.885] (-3547.894) (-3541.751) (-3545.312) -- 0:04:14 16000 -- (-3546.413) [-3551.833] (-3540.904) (-3542.403) * (-3540.904) (-3542.836) [-3543.373] (-3540.646) -- 0:04:06 16500 -- (-3546.496) (-3548.217) [-3551.130] (-3545.939) * (-3549.275) (-3545.175) (-3546.179) [-3542.654] -- 0:03:58 17000 -- (-3548.726) [-3541.488] (-3549.755) (-3549.043) * (-3550.597) (-3544.085) (-3549.550) [-3547.219] -- 0:03:51 17500 -- (-3547.316) [-3539.495] (-3555.216) (-3548.725) * (-3557.810) (-3545.672) (-3545.209) [-3550.006] -- 0:03:44 18000 -- (-3543.335) (-3543.548) [-3543.145] (-3544.095) * (-3545.854) (-3545.591) [-3543.078] (-3545.276) -- 0:04:32 18500 -- (-3550.215) (-3542.745) (-3544.576) [-3543.182] * [-3539.162] (-3551.933) (-3539.666) (-3546.033) -- 0:04:25 19000 -- (-3540.839) [-3545.216] (-3543.891) (-3542.353) * (-3548.196) (-3546.208) [-3545.561] (-3548.318) -- 0:04:18 19500 -- (-3542.788) [-3539.802] (-3547.248) (-3548.317) * (-3549.446) (-3543.125) [-3542.670] (-3556.573) -- 0:04:11 20000 -- (-3547.839) (-3542.467) [-3546.906] (-3558.224) * (-3544.387) [-3546.331] (-3549.264) (-3539.811) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 20500 -- (-3546.840) (-3546.740) (-3539.727) [-3547.745] * (-3544.737) (-3544.358) (-3547.059) [-3541.352] -- 0:03:58 21000 -- (-3539.913) (-3547.998) (-3543.041) [-3539.749] * (-3544.083) (-3543.351) [-3544.895] (-3545.929) -- 0:03:53 21500 -- (-3548.001) (-3545.129) [-3547.527] (-3542.943) * (-3541.539) [-3543.674] (-3547.753) (-3543.625) -- 0:04:33 22000 -- (-3547.464) (-3546.887) [-3545.469] (-3552.655) * (-3543.441) [-3539.868] (-3542.525) (-3551.274) -- 0:04:26 22500 -- (-3545.333) (-3544.410) [-3545.480] (-3546.190) * (-3542.332) [-3542.942] (-3546.418) (-3541.202) -- 0:04:20 23000 -- (-3543.087) (-3549.125) (-3542.830) [-3548.806] * [-3543.400] (-3548.378) (-3543.369) (-3540.461) -- 0:04:14 23500 -- (-3543.354) [-3541.315] (-3545.599) (-3556.257) * (-3546.862) (-3544.216) [-3542.824] (-3543.497) -- 0:04:09 24000 -- (-3544.962) [-3543.523] (-3543.814) (-3541.899) * [-3540.643] (-3543.182) (-3543.276) (-3546.183) -- 0:04:04 24500 -- [-3541.215] (-3545.181) (-3543.648) (-3549.152) * [-3549.446] (-3547.265) (-3544.397) (-3549.813) -- 0:03:58 25000 -- (-3538.887) (-3547.467) [-3540.796] (-3559.601) * (-3541.191) [-3543.188] (-3541.992) (-3551.403) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 25500 -- (-3544.737) (-3544.637) [-3542.150] (-3546.127) * (-3540.313) (-3541.847) (-3546.507) [-3546.451] -- 0:04:27 26000 -- [-3540.821] (-3543.658) (-3548.752) (-3543.423) * (-3546.060) [-3544.610] (-3542.235) (-3544.664) -- 0:04:22 26500 -- (-3543.718) (-3543.646) (-3548.607) [-3542.607] * (-3541.981) (-3542.712) [-3541.328] (-3552.707) -- 0:04:17 27000 -- [-3542.428] (-3542.788) (-3547.179) (-3548.652) * (-3542.456) (-3543.433) [-3542.649] (-3542.031) -- 0:04:12 27500 -- [-3541.626] (-3554.396) (-3549.627) (-3542.155) * (-3543.275) (-3539.007) (-3541.542) [-3546.458] -- 0:04:07 28000 -- (-3544.485) [-3550.791] (-3551.024) (-3544.268) * [-3549.987] (-3546.037) (-3544.062) (-3549.570) -- 0:04:03 28500 -- [-3541.581] (-3540.046) (-3553.127) (-3543.618) * [-3546.390] (-3551.504) (-3544.284) (-3546.920) -- 0:03:58 29000 -- (-3541.867) (-3543.414) (-3548.719) [-3544.219] * (-3545.077) [-3547.615] (-3543.669) (-3548.135) -- 0:04:27 29500 -- (-3542.439) (-3541.979) (-3543.471) [-3545.739] * (-3542.769) [-3547.835] (-3546.612) (-3546.738) -- 0:04:23 30000 -- (-3543.469) (-3545.559) [-3549.319] (-3545.048) * (-3544.299) (-3547.126) [-3542.287] (-3541.440) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 30500 -- (-3544.675) (-3546.576) [-3545.190] (-3547.478) * (-3544.916) (-3549.333) [-3540.566] (-3543.333) -- 0:04:14 31000 -- (-3544.702) (-3543.618) [-3545.305] (-3546.999) * (-3544.069) (-3552.027) (-3546.187) [-3543.002] -- 0:04:10 31500 -- [-3545.086] (-3544.301) (-3547.721) (-3551.832) * [-3538.186] (-3548.602) (-3542.393) (-3551.772) -- 0:04:05 32000 -- (-3546.147) [-3543.383] (-3550.551) (-3544.291) * [-3539.066] (-3547.471) (-3542.383) (-3546.031) -- 0:04:02 32500 -- (-3546.765) (-3552.791) [-3542.654] (-3551.828) * (-3544.304) (-3548.059) [-3546.941] (-3547.270) -- 0:03:58 33000 -- [-3541.582] (-3547.507) (-3539.768) (-3551.402) * (-3546.793) (-3541.909) (-3548.300) [-3543.866] -- 0:04:23 33500 -- (-3542.806) (-3557.469) [-3547.172] (-3552.578) * (-3546.462) [-3542.840] (-3542.393) (-3550.144) -- 0:04:19 34000 -- (-3552.248) (-3552.042) [-3548.492] (-3551.991) * (-3547.532) (-3549.937) (-3540.913) [-3547.711] -- 0:04:15 34500 -- (-3544.476) (-3544.765) (-3558.233) [-3549.669] * (-3549.989) (-3550.548) (-3546.682) [-3545.092] -- 0:04:11 35000 -- [-3544.615] (-3544.199) (-3550.441) (-3544.444) * [-3555.058] (-3541.704) (-3549.179) (-3546.902) -- 0:04:08 Average standard deviation of split frequencies: 0.000000 35500 -- [-3544.068] (-3545.561) (-3548.590) (-3543.098) * (-3548.398) [-3543.099] (-3540.609) (-3548.583) -- 0:04:04 36000 -- [-3543.535] (-3547.164) (-3546.662) (-3550.443) * [-3544.989] (-3549.536) (-3540.186) (-3550.626) -- 0:04:01 36500 -- (-3543.758) [-3546.665] (-3543.051) (-3551.171) * [-3547.446] (-3544.918) (-3543.190) (-3544.153) -- 0:03:57 37000 -- (-3541.571) [-3549.615] (-3543.647) (-3540.680) * [-3541.588] (-3547.192) (-3540.200) (-3543.168) -- 0:04:20 37500 -- (-3552.328) (-3548.767) [-3540.864] (-3542.141) * (-3543.196) (-3546.013) (-3542.657) [-3544.137] -- 0:04:16 38000 -- (-3544.401) (-3549.046) (-3545.651) [-3545.114] * (-3542.717) (-3544.078) [-3544.559] (-3544.063) -- 0:04:13 38500 -- [-3540.320] (-3546.611) (-3543.516) (-3548.340) * (-3545.007) [-3544.677] (-3548.738) (-3540.825) -- 0:04:09 39000 -- (-3546.382) (-3550.159) [-3540.381] (-3548.898) * (-3549.532) (-3549.941) [-3542.655] (-3539.883) -- 0:04:06 39500 -- (-3549.087) (-3546.634) (-3541.504) [-3543.848] * (-3540.750) (-3544.155) [-3543.848] (-3545.479) -- 0:04:03 40000 -- (-3546.484) (-3542.041) (-3551.217) [-3538.338] * (-3538.130) (-3547.267) (-3548.366) [-3542.339] -- 0:04:00 Average standard deviation of split frequencies: 0.000000 40500 -- [-3544.846] (-3540.875) (-3545.436) (-3544.107) * [-3541.766] (-3542.304) (-3546.352) (-3551.077) -- 0:03:56 41000 -- (-3542.531) [-3542.538] (-3544.339) (-3541.727) * (-3545.594) (-3545.099) [-3543.573] (-3544.894) -- 0:04:17 41500 -- [-3542.187] (-3546.450) (-3548.856) (-3553.689) * [-3543.309] (-3543.145) (-3546.328) (-3546.069) -- 0:04:14 42000 -- (-3547.054) (-3547.444) (-3547.197) [-3546.306] * (-3551.675) (-3540.850) [-3543.838] (-3545.748) -- 0:04:10 42500 -- [-3544.193] (-3548.803) (-3551.812) (-3548.891) * [-3542.695] (-3545.344) (-3541.018) (-3543.710) -- 0:04:07 43000 -- (-3542.880) (-3540.748) (-3542.647) [-3541.532] * (-3544.150) (-3552.796) (-3545.945) [-3540.679] -- 0:04:04 43500 -- [-3546.569] (-3542.785) (-3547.621) (-3542.306) * (-3551.352) (-3542.624) [-3548.322] (-3541.863) -- 0:04:01 44000 -- (-3548.064) [-3541.854] (-3551.900) (-3546.896) * (-3542.353) [-3539.128] (-3546.002) (-3543.511) -- 0:04:20 44500 -- [-3546.825] (-3542.815) (-3541.073) (-3541.705) * [-3544.185] (-3544.163) (-3543.387) (-3545.625) -- 0:04:17 45000 -- (-3548.719) (-3544.087) [-3551.221] (-3544.740) * (-3546.447) (-3546.289) [-3542.130] (-3546.654) -- 0:04:14 Average standard deviation of split frequencies: 0.000000 45500 -- (-3543.418) (-3544.579) (-3542.958) [-3547.747] * (-3552.984) (-3540.181) (-3547.246) [-3545.102] -- 0:04:11 46000 -- (-3546.572) [-3543.780] (-3541.416) (-3548.603) * [-3547.965] (-3544.367) (-3542.174) (-3547.896) -- 0:04:08 46500 -- (-3550.887) (-3543.330) (-3542.276) [-3548.582] * (-3542.849) [-3544.672] (-3552.803) (-3552.937) -- 0:04:06 47000 -- (-3544.740) (-3548.204) [-3540.609] (-3548.657) * (-3540.719) (-3546.082) [-3548.553] (-3543.252) -- 0:04:23 47500 -- [-3543.293] (-3543.224) (-3542.078) (-3540.964) * (-3549.590) [-3544.516] (-3546.247) (-3538.567) -- 0:04:20 48000 -- (-3545.333) (-3548.063) (-3539.145) [-3543.778] * [-3554.480] (-3550.443) (-3546.123) (-3541.084) -- 0:04:17 48500 -- [-3545.982] (-3545.094) (-3546.088) (-3543.311) * [-3552.707] (-3546.634) (-3545.685) (-3547.239) -- 0:04:15 49000 -- (-3548.451) (-3542.573) (-3543.193) [-3545.109] * (-3553.740) [-3542.822] (-3554.409) (-3543.947) -- 0:04:12 49500 -- [-3544.352] (-3542.696) (-3543.176) (-3548.538) * (-3550.035) (-3551.194) (-3546.289) [-3541.180] -- 0:04:09 50000 -- [-3549.521] (-3543.249) (-3541.077) (-3543.137) * (-3544.621) (-3542.572) [-3542.776] (-3546.969) -- 0:04:26 Average standard deviation of split frequencies: 0.000000 50500 -- [-3548.958] (-3545.854) (-3542.520) (-3543.680) * (-3549.640) (-3543.335) [-3541.256] (-3553.131) -- 0:04:23 51000 -- (-3543.507) (-3547.731) (-3540.687) [-3540.081] * (-3546.305) (-3542.880) [-3545.155] (-3543.412) -- 0:04:20 51500 -- [-3542.861] (-3542.313) (-3538.851) (-3545.098) * (-3541.850) [-3541.240] (-3547.598) (-3544.007) -- 0:04:17 52000 -- [-3542.292] (-3542.070) (-3540.444) (-3547.857) * (-3545.698) [-3543.043] (-3545.317) (-3542.575) -- 0:04:15 52500 -- (-3550.489) (-3545.492) (-3547.264) [-3547.106] * (-3550.317) (-3544.166) [-3543.427] (-3549.416) -- 0:04:12 53000 -- [-3547.871] (-3549.548) (-3547.789) (-3541.914) * [-3547.710] (-3544.112) (-3545.467) (-3541.228) -- 0:04:28 53500 -- (-3546.084) (-3545.998) (-3545.639) [-3539.096] * [-3541.527] (-3547.029) (-3542.036) (-3544.309) -- 0:04:25 54000 -- (-3547.757) (-3547.772) (-3542.893) [-3544.394] * (-3549.717) (-3542.760) [-3547.077] (-3544.314) -- 0:04:22 54500 -- (-3539.237) (-3545.562) (-3541.608) [-3542.275] * [-3543.356] (-3542.295) (-3543.219) (-3540.435) -- 0:04:20 55000 -- (-3544.105) [-3545.011] (-3545.890) (-3541.004) * (-3540.884) (-3541.668) [-3543.366] (-3544.608) -- 0:04:17 Average standard deviation of split frequencies: 0.000000 55500 -- [-3545.453] (-3546.128) (-3549.243) (-3544.978) * (-3546.456) (-3538.990) [-3549.159] (-3542.290) -- 0:04:15 56000 -- (-3540.267) (-3549.245) [-3550.859] (-3544.445) * [-3542.919] (-3545.220) (-3545.941) (-3543.961) -- 0:04:29 56500 -- (-3545.798) (-3543.943) (-3545.446) [-3543.946] * (-3547.518) (-3546.776) [-3544.038] (-3541.611) -- 0:04:27 57000 -- (-3543.628) [-3542.000] (-3540.685) (-3545.492) * (-3541.095) [-3549.634] (-3552.396) (-3549.387) -- 0:04:24 57500 -- (-3538.861) (-3541.845) [-3547.748] (-3547.618) * [-3541.325] (-3546.735) (-3546.292) (-3542.874) -- 0:04:22 58000 -- [-3543.960] (-3545.784) (-3547.464) (-3547.772) * (-3543.443) [-3543.171] (-3550.104) (-3542.595) -- 0:04:19 58500 -- (-3542.789) [-3549.163] (-3548.850) (-3547.900) * (-3538.502) (-3548.555) [-3543.463] (-3541.231) -- 0:04:17 59000 -- [-3544.929] (-3541.520) (-3546.044) (-3543.985) * (-3537.996) (-3546.256) [-3546.074] (-3542.058) -- 0:04:15 59500 -- (-3547.230) (-3542.118) (-3552.639) [-3548.454] * (-3546.664) (-3543.323) (-3545.715) [-3547.372] -- 0:04:28 60000 -- (-3545.525) (-3541.604) [-3548.491] (-3548.044) * (-3548.321) (-3543.875) (-3550.056) [-3543.068] -- 0:04:26 Average standard deviation of split frequencies: 0.000000 60500 -- (-3547.585) (-3540.842) [-3553.188] (-3541.375) * (-3539.180) (-3551.276) [-3540.377] (-3546.422) -- 0:04:23 61000 -- [-3546.646] (-3547.471) (-3545.089) (-3543.072) * (-3547.621) (-3540.810) [-3543.799] (-3552.907) -- 0:04:21 61500 -- (-3549.740) [-3541.378] (-3542.239) (-3546.065) * (-3548.267) (-3542.572) [-3546.230] (-3546.977) -- 0:04:19 62000 -- (-3542.161) (-3541.702) (-3536.766) [-3545.906] * (-3549.606) (-3548.245) (-3546.089) [-3542.837] -- 0:04:17 62500 -- (-3545.236) (-3544.389) [-3542.034] (-3550.264) * [-3544.267] (-3541.121) (-3541.579) (-3539.909) -- 0:04:15 63000 -- (-3543.026) (-3545.505) (-3549.700) [-3539.975] * (-3545.811) (-3545.612) [-3542.226] (-3545.193) -- 0:04:27 63500 -- (-3541.927) (-3544.059) (-3549.975) [-3542.039] * [-3541.198] (-3543.373) (-3542.933) (-3546.164) -- 0:04:25 64000 -- (-3553.793) (-3541.931) (-3544.935) [-3541.788] * (-3539.355) (-3540.819) (-3541.157) [-3543.149] -- 0:04:23 64500 -- (-3551.291) (-3545.639) [-3544.845] (-3554.119) * [-3541.330] (-3546.126) (-3552.616) (-3546.262) -- 0:04:21 65000 -- [-3546.754] (-3547.106) (-3551.970) (-3548.991) * (-3546.539) (-3545.466) (-3542.188) [-3546.492] -- 0:04:18 Average standard deviation of split frequencies: 0.000000 65500 -- [-3540.807] (-3547.537) (-3544.421) (-3547.202) * [-3549.188] (-3548.084) (-3553.337) (-3547.612) -- 0:04:16 66000 -- [-3539.430] (-3549.645) (-3542.600) (-3553.001) * (-3546.082) (-3547.258) [-3541.605] (-3543.349) -- 0:04:14 66500 -- (-3546.721) (-3549.113) [-3549.740] (-3539.310) * (-3541.299) (-3548.662) [-3540.957] (-3546.949) -- 0:04:26 67000 -- (-3548.798) [-3542.656] (-3543.968) (-3547.453) * [-3542.915] (-3546.961) (-3542.455) (-3546.616) -- 0:04:24 67500 -- [-3544.382] (-3545.792) (-3546.582) (-3547.700) * (-3539.048) [-3546.475] (-3547.555) (-3551.110) -- 0:04:22 68000 -- (-3551.382) [-3544.587] (-3546.071) (-3545.751) * (-3549.439) (-3544.822) (-3545.431) [-3541.577] -- 0:04:20 68500 -- (-3544.176) (-3543.217) [-3544.402] (-3549.455) * (-3543.132) [-3542.013] (-3540.445) (-3544.576) -- 0:04:18 69000 -- [-3540.057] (-3549.975) (-3543.308) (-3541.243) * (-3540.079) [-3543.992] (-3546.366) (-3545.844) -- 0:04:16 69500 -- (-3541.890) [-3539.436] (-3541.435) (-3541.294) * [-3542.975] (-3553.079) (-3543.120) (-3546.745) -- 0:04:14 70000 -- (-3545.998) (-3543.763) [-3539.835] (-3544.198) * (-3548.438) [-3543.673] (-3556.336) (-3541.264) -- 0:04:25 Average standard deviation of split frequencies: 0.000000 70500 -- (-3543.081) [-3541.106] (-3542.965) (-3549.599) * (-3543.651) [-3546.921] (-3546.418) (-3549.562) -- 0:04:23 71000 -- (-3541.962) [-3543.641] (-3546.252) (-3550.237) * (-3545.490) [-3548.875] (-3544.609) (-3544.558) -- 0:04:21 71500 -- (-3545.050) [-3545.880] (-3546.408) (-3544.644) * (-3544.851) (-3552.612) [-3544.034] (-3547.834) -- 0:04:19 72000 -- (-3545.958) (-3545.228) (-3545.557) [-3541.567] * (-3545.613) [-3549.037] (-3550.435) (-3553.623) -- 0:04:17 72500 -- [-3539.589] (-3542.709) (-3548.244) (-3548.406) * [-3544.607] (-3549.368) (-3544.606) (-3552.860) -- 0:04:15 73000 -- (-3540.815) (-3542.033) [-3542.025] (-3548.058) * [-3543.497] (-3544.392) (-3553.852) (-3543.810) -- 0:04:13 73500 -- (-3544.338) (-3545.530) [-3546.088] (-3552.515) * (-3545.313) (-3541.843) (-3548.595) [-3542.449] -- 0:04:12 74000 -- (-3545.327) [-3543.597] (-3547.868) (-3551.848) * (-3540.692) [-3543.749] (-3545.127) (-3550.173) -- 0:04:22 74500 -- (-3552.294) (-3545.616) (-3551.819) [-3545.821] * [-3543.140] (-3554.494) (-3548.569) (-3545.498) -- 0:04:20 75000 -- [-3543.488] (-3547.928) (-3553.429) (-3546.762) * (-3550.365) (-3546.527) [-3547.970] (-3545.119) -- 0:04:19 Average standard deviation of split frequencies: 0.000000 75500 -- [-3543.565] (-3547.719) (-3550.803) (-3543.778) * (-3548.857) (-3542.426) [-3541.388] (-3541.363) -- 0:04:17 76000 -- [-3548.105] (-3553.114) (-3544.176) (-3545.922) * (-3539.006) [-3542.141] (-3542.282) (-3542.916) -- 0:04:15 76500 -- (-3547.101) (-3546.782) (-3546.413) [-3546.304] * (-3539.572) (-3545.294) (-3546.603) [-3541.569] -- 0:04:13 77000 -- (-3549.625) (-3543.231) [-3545.368] (-3545.344) * [-3543.351] (-3548.363) (-3545.573) (-3540.932) -- 0:04:11 77500 -- (-3540.715) (-3551.020) (-3548.965) [-3546.425] * [-3542.267] (-3545.689) (-3542.006) (-3540.012) -- 0:04:09 78000 -- [-3541.520] (-3551.722) (-3545.214) (-3543.862) * (-3544.947) [-3540.096] (-3546.828) (-3545.965) -- 0:04:20 78500 -- [-3541.281] (-3540.516) (-3551.903) (-3541.630) * (-3546.323) [-3543.656] (-3545.758) (-3542.509) -- 0:04:18 79000 -- (-3546.187) (-3545.671) (-3542.084) [-3543.838] * (-3545.801) (-3545.896) (-3551.455) [-3539.558] -- 0:04:16 79500 -- (-3544.636) (-3548.214) (-3544.893) [-3545.894] * (-3552.684) [-3542.891] (-3549.077) (-3543.067) -- 0:04:14 80000 -- [-3542.530] (-3547.863) (-3548.686) (-3545.417) * (-3547.142) (-3542.399) (-3546.493) [-3547.127] -- 0:04:13 Average standard deviation of split frequencies: 0.000000 80500 -- (-3542.163) [-3545.346] (-3542.919) (-3541.907) * [-3554.047] (-3547.740) (-3544.459) (-3539.647) -- 0:04:11 81000 -- (-3538.853) [-3541.534] (-3543.414) (-3541.425) * (-3550.435) [-3543.184] (-3542.183) (-3546.452) -- 0:04:09 81500 -- (-3539.149) (-3554.232) (-3544.401) [-3542.386] * (-3553.940) (-3549.926) [-3544.377] (-3544.431) -- 0:04:19 82000 -- (-3552.624) (-3555.186) [-3545.678] (-3550.813) * (-3546.926) (-3551.124) [-3537.705] (-3542.531) -- 0:04:17 82500 -- (-3540.761) [-3545.837] (-3550.985) (-3541.347) * [-3547.331] (-3546.125) (-3549.105) (-3544.418) -- 0:04:15 83000 -- (-3549.666) [-3546.288] (-3543.002) (-3543.268) * (-3543.593) (-3551.889) (-3541.560) [-3543.581] -- 0:04:14 83500 -- (-3543.296) (-3543.905) (-3546.618) [-3547.820] * (-3545.178) (-3551.272) [-3539.638] (-3544.046) -- 0:04:12 84000 -- (-3547.456) [-3543.607] (-3545.522) (-3550.159) * (-3543.062) [-3544.627] (-3546.039) (-3545.328) -- 0:04:10 84500 -- (-3549.529) (-3546.361) [-3548.730] (-3544.294) * (-3546.942) (-3545.233) [-3541.752] (-3548.440) -- 0:04:09 85000 -- [-3543.277] (-3548.021) (-3545.832) (-3545.781) * [-3540.919] (-3550.441) (-3543.509) (-3541.884) -- 0:04:07 Average standard deviation of split frequencies: 0.000000 85500 -- [-3546.872] (-3550.758) (-3543.793) (-3549.540) * (-3541.680) [-3549.003] (-3543.085) (-3544.717) -- 0:04:16 86000 -- (-3549.296) (-3545.186) (-3545.006) [-3548.204] * (-3554.706) (-3553.263) (-3542.236) [-3546.677] -- 0:04:15 86500 -- (-3544.129) (-3547.002) [-3545.645] (-3542.909) * (-3546.524) (-3550.652) [-3540.621] (-3543.538) -- 0:04:13 87000 -- (-3545.683) (-3544.007) (-3542.286) [-3547.390] * (-3549.669) (-3546.797) (-3540.866) [-3543.334] -- 0:04:11 87500 -- (-3547.014) (-3541.643) (-3542.616) [-3541.442] * (-3541.410) (-3553.183) [-3541.352] (-3548.795) -- 0:04:10 88000 -- (-3542.107) (-3544.615) [-3541.062] (-3542.702) * (-3553.936) (-3543.726) [-3546.524] (-3542.499) -- 0:04:08 88500 -- (-3541.740) (-3546.967) [-3544.708] (-3545.906) * (-3542.401) (-3544.046) (-3547.885) [-3542.628] -- 0:04:07 89000 -- (-3547.526) (-3540.920) (-3542.589) [-3544.491] * (-3540.397) [-3542.247] (-3540.190) (-3544.402) -- 0:04:05 89500 -- [-3543.985] (-3549.556) (-3538.234) (-3543.092) * (-3546.720) (-3545.372) [-3540.342] (-3544.449) -- 0:04:14 90000 -- [-3543.785] (-3549.153) (-3547.643) (-3539.004) * (-3542.161) (-3549.686) [-3540.988] (-3542.110) -- 0:04:12 Average standard deviation of split frequencies: 0.000000 90500 -- (-3546.094) (-3543.162) (-3551.559) [-3546.587] * (-3542.507) [-3547.856] (-3541.961) (-3549.760) -- 0:04:11 91000 -- (-3550.052) (-3549.947) (-3558.619) [-3540.788] * (-3547.108) [-3547.725] (-3543.889) (-3547.593) -- 0:04:09 91500 -- (-3546.437) (-3545.397) (-3551.935) [-3541.475] * (-3546.535) (-3548.801) (-3541.051) [-3547.615] -- 0:04:08 92000 -- [-3546.092] (-3546.385) (-3549.483) (-3542.527) * (-3541.845) [-3548.542] (-3542.048) (-3554.676) -- 0:04:06 92500 -- [-3544.381] (-3552.062) (-3542.965) (-3544.090) * (-3543.550) (-3544.995) [-3544.561] (-3540.838) -- 0:04:05 93000 -- [-3538.888] (-3546.879) (-3543.224) (-3541.770) * (-3544.741) (-3545.146) (-3544.656) [-3538.836] -- 0:04:13 93500 -- (-3539.231) [-3547.798] (-3547.205) (-3546.653) * (-3541.288) (-3547.552) (-3551.072) [-3543.032] -- 0:04:12 94000 -- (-3548.389) [-3550.130] (-3551.440) (-3545.553) * (-3549.165) [-3544.899] (-3548.363) (-3544.701) -- 0:04:10 94500 -- (-3546.540) [-3543.217] (-3548.428) (-3540.655) * (-3544.546) (-3551.631) [-3543.767] (-3548.343) -- 0:04:09 95000 -- (-3557.149) [-3540.448] (-3545.227) (-3543.221) * (-3554.391) [-3549.684] (-3547.321) (-3545.432) -- 0:04:07 Average standard deviation of split frequencies: 0.000000 95500 -- [-3546.741] (-3542.943) (-3550.781) (-3545.768) * [-3542.465] (-3548.760) (-3542.297) (-3543.721) -- 0:04:06 96000 -- [-3550.124] (-3543.641) (-3545.211) (-3542.343) * (-3543.235) (-3541.890) (-3544.316) [-3539.910] -- 0:04:04 96500 -- (-3545.909) (-3544.103) [-3540.967] (-3550.904) * (-3547.407) (-3550.527) [-3543.610] (-3541.119) -- 0:04:03 97000 -- (-3542.234) (-3544.716) [-3547.801] (-3549.517) * (-3545.852) (-3544.920) (-3547.374) [-3541.921] -- 0:04:11 97500 -- (-3545.070) [-3541.616] (-3541.573) (-3545.409) * (-3540.103) (-3547.987) (-3553.120) [-3543.084] -- 0:04:09 98000 -- (-3545.844) (-3546.031) (-3539.486) [-3540.771] * [-3540.806] (-3540.363) (-3538.962) (-3541.141) -- 0:04:08 98500 -- (-3548.513) (-3549.501) (-3546.001) [-3543.543] * [-3544.766] (-3543.150) (-3539.392) (-3543.330) -- 0:04:07 99000 -- [-3546.393] (-3552.567) (-3550.988) (-3546.462) * (-3545.374) [-3542.004] (-3541.683) (-3544.348) -- 0:04:05 99500 -- (-3540.923) (-3548.145) [-3544.359] (-3540.258) * (-3544.476) (-3542.359) (-3543.048) [-3541.378] -- 0:04:04 100000 -- (-3548.930) [-3544.703] (-3543.815) (-3540.894) * (-3545.306) [-3545.439] (-3549.742) (-3542.115) -- 0:04:03 Average standard deviation of split frequencies: 0.000000 100500 -- [-3546.320] (-3543.044) (-3544.327) (-3543.683) * [-3549.233] (-3545.504) (-3552.697) (-3540.433) -- 0:04:01 101000 -- (-3546.745) [-3545.230] (-3541.285) (-3560.735) * (-3542.197) (-3545.164) (-3541.148) [-3542.775] -- 0:04:09 101500 -- (-3546.293) (-3544.142) [-3544.244] (-3554.667) * (-3547.632) (-3543.741) [-3541.438] (-3546.530) -- 0:04:07 102000 -- (-3554.842) (-3542.179) (-3538.998) [-3550.359] * (-3548.971) (-3540.355) (-3545.605) [-3541.385] -- 0:04:06 102500 -- (-3545.495) (-3543.710) (-3541.668) [-3548.145] * (-3555.443) (-3543.497) [-3538.395] (-3547.604) -- 0:04:05 103000 -- [-3547.247] (-3559.793) (-3546.676) (-3543.115) * [-3543.693] (-3549.186) (-3540.769) (-3542.375) -- 0:04:03 103500 -- [-3547.346] (-3549.703) (-3554.100) (-3540.147) * [-3541.771] (-3551.062) (-3540.332) (-3542.552) -- 0:04:02 104000 -- (-3542.522) (-3548.929) (-3545.092) [-3543.693] * [-3545.656] (-3545.320) (-3548.446) (-3558.599) -- 0:04:01 104500 -- [-3544.921] (-3547.570) (-3543.627) (-3551.267) * (-3549.042) (-3543.373) (-3541.205) [-3541.600] -- 0:03:59 105000 -- (-3543.391) [-3542.293] (-3540.892) (-3540.696) * (-3544.620) (-3545.391) (-3542.943) [-3543.956] -- 0:04:07 Average standard deviation of split frequencies: 0.000000 105500 -- (-3546.436) [-3539.719] (-3543.760) (-3539.891) * (-3543.031) (-3547.218) (-3550.629) [-3546.885] -- 0:04:05 106000 -- [-3540.734] (-3544.717) (-3544.818) (-3544.525) * [-3537.714] (-3546.688) (-3543.828) (-3541.140) -- 0:04:04 106500 -- (-3546.560) (-3549.026) (-3540.670) [-3540.083] * (-3541.725) [-3541.759] (-3539.301) (-3545.839) -- 0:04:03 107000 -- (-3543.249) (-3546.150) (-3545.698) [-3544.567] * (-3547.078) (-3550.376) [-3538.518] (-3543.683) -- 0:04:02 107500 -- (-3547.029) [-3544.500] (-3542.902) (-3547.535) * (-3547.828) (-3550.175) (-3550.853) [-3541.334] -- 0:04:00 108000 -- [-3542.448] (-3545.688) (-3551.484) (-3555.241) * (-3543.990) [-3546.364] (-3551.408) (-3542.125) -- 0:03:59 108500 -- [-3543.487] (-3546.366) (-3551.629) (-3549.349) * [-3548.422] (-3551.840) (-3541.233) (-3541.126) -- 0:04:06 109000 -- (-3545.594) [-3543.800] (-3550.230) (-3545.139) * (-3546.705) (-3547.472) (-3544.149) [-3546.042] -- 0:04:05 109500 -- (-3543.316) (-3548.524) [-3549.251] (-3551.550) * [-3545.785] (-3540.431) (-3544.225) (-3542.381) -- 0:04:03 110000 -- [-3542.873] (-3545.628) (-3548.985) (-3540.368) * (-3541.886) [-3541.741] (-3548.965) (-3541.882) -- 0:04:02 Average standard deviation of split frequencies: 0.000000 110500 -- (-3549.040) (-3547.111) [-3547.873] (-3544.158) * (-3551.381) (-3551.643) (-3548.675) [-3542.377] -- 0:04:01 111000 -- [-3543.687] (-3544.621) (-3549.007) (-3545.138) * (-3552.188) (-3550.362) [-3548.753] (-3546.484) -- 0:04:00 111500 -- (-3545.027) [-3544.394] (-3546.286) (-3548.295) * (-3556.751) [-3544.517] (-3547.628) (-3550.874) -- 0:03:59 112000 -- (-3547.329) (-3545.508) (-3545.456) [-3544.860] * (-3549.994) (-3548.296) (-3543.644) [-3544.831] -- 0:03:57 112500 -- (-3542.905) (-3549.411) [-3540.472] (-3554.796) * (-3549.536) [-3546.164] (-3543.291) (-3543.006) -- 0:04:04 113000 -- (-3542.754) (-3550.438) [-3541.811] (-3546.924) * (-3546.855) [-3543.165] (-3544.128) (-3548.891) -- 0:04:03 113500 -- [-3541.761] (-3551.779) (-3541.251) (-3549.990) * (-3546.649) (-3542.351) (-3543.070) [-3547.074] -- 0:04:02 114000 -- [-3540.312] (-3556.906) (-3542.345) (-3543.028) * (-3540.459) [-3542.901] (-3543.258) (-3540.922) -- 0:04:00 114500 -- (-3542.578) (-3548.117) (-3541.925) [-3541.028] * [-3541.120] (-3546.577) (-3544.196) (-3544.830) -- 0:03:59 115000 -- (-3545.832) (-3547.596) (-3543.018) [-3543.077] * (-3546.734) (-3542.127) (-3550.308) [-3541.715] -- 0:03:58 Average standard deviation of split frequencies: 0.000000 115500 -- (-3546.197) (-3542.753) [-3542.242] (-3545.798) * (-3541.996) [-3539.542] (-3545.341) (-3542.396) -- 0:03:57 116000 -- (-3546.237) (-3543.226) [-3542.607] (-3543.978) * [-3544.976] (-3549.080) (-3547.886) (-3545.476) -- 0:03:56 116500 -- (-3553.414) (-3545.086) (-3540.570) [-3543.577] * (-3546.501) [-3544.797] (-3545.236) (-3545.795) -- 0:04:02 117000 -- (-3546.323) (-3549.314) [-3543.626] (-3544.222) * (-3550.343) (-3539.002) (-3544.255) [-3544.397] -- 0:04:01 117500 -- (-3547.957) [-3541.797] (-3553.292) (-3548.446) * (-3542.189) (-3545.655) [-3541.814] (-3553.375) -- 0:04:00 118000 -- (-3545.483) [-3539.954] (-3550.914) (-3542.856) * (-3540.056) [-3540.247] (-3543.048) (-3551.947) -- 0:03:59 118500 -- [-3543.104] (-3542.371) (-3546.260) (-3544.242) * [-3545.254] (-3549.834) (-3542.968) (-3554.439) -- 0:03:58 119000 -- (-3543.543) [-3543.584] (-3549.694) (-3543.723) * (-3548.359) (-3543.460) (-3544.275) [-3540.672] -- 0:03:56 119500 -- (-3547.219) (-3546.661) (-3541.658) [-3546.579] * [-3543.559] (-3543.063) (-3542.723) (-3553.527) -- 0:03:55 120000 -- (-3545.889) (-3547.186) (-3540.733) [-3548.036] * [-3538.223] (-3542.705) (-3544.825) (-3551.844) -- 0:04:02 Average standard deviation of split frequencies: 0.000000 120500 -- (-3541.450) [-3543.236] (-3541.385) (-3540.538) * [-3541.924] (-3543.663) (-3541.578) (-3551.595) -- 0:04:00 121000 -- (-3546.989) (-3547.797) (-3539.499) [-3544.366] * [-3545.500] (-3546.442) (-3546.803) (-3546.070) -- 0:03:59 121500 -- [-3541.384] (-3543.913) (-3546.003) (-3548.722) * (-3546.901) [-3545.415] (-3548.637) (-3547.969) -- 0:03:58 122000 -- (-3547.363) (-3541.609) [-3543.515] (-3547.021) * (-3548.521) (-3544.414) [-3543.227] (-3548.038) -- 0:03:57 122500 -- (-3547.880) (-3543.444) (-3543.001) [-3541.135] * [-3554.813] (-3542.072) (-3542.175) (-3549.755) -- 0:03:56 123000 -- (-3546.755) [-3549.597] (-3542.535) (-3541.665) * (-3545.236) (-3540.135) [-3545.301] (-3544.925) -- 0:03:55 123500 -- [-3542.217] (-3545.982) (-3543.297) (-3540.889) * (-3543.403) [-3548.034] (-3544.256) (-3544.754) -- 0:03:54 124000 -- (-3548.096) (-3546.777) (-3538.560) [-3543.139] * [-3543.665] (-3549.844) (-3541.666) (-3552.354) -- 0:04:00 124500 -- (-3545.770) (-3542.999) [-3542.778] (-3549.977) * [-3539.520] (-3542.473) (-3546.446) (-3551.189) -- 0:03:59 125000 -- (-3541.380) (-3540.845) [-3543.012] (-3544.499) * (-3547.372) (-3542.337) [-3543.405] (-3547.223) -- 0:03:58 Average standard deviation of split frequencies: 0.000000 125500 -- [-3545.473] (-3548.321) (-3539.345) (-3541.784) * [-3541.812] (-3544.200) (-3542.260) (-3552.488) -- 0:03:56 126000 -- [-3544.738] (-3544.889) (-3546.790) (-3540.809) * (-3547.264) [-3540.030] (-3545.430) (-3547.621) -- 0:03:55 126500 -- [-3548.922] (-3550.093) (-3543.355) (-3544.888) * (-3548.452) [-3540.678] (-3546.090) (-3550.911) -- 0:03:54 127000 -- (-3549.802) (-3548.203) [-3543.175] (-3544.668) * [-3541.292] (-3541.960) (-3549.354) (-3546.703) -- 0:03:53 127500 -- (-3546.938) (-3545.726) [-3544.088] (-3542.327) * [-3545.570] (-3544.746) (-3542.480) (-3548.239) -- 0:03:59 128000 -- (-3549.989) [-3546.449] (-3546.812) (-3555.675) * (-3545.053) (-3543.455) [-3544.816] (-3542.498) -- 0:03:58 128500 -- [-3548.636] (-3546.506) (-3546.863) (-3548.019) * (-3545.296) (-3539.765) (-3543.974) [-3545.287] -- 0:03:57 129000 -- [-3544.657] (-3540.707) (-3553.069) (-3543.889) * (-3543.303) [-3542.607] (-3543.573) (-3543.548) -- 0:03:56 129500 -- (-3551.059) (-3545.431) (-3548.081) [-3541.554] * (-3550.373) [-3543.466] (-3542.836) (-3541.626) -- 0:03:55 130000 -- [-3549.529] (-3547.263) (-3545.231) (-3544.441) * (-3555.333) [-3545.579] (-3545.412) (-3544.155) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 130500 -- (-3542.919) [-3542.872] (-3548.471) (-3546.356) * [-3549.465] (-3548.317) (-3546.064) (-3546.956) -- 0:03:53 131000 -- [-3544.161] (-3547.546) (-3553.951) (-3554.127) * (-3549.170) (-3543.946) (-3543.823) [-3547.436] -- 0:03:58 131500 -- [-3540.157] (-3549.520) (-3543.062) (-3546.446) * (-3545.888) [-3541.526] (-3547.769) (-3551.991) -- 0:03:57 132000 -- (-3545.834) (-3547.253) [-3543.819] (-3542.762) * (-3545.108) [-3539.980] (-3543.394) (-3544.435) -- 0:03:56 132500 -- (-3548.142) (-3548.997) (-3537.446) [-3540.260] * (-3551.199) (-3538.308) (-3546.102) [-3545.367] -- 0:03:55 133000 -- (-3546.277) (-3549.146) (-3545.542) [-3539.514] * (-3543.740) [-3544.142] (-3554.245) (-3545.273) -- 0:03:54 133500 -- [-3547.924] (-3547.391) (-3548.940) (-3543.108) * (-3545.022) (-3544.286) (-3553.155) [-3541.185] -- 0:03:53 134000 -- (-3548.967) (-3542.505) (-3542.388) [-3538.785] * (-3544.094) [-3539.272] (-3548.259) (-3544.172) -- 0:03:59 134500 -- (-3544.968) (-3543.398) [-3547.470] (-3544.594) * (-3548.250) (-3541.340) (-3547.641) [-3539.693] -- 0:03:58 135000 -- (-3545.958) (-3547.146) (-3546.476) [-3549.453] * (-3545.926) (-3546.120) (-3553.786) [-3545.962] -- 0:03:57 Average standard deviation of split frequencies: 0.000000 135500 -- [-3541.536] (-3549.578) (-3548.696) (-3556.499) * (-3551.507) [-3545.794] (-3556.978) (-3541.647) -- 0:03:56 136000 -- [-3542.555] (-3543.409) (-3543.811) (-3544.364) * (-3544.491) (-3543.309) (-3545.912) [-3544.057] -- 0:03:55 136500 -- (-3542.943) (-3547.131) (-3548.846) [-3545.455] * (-3545.010) [-3543.685] (-3547.502) (-3541.250) -- 0:03:54 137000 -- (-3541.260) (-3550.010) [-3543.641] (-3540.504) * (-3548.916) [-3540.590] (-3548.151) (-3549.132) -- 0:03:53 137500 -- (-3548.356) (-3547.117) (-3557.979) [-3539.823] * (-3546.378) (-3549.500) [-3545.774] (-3544.150) -- 0:03:58 138000 -- [-3545.609] (-3540.012) (-3545.490) (-3542.810) * [-3543.942] (-3540.691) (-3542.023) (-3545.818) -- 0:03:57 138500 -- (-3549.033) (-3549.389) (-3540.351) [-3541.632] * (-3544.752) [-3541.958] (-3547.953) (-3549.949) -- 0:03:56 139000 -- (-3544.550) [-3548.649] (-3546.109) (-3544.291) * (-3538.250) (-3543.413) (-3546.493) [-3544.483] -- 0:03:55 139500 -- (-3540.611) [-3543.727] (-3545.448) (-3545.712) * (-3545.698) [-3544.877] (-3547.378) (-3541.708) -- 0:03:54 140000 -- [-3546.345] (-3540.084) (-3538.184) (-3545.029) * (-3539.878) [-3543.889] (-3545.037) (-3545.159) -- 0:03:53 Average standard deviation of split frequencies: 0.000000 140500 -- (-3541.100) [-3546.433] (-3541.174) (-3538.478) * [-3541.028] (-3548.035) (-3543.797) (-3551.141) -- 0:03:58 141000 -- (-3548.769) [-3544.608] (-3542.608) (-3543.044) * (-3549.881) [-3544.249] (-3547.220) (-3545.913) -- 0:03:57 141500 -- (-3549.876) (-3544.768) [-3547.519] (-3548.670) * (-3544.570) (-3547.060) (-3546.246) [-3541.233] -- 0:03:56 142000 -- [-3547.612] (-3544.747) (-3547.032) (-3549.942) * [-3541.946] (-3544.497) (-3550.605) (-3545.490) -- 0:03:55 142500 -- [-3542.197] (-3544.196) (-3552.355) (-3544.045) * (-3546.021) (-3547.852) (-3545.111) [-3545.413] -- 0:03:54 143000 -- [-3543.554] (-3543.356) (-3547.511) (-3547.843) * (-3542.173) [-3544.928] (-3546.453) (-3544.973) -- 0:03:53 143500 -- [-3539.442] (-3547.222) (-3545.449) (-3545.580) * (-3553.502) [-3540.026] (-3546.217) (-3546.888) -- 0:03:52 144000 -- [-3547.356] (-3545.214) (-3551.125) (-3546.751) * (-3545.286) (-3549.239) [-3545.643] (-3549.518) -- 0:03:57 144500 -- (-3542.423) (-3545.107) (-3542.920) [-3540.597] * [-3550.778] (-3548.133) (-3541.726) (-3546.185) -- 0:03:56 145000 -- (-3543.042) (-3548.031) [-3543.973] (-3543.819) * [-3546.014] (-3549.766) (-3547.286) (-3547.106) -- 0:03:55 Average standard deviation of split frequencies: 0.000000 145500 -- (-3547.078) [-3545.370] (-3547.714) (-3543.029) * (-3541.808) (-3547.626) [-3543.728] (-3539.526) -- 0:03:54 146000 -- (-3556.266) (-3549.386) [-3542.921] (-3548.917) * (-3544.672) (-3549.880) [-3547.385] (-3539.847) -- 0:03:53 146500 -- (-3552.621) (-3546.354) (-3543.389) [-3544.601] * [-3543.233] (-3544.719) (-3545.163) (-3539.051) -- 0:03:53 147000 -- [-3548.102] (-3543.776) (-3549.910) (-3545.778) * [-3542.459] (-3540.931) (-3546.612) (-3539.583) -- 0:03:52 147500 -- (-3543.978) [-3545.778] (-3545.560) (-3550.601) * (-3551.715) [-3547.360] (-3547.477) (-3543.901) -- 0:03:56 148000 -- (-3546.166) (-3544.780) [-3542.362] (-3543.070) * (-3541.184) (-3544.846) (-3543.248) [-3545.587] -- 0:03:56 148500 -- (-3544.493) [-3546.132] (-3543.778) (-3546.840) * (-3543.322) (-3545.855) (-3546.083) [-3547.514] -- 0:03:55 149000 -- (-3547.607) (-3543.451) [-3545.364] (-3544.981) * (-3541.056) (-3544.682) (-3548.947) [-3545.214] -- 0:03:54 149500 -- (-3547.020) [-3540.829] (-3550.278) (-3541.902) * [-3544.547] (-3545.146) (-3548.182) (-3548.885) -- 0:03:53 150000 -- (-3546.842) (-3544.493) [-3544.969] (-3546.865) * (-3545.260) [-3545.175] (-3552.767) (-3542.681) -- 0:03:52 Average standard deviation of split frequencies: 0.000000 150500 -- (-3545.679) [-3541.677] (-3543.651) (-3547.114) * [-3540.887] (-3542.988) (-3543.462) (-3542.894) -- 0:03:51 151000 -- (-3545.142) (-3542.901) [-3544.304] (-3542.960) * [-3546.377] (-3541.429) (-3547.269) (-3546.222) -- 0:03:50 151500 -- (-3554.014) [-3541.353] (-3550.976) (-3543.311) * (-3542.661) [-3542.689] (-3545.270) (-3548.333) -- 0:03:55 152000 -- (-3545.161) (-3547.322) [-3553.241] (-3542.459) * [-3544.960] (-3549.966) (-3544.532) (-3544.291) -- 0:03:54 152500 -- [-3551.536] (-3541.920) (-3548.277) (-3550.095) * (-3541.124) (-3544.421) [-3544.129] (-3543.233) -- 0:03:53 153000 -- (-3539.641) (-3543.042) [-3547.617] (-3546.837) * (-3546.832) (-3543.611) [-3547.484] (-3538.174) -- 0:03:52 153500 -- [-3544.577] (-3548.289) (-3550.342) (-3546.174) * (-3543.401) [-3543.487] (-3543.061) (-3544.277) -- 0:03:51 154000 -- [-3548.286] (-3551.124) (-3549.468) (-3543.925) * [-3544.346] (-3551.502) (-3545.754) (-3543.144) -- 0:03:50 154500 -- [-3543.648] (-3551.684) (-3541.188) (-3541.720) * [-3547.904] (-3544.993) (-3544.963) (-3547.370) -- 0:03:49 155000 -- (-3548.037) (-3558.489) [-3542.507] (-3550.251) * [-3545.270] (-3554.626) (-3547.860) (-3553.089) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 155500 -- (-3542.840) (-3549.399) [-3542.570] (-3552.239) * (-3548.604) [-3545.454] (-3549.826) (-3550.460) -- 0:03:53 156000 -- (-3550.997) (-3542.867) (-3550.785) [-3541.565] * [-3542.288] (-3545.697) (-3548.423) (-3546.192) -- 0:03:52 156500 -- [-3548.762] (-3543.990) (-3553.120) (-3544.391) * (-3544.735) (-3547.590) (-3546.950) [-3542.387] -- 0:03:51 157000 -- (-3549.874) (-3547.506) (-3546.257) [-3541.009] * (-3544.123) (-3541.095) [-3545.137] (-3541.153) -- 0:03:50 157500 -- [-3544.349] (-3548.022) (-3550.387) (-3551.879) * (-3548.272) [-3546.216] (-3548.319) (-3544.187) -- 0:03:50 158000 -- [-3546.638] (-3550.930) (-3541.138) (-3559.237) * (-3546.336) (-3544.757) (-3549.942) [-3545.739] -- 0:03:49 158500 -- [-3543.842] (-3549.085) (-3550.769) (-3554.483) * (-3547.999) (-3546.793) (-3549.468) [-3548.296] -- 0:03:48 159000 -- (-3547.621) [-3547.825] (-3546.798) (-3548.633) * [-3541.453] (-3553.919) (-3541.864) (-3549.507) -- 0:03:52 159500 -- (-3550.998) (-3547.157) [-3542.193] (-3551.327) * (-3541.182) (-3546.666) (-3551.388) [-3548.593] -- 0:03:51 160000 -- (-3549.359) (-3552.926) [-3544.025] (-3557.275) * (-3545.748) (-3543.991) (-3544.263) [-3545.211] -- 0:03:51 Average standard deviation of split frequencies: 0.000000 160500 -- (-3546.053) (-3543.078) [-3544.785] (-3551.632) * (-3541.858) [-3543.122] (-3542.551) (-3546.257) -- 0:03:50 161000 -- (-3546.767) [-3544.574] (-3543.425) (-3549.514) * [-3547.290] (-3547.979) (-3551.923) (-3546.701) -- 0:03:49 161500 -- (-3549.867) (-3546.858) (-3543.692) [-3542.107] * (-3544.575) (-3546.254) [-3539.967] (-3547.417) -- 0:03:48 162000 -- (-3542.611) (-3543.182) (-3541.889) [-3539.755] * (-3549.446) [-3539.114] (-3544.753) (-3542.586) -- 0:03:47 162500 -- (-3545.025) (-3546.883) (-3543.142) [-3543.948] * (-3547.786) (-3543.921) [-3547.161] (-3545.669) -- 0:03:46 163000 -- [-3540.597] (-3547.767) (-3546.008) (-3544.224) * (-3543.486) (-3538.426) (-3544.438) [-3547.266] -- 0:03:51 163500 -- (-3546.754) (-3545.709) [-3545.407] (-3540.995) * [-3545.869] (-3547.615) (-3541.143) (-3549.028) -- 0:03:50 164000 -- (-3542.958) (-3543.558) [-3544.083] (-3552.705) * (-3549.645) (-3543.575) (-3545.067) [-3540.827] -- 0:03:49 164500 -- [-3543.516] (-3541.798) (-3549.684) (-3541.811) * (-3545.848) (-3546.981) [-3544.894] (-3540.257) -- 0:03:48 165000 -- (-3546.351) (-3544.501) (-3544.958) [-3544.021] * [-3546.648] (-3549.288) (-3542.915) (-3546.395) -- 0:03:47 Average standard deviation of split frequencies: 0.000000 165500 -- (-3549.835) (-3551.670) [-3543.395] (-3545.293) * [-3544.172] (-3551.253) (-3549.436) (-3555.468) -- 0:03:46 166000 -- (-3556.473) (-3549.779) [-3545.165] (-3551.327) * (-3546.784) (-3548.785) [-3552.922] (-3548.594) -- 0:03:46 166500 -- (-3543.856) (-3546.279) (-3550.834) [-3543.660] * (-3542.787) (-3549.866) (-3549.898) [-3545.089] -- 0:03:45 167000 -- (-3545.889) (-3550.409) [-3550.806] (-3545.604) * (-3538.818) [-3543.935] (-3550.583) (-3548.577) -- 0:03:49 167500 -- (-3544.088) [-3547.777] (-3542.649) (-3547.098) * [-3539.457] (-3541.140) (-3540.204) (-3551.895) -- 0:03:48 168000 -- (-3546.152) (-3562.425) [-3541.252] (-3539.810) * (-3543.110) [-3545.296] (-3542.645) (-3549.441) -- 0:03:47 168500 -- (-3544.186) (-3548.681) (-3550.299) [-3535.816] * (-3539.616) (-3548.272) (-3542.699) [-3542.581] -- 0:03:46 169000 -- [-3547.114] (-3543.451) (-3546.774) (-3546.101) * (-3543.091) (-3547.792) [-3542.228] (-3553.075) -- 0:03:46 169500 -- (-3554.110) [-3541.354] (-3543.801) (-3547.919) * (-3546.055) [-3546.443] (-3543.948) (-3544.897) -- 0:03:45 170000 -- [-3543.377] (-3546.010) (-3545.961) (-3541.528) * [-3546.490] (-3541.909) (-3545.439) (-3543.037) -- 0:03:44 Average standard deviation of split frequencies: 0.000000 170500 -- (-3544.463) (-3544.475) [-3542.441] (-3553.199) * (-3540.105) [-3542.056] (-3549.234) (-3541.986) -- 0:03:48 171000 -- (-3548.933) (-3546.750) [-3545.377] (-3545.061) * [-3540.346] (-3544.176) (-3543.765) (-3541.691) -- 0:03:47 171500 -- (-3548.065) (-3545.441) (-3542.350) [-3542.401] * (-3540.892) [-3544.201] (-3545.847) (-3547.307) -- 0:03:47 172000 -- [-3546.299] (-3547.753) (-3540.871) (-3542.824) * (-3550.450) [-3548.398] (-3549.423) (-3542.965) -- 0:03:46 172500 -- (-3543.932) (-3543.993) (-3546.703) [-3544.438] * (-3541.496) (-3542.273) (-3543.683) [-3538.767] -- 0:03:45 173000 -- [-3543.065] (-3541.686) (-3547.512) (-3556.681) * [-3552.690] (-3552.641) (-3539.974) (-3546.203) -- 0:03:44 173500 -- (-3542.109) (-3556.381) (-3551.894) [-3544.906] * [-3537.878] (-3549.173) (-3545.425) (-3547.487) -- 0:03:43 174000 -- [-3549.558] (-3547.238) (-3553.406) (-3551.075) * (-3548.758) [-3540.487] (-3544.814) (-3543.605) -- 0:03:43 174500 -- [-3548.141] (-3542.039) (-3547.358) (-3545.988) * (-3546.908) (-3546.266) [-3542.689] (-3542.417) -- 0:03:47 175000 -- (-3549.959) (-3541.848) (-3553.103) [-3540.356] * [-3544.164] (-3546.800) (-3545.877) (-3547.393) -- 0:03:46 Average standard deviation of split frequencies: 0.000000 175500 -- [-3542.626] (-3547.168) (-3557.557) (-3542.874) * (-3546.505) [-3546.804] (-3545.081) (-3548.180) -- 0:03:45 176000 -- (-3541.548) (-3545.796) (-3550.840) [-3540.859] * [-3544.562] (-3545.721) (-3545.705) (-3543.943) -- 0:03:44 176500 -- [-3543.698] (-3551.837) (-3544.019) (-3544.897) * [-3541.943] (-3544.752) (-3545.296) (-3547.460) -- 0:03:43 177000 -- (-3543.930) (-3546.884) (-3549.152) [-3542.356] * (-3542.024) [-3547.120] (-3542.362) (-3545.326) -- 0:03:43 177500 -- (-3542.685) (-3543.796) [-3545.366] (-3547.344) * (-3551.582) (-3553.478) (-3546.092) [-3542.272] -- 0:03:42 178000 -- (-3541.394) (-3542.136) [-3544.047] (-3547.840) * (-3539.818) (-3544.532) [-3546.951] (-3546.781) -- 0:03:41 178500 -- (-3546.749) (-3545.785) [-3542.206] (-3550.199) * (-3546.876) (-3544.652) [-3546.144] (-3549.060) -- 0:03:45 179000 -- (-3543.836) (-3544.236) [-3546.232] (-3548.241) * [-3541.651] (-3546.419) (-3540.487) (-3546.062) -- 0:03:44 179500 -- (-3540.783) (-3550.421) (-3546.021) [-3548.391] * [-3546.553] (-3545.126) (-3542.818) (-3539.455) -- 0:03:43 180000 -- [-3540.791] (-3548.533) (-3541.701) (-3541.749) * (-3541.246) (-3561.065) [-3538.913] (-3544.294) -- 0:03:43 Average standard deviation of split frequencies: 0.000000 180500 -- (-3547.518) (-3544.269) (-3541.506) [-3542.619] * (-3541.279) (-3551.756) (-3541.144) [-3550.476] -- 0:03:42 181000 -- (-3544.944) (-3542.627) (-3544.360) [-3545.901] * (-3540.837) [-3548.814] (-3549.454) (-3549.378) -- 0:03:41 181500 -- (-3551.107) (-3540.716) (-3546.070) [-3550.105] * (-3543.484) (-3546.498) [-3545.428] (-3545.717) -- 0:03:40 182000 -- (-3545.431) [-3540.344] (-3544.335) (-3551.101) * [-3549.713] (-3540.603) (-3544.403) (-3550.064) -- 0:03:44 182500 -- [-3542.202] (-3543.138) (-3540.868) (-3546.316) * (-3551.619) [-3543.299] (-3542.788) (-3549.095) -- 0:03:43 183000 -- (-3546.427) (-3547.234) (-3546.335) [-3544.985] * (-3548.568) (-3547.402) (-3545.243) [-3544.997] -- 0:03:43 183500 -- (-3544.351) (-3541.854) (-3547.139) [-3547.421] * (-3549.985) (-3552.510) [-3541.494] (-3549.902) -- 0:03:42 184000 -- (-3544.881) (-3548.253) (-3545.116) [-3540.895] * (-3551.833) (-3546.409) (-3545.033) [-3540.871] -- 0:03:41 184500 -- (-3547.005) [-3542.489] (-3549.414) (-3546.562) * (-3551.915) (-3547.813) [-3541.812] (-3547.892) -- 0:03:41 185000 -- (-3550.925) [-3542.489] (-3546.243) (-3545.230) * (-3547.434) [-3542.831] (-3543.410) (-3547.022) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 185500 -- (-3544.231) (-3548.133) [-3551.253] (-3546.046) * (-3545.360) (-3542.855) (-3544.349) [-3540.634] -- 0:03:39 186000 -- (-3546.744) [-3541.457] (-3549.759) (-3541.890) * [-3541.182] (-3543.246) (-3545.589) (-3544.016) -- 0:03:43 186500 -- (-3555.957) [-3546.215] (-3550.289) (-3541.517) * (-3549.675) (-3542.782) [-3544.700] (-3541.991) -- 0:03:42 187000 -- [-3543.876] (-3543.766) (-3548.873) (-3545.643) * (-3551.292) (-3549.332) [-3544.828] (-3542.914) -- 0:03:41 187500 -- (-3544.885) (-3544.436) [-3548.192] (-3543.318) * (-3545.115) [-3548.051] (-3547.678) (-3543.960) -- 0:03:41 188000 -- (-3544.542) [-3542.694] (-3551.577) (-3546.973) * (-3546.970) [-3544.241] (-3547.887) (-3551.134) -- 0:03:40 188500 -- (-3543.270) (-3551.515) (-3544.044) [-3545.027] * [-3544.621] (-3551.992) (-3543.136) (-3549.493) -- 0:03:39 189000 -- [-3539.720] (-3550.591) (-3548.532) (-3547.423) * (-3540.516) (-3551.063) [-3545.286] (-3544.980) -- 0:03:38 189500 -- (-3541.261) [-3545.540] (-3550.274) (-3552.132) * (-3545.798) (-3544.410) [-3538.855] (-3548.018) -- 0:03:38 190000 -- [-3545.706] (-3547.223) (-3549.515) (-3545.584) * (-3540.435) [-3547.397] (-3545.614) (-3540.383) -- 0:03:41 Average standard deviation of split frequencies: 0.000000 190500 -- [-3538.350] (-3547.332) (-3544.084) (-3544.010) * (-3542.033) (-3551.320) [-3544.503] (-3542.578) -- 0:03:40 191000 -- (-3543.508) (-3544.462) (-3543.350) [-3546.260] * [-3546.357] (-3544.119) (-3544.294) (-3543.466) -- 0:03:40 191500 -- (-3541.206) (-3542.690) [-3544.230] (-3552.718) * (-3541.966) (-3543.038) (-3542.671) [-3546.172] -- 0:03:39 192000 -- (-3542.669) [-3547.957] (-3546.735) (-3546.673) * (-3545.053) (-3546.268) (-3546.699) [-3544.269] -- 0:03:38 192500 -- [-3543.785] (-3545.145) (-3548.225) (-3543.301) * (-3544.567) (-3542.122) (-3541.809) [-3546.107] -- 0:03:38 193000 -- (-3549.408) (-3546.920) (-3550.205) [-3539.134] * (-3543.436) (-3547.870) [-3546.761] (-3546.753) -- 0:03:37 193500 -- (-3558.790) (-3547.782) [-3546.196] (-3539.613) * (-3545.022) [-3546.212] (-3541.634) (-3544.853) -- 0:03:36 194000 -- (-3546.685) (-3544.456) (-3544.915) [-3550.500] * (-3549.506) (-3549.817) [-3544.102] (-3547.652) -- 0:03:40 194500 -- [-3545.984] (-3549.336) (-3552.200) (-3547.079) * (-3548.633) [-3544.118] (-3550.443) (-3546.697) -- 0:03:39 195000 -- (-3540.068) (-3542.661) (-3544.560) [-3544.549] * (-3542.057) (-3555.786) (-3546.081) [-3541.454] -- 0:03:38 Average standard deviation of split frequencies: 0.000000 195500 -- (-3542.711) (-3544.568) (-3543.551) [-3545.383] * (-3544.287) (-3541.170) [-3544.990] (-3548.591) -- 0:03:38 196000 -- (-3547.903) (-3546.510) [-3544.554] (-3545.778) * [-3548.282] (-3546.433) (-3551.054) (-3549.231) -- 0:03:37 196500 -- [-3541.685] (-3547.962) (-3544.508) (-3542.759) * (-3553.620) (-3546.608) [-3542.926] (-3546.521) -- 0:03:36 197000 -- (-3547.392) [-3550.395] (-3544.778) (-3545.963) * [-3542.624] (-3541.362) (-3539.579) (-3550.081) -- 0:03:36 197500 -- (-3548.156) (-3551.561) [-3542.910] (-3544.272) * [-3547.308] (-3543.490) (-3545.269) (-3546.517) -- 0:03:35 198000 -- (-3547.318) (-3545.514) [-3543.850] (-3545.087) * (-3545.281) (-3544.414) (-3548.291) [-3546.146] -- 0:03:38 198500 -- (-3542.473) (-3546.637) [-3551.004] (-3546.742) * (-3548.770) [-3539.047] (-3550.084) (-3543.142) -- 0:03:38 199000 -- [-3545.256] (-3545.884) (-3546.067) (-3546.446) * (-3544.428) (-3538.337) (-3545.879) [-3552.910] -- 0:03:37 199500 -- (-3542.190) (-3541.110) [-3547.682] (-3549.443) * (-3544.558) [-3549.458] (-3546.381) (-3546.886) -- 0:03:36 200000 -- [-3551.781] (-3547.546) (-3544.808) (-3545.842) * (-3545.387) (-3547.977) (-3544.281) [-3545.045] -- 0:03:36 Average standard deviation of split frequencies: 0.000000 200500 -- [-3541.706] (-3550.818) (-3544.476) (-3551.380) * (-3543.084) [-3540.041] (-3543.503) (-3541.905) -- 0:03:35 201000 -- (-3545.665) (-3543.625) [-3539.465] (-3545.569) * (-3544.035) [-3541.715] (-3549.224) (-3550.314) -- 0:03:34 201500 -- [-3544.306] (-3546.434) (-3547.147) (-3543.195) * [-3542.585] (-3546.124) (-3539.801) (-3545.641) -- 0:03:37 202000 -- (-3545.256) (-3549.009) [-3539.364] (-3544.278) * (-3547.473) (-3542.934) (-3543.724) [-3541.664] -- 0:03:37 202500 -- (-3548.409) (-3551.323) (-3554.403) [-3543.386] * (-3542.118) (-3545.634) (-3540.911) [-3542.184] -- 0:03:36 203000 -- [-3542.863] (-3546.533) (-3542.279) (-3543.981) * (-3550.435) [-3544.502] (-3543.990) (-3546.144) -- 0:03:35 203500 -- [-3543.046] (-3547.372) (-3543.666) (-3554.353) * (-3547.771) [-3542.207] (-3542.294) (-3549.381) -- 0:03:35 204000 -- [-3546.088] (-3546.430) (-3546.847) (-3544.538) * [-3538.968] (-3546.459) (-3547.787) (-3549.544) -- 0:03:34 204500 -- (-3548.699) (-3545.737) [-3542.080] (-3544.518) * [-3544.091] (-3546.595) (-3542.897) (-3546.538) -- 0:03:33 205000 -- (-3542.846) [-3547.824] (-3537.882) (-3540.864) * (-3540.310) (-3547.164) [-3545.123] (-3551.875) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 205500 -- (-3557.009) (-3539.038) (-3542.393) [-3541.884] * (-3546.811) (-3546.906) [-3542.982] (-3548.605) -- 0:03:36 206000 -- [-3543.051] (-3544.027) (-3545.609) (-3541.594) * (-3538.793) (-3544.706) (-3549.871) [-3549.795] -- 0:03:35 206500 -- [-3543.663] (-3541.735) (-3540.080) (-3542.603) * (-3545.058) [-3542.086] (-3543.371) (-3548.372) -- 0:03:35 207000 -- (-3547.625) [-3546.174] (-3550.076) (-3540.424) * (-3544.646) (-3546.157) (-3542.955) [-3543.637] -- 0:03:34 207500 -- (-3551.658) (-3543.129) [-3543.869] (-3541.643) * (-3545.671) [-3543.418] (-3551.272) (-3555.063) -- 0:03:33 208000 -- (-3546.585) (-3538.833) (-3548.279) [-3541.296] * [-3546.909] (-3543.601) (-3546.502) (-3549.216) -- 0:03:33 208500 -- (-3546.161) (-3543.256) (-3551.771) [-3538.248] * [-3546.947] (-3547.232) (-3545.887) (-3552.148) -- 0:03:32 209000 -- (-3542.101) (-3551.572) (-3539.871) [-3547.563] * (-3546.577) [-3546.228] (-3539.270) (-3548.829) -- 0:03:31 209500 -- (-3544.376) (-3555.494) [-3541.785] (-3545.570) * (-3548.109) (-3541.269) [-3544.173] (-3548.225) -- 0:03:35 210000 -- [-3542.313] (-3556.167) (-3540.034) (-3547.358) * [-3547.667] (-3539.497) (-3540.177) (-3551.573) -- 0:03:34 Average standard deviation of split frequencies: 0.000000 210500 -- [-3545.412] (-3550.509) (-3544.118) (-3542.574) * (-3537.796) [-3540.931] (-3546.486) (-3543.912) -- 0:03:33 211000 -- [-3540.215] (-3546.936) (-3546.591) (-3545.264) * (-3545.149) (-3546.346) (-3541.791) [-3550.971] -- 0:03:33 211500 -- [-3544.855] (-3552.448) (-3546.480) (-3539.665) * [-3552.060] (-3543.712) (-3547.350) (-3546.420) -- 0:03:32 212000 -- (-3546.720) (-3548.005) (-3543.354) [-3544.241] * (-3545.260) (-3550.437) (-3538.920) [-3546.191] -- 0:03:31 212500 -- (-3542.544) (-3550.412) [-3541.633] (-3543.226) * [-3547.060] (-3542.238) (-3546.407) (-3550.454) -- 0:03:31 213000 -- (-3552.150) (-3544.410) [-3542.182] (-3546.852) * (-3544.131) [-3544.592] (-3544.526) (-3551.915) -- 0:03:30 213500 -- (-3544.068) [-3547.968] (-3543.758) (-3546.234) * (-3549.284) (-3545.293) (-3545.307) [-3545.520] -- 0:03:33 214000 -- [-3545.881] (-3549.418) (-3554.007) (-3548.147) * (-3545.472) (-3551.564) [-3545.688] (-3542.488) -- 0:03:33 214500 -- [-3546.702] (-3544.298) (-3546.426) (-3545.479) * [-3544.556] (-3545.008) (-3542.984) (-3546.429) -- 0:03:32 215000 -- (-3548.227) (-3547.972) (-3550.872) [-3542.929] * (-3546.657) (-3540.164) [-3550.805] (-3539.616) -- 0:03:31 Average standard deviation of split frequencies: 0.000000 215500 -- (-3548.032) (-3544.156) (-3559.002) [-3541.365] * (-3546.180) [-3543.337] (-3547.725) (-3547.543) -- 0:03:31 216000 -- (-3541.522) (-3543.764) (-3552.323) [-3541.133] * (-3553.633) (-3546.400) (-3550.299) [-3544.943] -- 0:03:30 216500 -- (-3549.118) [-3545.150] (-3546.557) (-3545.143) * (-3547.311) [-3543.075] (-3543.177) (-3549.646) -- 0:03:29 217000 -- (-3553.614) (-3540.074) (-3541.069) [-3541.499] * [-3546.159] (-3542.361) (-3542.354) (-3542.335) -- 0:03:32 217500 -- (-3541.680) (-3545.281) (-3545.484) [-3541.805] * (-3542.296) (-3547.555) [-3544.384] (-3543.997) -- 0:03:32 218000 -- (-3544.027) [-3545.211] (-3547.761) (-3542.981) * (-3542.148) [-3541.529] (-3545.823) (-3550.127) -- 0:03:31 218500 -- [-3541.413] (-3542.251) (-3541.377) (-3539.517) * [-3543.350] (-3542.354) (-3555.498) (-3549.750) -- 0:03:31 219000 -- (-3539.976) (-3544.691) [-3546.963] (-3548.026) * (-3555.992) [-3544.697] (-3562.226) (-3546.302) -- 0:03:30 219500 -- (-3540.693) (-3549.290) (-3545.155) [-3545.959] * (-3540.805) (-3538.819) [-3554.918] (-3545.391) -- 0:03:29 220000 -- (-3544.731) [-3542.268] (-3546.429) (-3555.275) * (-3550.796) [-3543.661] (-3545.999) (-3545.349) -- 0:03:29 Average standard deviation of split frequencies: 0.001068 220500 -- (-3544.966) (-3548.705) [-3545.245] (-3557.467) * (-3545.653) (-3542.800) [-3539.156] (-3544.542) -- 0:03:28 221000 -- (-3543.938) (-3545.732) (-3546.002) [-3546.365] * (-3554.145) (-3543.525) (-3540.963) [-3539.968] -- 0:03:31 221500 -- (-3541.222) (-3543.976) (-3548.124) [-3548.353] * (-3547.077) [-3549.278] (-3543.504) (-3541.442) -- 0:03:30 222000 -- (-3544.247) (-3546.102) [-3547.982] (-3541.711) * (-3548.840) (-3549.508) (-3542.094) [-3541.853] -- 0:03:30 222500 -- [-3549.941] (-3552.864) (-3544.404) (-3539.066) * (-3546.162) (-3545.191) [-3552.038] (-3542.014) -- 0:03:29 223000 -- (-3545.315) [-3544.357] (-3549.596) (-3544.578) * [-3544.791] (-3545.165) (-3542.054) (-3544.637) -- 0:03:29 223500 -- (-3542.279) [-3548.319] (-3550.414) (-3539.158) * (-3541.960) (-3548.282) (-3546.060) [-3543.679] -- 0:03:28 224000 -- (-3547.978) [-3548.346] (-3550.127) (-3545.660) * (-3545.714) (-3541.673) (-3543.664) [-3546.375] -- 0:03:27 224500 -- [-3543.979] (-3549.484) (-3550.455) (-3546.048) * (-3541.853) (-3543.157) (-3544.959) [-3542.312] -- 0:03:27 225000 -- (-3539.668) (-3545.137) (-3547.896) [-3546.870] * (-3543.664) [-3543.838] (-3550.835) (-3541.225) -- 0:03:30 Average standard deviation of split frequencies: 0.001043 225500 -- (-3539.725) (-3544.834) (-3545.679) [-3550.131] * (-3547.016) [-3549.070] (-3546.410) (-3543.716) -- 0:03:29 226000 -- (-3540.887) (-3540.390) [-3545.506] (-3542.186) * (-3547.485) (-3548.109) (-3542.938) [-3542.941] -- 0:03:28 226500 -- (-3543.170) [-3546.415] (-3544.987) (-3553.450) * [-3543.969] (-3555.883) (-3551.983) (-3541.471) -- 0:03:28 227000 -- [-3539.754] (-3546.690) (-3544.516) (-3546.405) * [-3550.180] (-3555.937) (-3543.765) (-3543.131) -- 0:03:27 227500 -- [-3543.271] (-3543.410) (-3546.884) (-3545.341) * [-3542.093] (-3544.896) (-3546.270) (-3546.003) -- 0:03:27 228000 -- (-3543.179) [-3548.555] (-3544.226) (-3545.348) * [-3542.498] (-3541.801) (-3542.736) (-3547.640) -- 0:03:26 228500 -- (-3549.919) [-3544.208] (-3546.341) (-3547.453) * [-3544.227] (-3544.423) (-3549.757) (-3553.381) -- 0:03:29 229000 -- (-3546.621) (-3545.121) (-3543.112) [-3542.803] * (-3550.508) [-3540.843] (-3546.916) (-3550.195) -- 0:03:28 229500 -- (-3548.794) (-3544.543) [-3542.472] (-3547.549) * [-3545.222] (-3543.860) (-3554.395) (-3552.581) -- 0:03:28 230000 -- [-3544.646] (-3546.171) (-3546.448) (-3542.674) * (-3545.871) (-3545.711) (-3544.183) [-3541.459] -- 0:03:27 Average standard deviation of split frequencies: 0.001022 230500 -- [-3545.983] (-3544.154) (-3542.287) (-3547.371) * (-3551.468) [-3541.939] (-3546.868) (-3550.102) -- 0:03:26 231000 -- (-3539.531) (-3545.308) [-3544.809] (-3544.562) * [-3545.857] (-3540.668) (-3548.240) (-3545.578) -- 0:03:26 231500 -- (-3539.115) [-3545.900] (-3553.070) (-3542.409) * (-3549.285) [-3548.949] (-3552.856) (-3545.317) -- 0:03:25 232000 -- [-3541.189] (-3547.379) (-3542.575) (-3547.673) * (-3549.079) (-3544.132) [-3543.924] (-3547.585) -- 0:03:25 232500 -- (-3551.239) (-3538.916) (-3543.045) [-3548.793] * (-3547.661) [-3541.240] (-3543.866) (-3543.973) -- 0:03:27 233000 -- (-3549.935) (-3552.349) [-3544.902] (-3546.431) * (-3547.678) [-3544.477] (-3542.564) (-3546.224) -- 0:03:27 233500 -- (-3547.509) (-3543.901) (-3547.453) [-3542.053] * (-3548.074) [-3545.402] (-3545.341) (-3550.534) -- 0:03:26 234000 -- (-3546.995) (-3552.915) [-3546.986] (-3544.446) * (-3548.460) (-3556.431) [-3546.443] (-3546.710) -- 0:03:26 234500 -- [-3542.962] (-3539.876) (-3541.564) (-3545.936) * (-3542.399) (-3547.826) [-3540.765] (-3542.326) -- 0:03:25 235000 -- (-3547.053) (-3543.731) [-3546.726] (-3543.507) * (-3545.227) (-3548.625) [-3541.697] (-3544.584) -- 0:03:25 Average standard deviation of split frequencies: 0.000999 235500 -- (-3553.104) (-3542.021) (-3552.936) [-3543.500] * (-3543.228) (-3543.558) [-3543.405] (-3542.018) -- 0:03:24 236000 -- (-3552.630) (-3546.675) [-3546.334] (-3547.219) * (-3546.657) (-3544.866) [-3545.024] (-3544.422) -- 0:03:23 236500 -- [-3551.774] (-3546.432) (-3545.906) (-3544.813) * (-3548.403) (-3550.712) (-3550.880) [-3543.006] -- 0:03:26 237000 -- (-3549.810) (-3542.829) (-3545.888) [-3539.904] * (-3552.748) [-3541.031] (-3547.059) (-3541.033) -- 0:03:26 237500 -- (-3543.795) [-3539.901] (-3541.499) (-3542.143) * (-3539.055) [-3539.592] (-3549.999) (-3542.668) -- 0:03:25 238000 -- (-3556.562) [-3542.318] (-3543.008) (-3541.607) * (-3546.882) [-3545.104] (-3543.377) (-3545.651) -- 0:03:24 238500 -- (-3542.468) (-3541.094) (-3545.444) [-3541.580] * (-3545.877) (-3555.268) (-3553.473) [-3540.070] -- 0:03:24 239000 -- [-3539.496] (-3540.307) (-3543.955) (-3546.627) * [-3548.997] (-3544.301) (-3548.154) (-3542.721) -- 0:03:23 239500 -- (-3542.583) (-3545.651) [-3545.801] (-3544.569) * (-3546.723) (-3547.434) [-3544.682] (-3545.602) -- 0:03:23 240000 -- (-3536.617) (-3542.779) (-3544.150) [-3542.438] * (-3547.723) (-3545.078) (-3543.124) [-3541.037] -- 0:03:22 Average standard deviation of split frequencies: 0.000979 240500 -- (-3541.042) [-3539.974] (-3545.788) (-3546.384) * (-3547.426) (-3552.341) (-3548.304) [-3545.642] -- 0:03:25 241000 -- (-3551.433) [-3541.110] (-3546.642) (-3542.417) * (-3548.301) [-3549.243] (-3542.607) (-3544.317) -- 0:03:24 241500 -- (-3550.331) (-3548.918) [-3542.561] (-3540.919) * (-3551.401) (-3541.185) (-3544.939) [-3547.555] -- 0:03:24 242000 -- (-3543.557) (-3550.080) (-3547.199) [-3541.924] * (-3549.772) (-3538.978) [-3546.214] (-3544.800) -- 0:03:23 242500 -- (-3541.819) (-3542.787) (-3549.108) [-3543.584] * (-3547.726) [-3542.235] (-3549.598) (-3547.129) -- 0:03:23 243000 -- (-3547.654) (-3542.156) (-3551.044) [-3539.451] * [-3543.455] (-3544.333) (-3544.825) (-3544.144) -- 0:03:22 243500 -- (-3546.164) [-3550.901] (-3554.032) (-3542.630) * (-3543.178) [-3544.315] (-3540.934) (-3545.515) -- 0:03:21 244000 -- [-3543.124] (-3544.080) (-3553.667) (-3548.401) * (-3545.146) [-3542.992] (-3540.928) (-3545.649) -- 0:03:21 244500 -- [-3540.870] (-3547.709) (-3548.863) (-3550.968) * (-3539.744) [-3539.360] (-3542.218) (-3541.461) -- 0:03:23 245000 -- (-3543.202) [-3542.888] (-3553.142) (-3549.516) * (-3550.579) [-3541.237] (-3548.040) (-3557.262) -- 0:03:23 Average standard deviation of split frequencies: 0.000958 245500 -- (-3540.540) (-3545.860) (-3545.356) [-3546.131] * (-3551.635) [-3544.427] (-3555.918) (-3547.724) -- 0:03:22 246000 -- (-3541.897) (-3553.242) (-3548.844) [-3543.593] * (-3547.000) (-3542.365) (-3549.943) [-3541.975] -- 0:03:22 246500 -- [-3539.481] (-3550.623) (-3547.415) (-3547.024) * (-3542.535) (-3543.700) (-3546.132) [-3541.754] -- 0:03:21 247000 -- (-3544.582) (-3552.457) (-3544.199) [-3547.057] * [-3548.921] (-3542.489) (-3547.035) (-3548.538) -- 0:03:21 247500 -- (-3544.662) (-3546.730) [-3543.322] (-3544.635) * (-3541.149) [-3549.226] (-3550.266) (-3543.617) -- 0:03:20 248000 -- (-3544.329) (-3545.077) [-3547.042] (-3545.621) * [-3541.201] (-3541.604) (-3548.466) (-3549.154) -- 0:03:23 248500 -- [-3544.047] (-3543.686) (-3540.262) (-3550.139) * (-3542.846) (-3547.395) [-3543.076] (-3549.001) -- 0:03:22 249000 -- (-3542.122) (-3552.680) (-3550.231) [-3545.413] * [-3544.305] (-3548.049) (-3549.947) (-3549.554) -- 0:03:22 249500 -- (-3541.559) [-3545.506] (-3546.939) (-3544.523) * (-3547.592) [-3544.694] (-3553.514) (-3541.110) -- 0:03:21 250000 -- (-3546.667) (-3540.034) (-3545.702) [-3545.237] * (-3542.600) (-3549.660) (-3544.168) [-3542.213] -- 0:03:21 Average standard deviation of split frequencies: 0.000940 250500 -- [-3544.145] (-3543.382) (-3547.574) (-3546.063) * (-3548.366) (-3542.695) (-3544.540) [-3546.043] -- 0:03:20 251000 -- [-3542.610] (-3549.044) (-3543.183) (-3552.156) * [-3549.688] (-3543.661) (-3545.028) (-3542.263) -- 0:03:19 251500 -- (-3552.015) [-3547.048] (-3544.908) (-3542.829) * (-3549.187) (-3548.890) (-3548.597) [-3541.053] -- 0:03:19 252000 -- [-3543.941] (-3553.010) (-3541.761) (-3552.017) * (-3550.856) (-3542.674) [-3545.413] (-3546.055) -- 0:03:21 252500 -- (-3555.162) (-3549.179) (-3542.007) [-3544.291] * [-3547.898] (-3546.671) (-3546.585) (-3541.547) -- 0:03:21 253000 -- (-3548.424) (-3550.121) (-3543.472) [-3542.133] * (-3543.889) (-3543.549) (-3554.897) [-3542.798] -- 0:03:20 253500 -- (-3541.913) (-3549.262) (-3548.244) [-3540.589] * [-3542.470] (-3543.042) (-3544.041) (-3547.222) -- 0:03:20 254000 -- (-3546.681) (-3542.112) (-3548.211) [-3543.453] * [-3543.297] (-3549.672) (-3545.444) (-3542.866) -- 0:03:19 254500 -- (-3546.525) (-3543.652) (-3545.601) [-3541.214] * (-3544.361) [-3545.521] (-3547.877) (-3546.704) -- 0:03:19 255000 -- (-3548.360) (-3541.613) (-3540.631) [-3544.576] * (-3544.422) (-3550.213) (-3547.500) [-3542.636] -- 0:03:18 Average standard deviation of split frequencies: 0.000921 255500 -- [-3546.256] (-3541.296) (-3543.573) (-3547.849) * (-3542.853) (-3553.961) [-3543.441] (-3543.961) -- 0:03:18 256000 -- (-3543.821) (-3548.611) [-3543.908] (-3541.954) * (-3542.130) (-3550.751) (-3542.110) [-3540.383] -- 0:03:20 256500 -- [-3539.668] (-3553.353) (-3542.017) (-3551.394) * (-3542.204) (-3542.041) (-3541.493) [-3547.996] -- 0:03:20 257000 -- (-3543.865) (-3546.859) [-3546.284] (-3545.890) * (-3546.267) [-3542.477] (-3542.739) (-3541.020) -- 0:03:19 257500 -- (-3541.402) (-3545.466) (-3540.771) [-3545.156] * [-3545.386] (-3546.526) (-3542.385) (-3552.110) -- 0:03:18 258000 -- (-3545.380) (-3543.112) (-3545.141) [-3549.806] * [-3541.097] (-3543.602) (-3550.606) (-3546.917) -- 0:03:18 258500 -- (-3550.504) [-3544.472] (-3550.573) (-3546.409) * [-3551.856] (-3545.223) (-3546.239) (-3545.606) -- 0:03:17 259000 -- (-3539.935) [-3544.328] (-3544.500) (-3545.142) * (-3545.099) (-3540.587) [-3543.899] (-3548.105) -- 0:03:17 259500 -- (-3545.985) [-3541.966] (-3552.224) (-3549.393) * [-3548.564] (-3544.264) (-3547.956) (-3548.786) -- 0:03:19 260000 -- (-3540.357) (-3543.081) [-3547.795] (-3546.041) * (-3547.840) (-3544.395) [-3548.400] (-3545.126) -- 0:03:19 Average standard deviation of split frequencies: 0.000904 260500 -- (-3544.533) (-3546.241) (-3550.826) [-3543.059] * (-3543.067) (-3545.980) [-3547.605] (-3544.168) -- 0:03:18 261000 -- (-3543.990) (-3542.010) [-3543.417] (-3551.797) * (-3546.040) (-3545.372) [-3543.949] (-3543.682) -- 0:03:18 261500 -- (-3551.735) (-3539.746) (-3546.893) [-3540.632] * (-3543.912) (-3541.625) [-3546.397] (-3544.679) -- 0:03:17 262000 -- (-3552.419) (-3538.458) (-3543.515) [-3543.320] * (-3547.023) (-3545.773) [-3545.714] (-3543.888) -- 0:03:17 262500 -- (-3540.979) (-3557.555) (-3540.941) [-3543.301] * (-3542.746) (-3554.594) [-3543.508] (-3547.823) -- 0:03:16 263000 -- (-3543.254) (-3546.480) [-3545.509] (-3541.276) * (-3545.461) (-3541.981) [-3542.970] (-3545.835) -- 0:03:16 263500 -- (-3544.821) (-3544.371) [-3547.687] (-3552.715) * (-3545.609) (-3547.323) (-3541.961) [-3542.533] -- 0:03:18 264000 -- (-3544.413) (-3540.141) (-3548.572) [-3542.551] * (-3545.732) (-3546.827) [-3540.018] (-3550.947) -- 0:03:17 264500 -- [-3546.374] (-3546.501) (-3546.257) (-3546.181) * (-3545.314) (-3543.649) [-3550.555] (-3547.324) -- 0:03:17 265000 -- (-3542.208) (-3551.511) [-3554.578] (-3546.305) * (-3550.174) (-3545.074) (-3545.929) [-3543.116] -- 0:03:16 Average standard deviation of split frequencies: 0.000886 265500 -- [-3543.799] (-3545.652) (-3543.717) (-3548.278) * (-3546.300) (-3546.318) (-3541.948) [-3541.662] -- 0:03:16 266000 -- (-3545.586) (-3540.691) [-3544.041] (-3548.683) * (-3552.426) (-3547.193) [-3544.502] (-3543.624) -- 0:03:15 266500 -- [-3541.509] (-3542.150) (-3542.201) (-3544.154) * (-3543.352) (-3548.783) [-3540.002] (-3546.593) -- 0:03:15 267000 -- (-3537.751) (-3548.139) [-3540.555] (-3544.015) * (-3554.595) (-3547.287) (-3548.139) [-3540.437] -- 0:03:14 267500 -- (-3548.261) (-3551.364) (-3546.582) [-3544.357] * (-3543.004) (-3540.377) (-3547.098) [-3549.541] -- 0:03:17 268000 -- (-3545.352) (-3543.775) [-3544.011] (-3546.032) * [-3539.370] (-3541.671) (-3542.728) (-3548.138) -- 0:03:16 268500 -- (-3546.382) (-3553.738) (-3544.933) [-3545.414] * (-3549.261) (-3543.300) [-3544.832] (-3548.130) -- 0:03:16 269000 -- [-3548.155] (-3553.907) (-3541.525) (-3545.793) * (-3543.035) [-3547.177] (-3543.914) (-3543.427) -- 0:03:15 269500 -- (-3556.246) (-3551.327) (-3540.972) [-3540.254] * (-3550.883) [-3548.572] (-3542.207) (-3546.313) -- 0:03:15 270000 -- [-3549.322] (-3542.564) (-3542.542) (-3546.722) * (-3543.858) (-3545.804) [-3539.450] (-3544.196) -- 0:03:14 Average standard deviation of split frequencies: 0.000871 270500 -- (-3543.983) (-3548.163) [-3545.750] (-3545.766) * (-3540.546) (-3541.710) (-3543.336) [-3545.440] -- 0:03:14 271000 -- (-3545.402) (-3543.935) (-3539.071) [-3546.617] * [-3539.451] (-3539.477) (-3547.809) (-3544.151) -- 0:03:13 271500 -- (-3554.588) (-3543.891) (-3543.431) [-3545.571] * (-3540.976) [-3542.904] (-3542.903) (-3554.139) -- 0:03:15 272000 -- (-3551.083) [-3544.893] (-3549.692) (-3549.811) * [-3543.057] (-3553.348) (-3542.691) (-3548.909) -- 0:03:15 272500 -- (-3541.741) (-3551.133) [-3540.021] (-3550.997) * (-3546.673) [-3541.360] (-3543.446) (-3550.289) -- 0:03:14 273000 -- (-3545.863) (-3548.030) [-3544.238] (-3551.360) * (-3541.112) (-3554.434) (-3548.613) [-3547.431] -- 0:03:14 273500 -- (-3542.863) (-3555.591) [-3545.394] (-3548.994) * (-3547.088) [-3542.775] (-3550.759) (-3549.702) -- 0:03:13 274000 -- (-3544.904) (-3546.342) [-3546.357] (-3544.609) * [-3542.898] (-3546.976) (-3542.060) (-3542.384) -- 0:03:13 274500 -- (-3540.845) (-3544.820) (-3549.423) [-3544.796] * (-3540.452) [-3546.146] (-3545.554) (-3549.488) -- 0:03:12 275000 -- (-3544.777) (-3541.915) [-3551.585] (-3550.119) * (-3548.287) (-3547.119) (-3543.598) [-3544.964] -- 0:03:15 Average standard deviation of split frequencies: 0.000854 275500 -- (-3548.856) (-3547.638) (-3546.265) [-3541.345] * [-3546.162] (-3546.974) (-3542.757) (-3538.828) -- 0:03:14 276000 -- [-3545.298] (-3544.805) (-3546.893) (-3544.775) * [-3545.284] (-3547.375) (-3555.514) (-3538.739) -- 0:03:14 276500 -- [-3541.251] (-3543.069) (-3545.564) (-3538.248) * (-3549.877) (-3550.417) (-3553.098) [-3542.588] -- 0:03:13 277000 -- (-3542.247) (-3553.100) (-3547.541) [-3541.844] * (-3545.978) (-3553.061) [-3544.437] (-3549.657) -- 0:03:13 277500 -- [-3541.179] (-3554.746) (-3551.206) (-3540.911) * (-3545.405) (-3548.377) (-3549.508) [-3545.616] -- 0:03:12 278000 -- (-3539.181) (-3548.117) (-3548.733) [-3542.121] * (-3544.719) [-3540.812] (-3540.794) (-3552.904) -- 0:03:12 278500 -- (-3547.523) (-3545.075) (-3565.695) [-3541.451] * (-3550.315) [-3540.905] (-3543.964) (-3547.435) -- 0:03:11 279000 -- (-3540.953) [-3544.472] (-3548.083) (-3549.579) * (-3547.827) [-3545.686] (-3545.292) (-3550.657) -- 0:03:13 279500 -- (-3545.922) (-3547.355) (-3546.143) [-3539.444] * (-3556.760) (-3548.214) (-3547.765) [-3546.690] -- 0:03:13 280000 -- (-3547.490) (-3547.410) [-3545.513] (-3544.623) * (-3555.780) (-3546.626) (-3543.507) [-3544.455] -- 0:03:12 Average standard deviation of split frequencies: 0.000840 280500 -- (-3545.679) (-3546.320) (-3541.082) [-3546.580] * (-3553.765) [-3548.578] (-3539.808) (-3543.831) -- 0:03:12 281000 -- [-3539.971] (-3544.310) (-3546.469) (-3545.431) * (-3546.406) (-3544.433) (-3544.613) [-3544.207] -- 0:03:11 281500 -- (-3541.015) (-3560.068) (-3545.661) [-3542.556] * (-3545.253) (-3543.995) [-3546.285] (-3539.968) -- 0:03:11 282000 -- (-3544.182) (-3554.474) [-3540.692] (-3547.973) * (-3548.824) (-3546.666) [-3548.415] (-3545.743) -- 0:03:10 282500 -- (-3547.230) [-3549.190] (-3548.934) (-3545.300) * (-3548.174) (-3540.802) [-3543.712] (-3541.100) -- 0:03:10 283000 -- [-3543.917] (-3543.443) (-3553.073) (-3546.271) * (-3545.203) [-3541.957] (-3556.490) (-3546.457) -- 0:03:12 283500 -- [-3544.361] (-3546.445) (-3557.944) (-3544.357) * (-3548.536) [-3544.928] (-3544.927) (-3541.417) -- 0:03:12 284000 -- (-3546.653) (-3544.995) (-3544.174) [-3541.592] * (-3543.390) (-3551.096) (-3544.036) [-3545.884] -- 0:03:11 284500 -- (-3549.632) [-3548.987] (-3553.841) (-3551.916) * (-3549.409) (-3541.730) (-3541.055) [-3546.156] -- 0:03:11 285000 -- (-3540.866) [-3547.008] (-3544.747) (-3549.245) * (-3553.558) (-3548.361) (-3542.096) [-3547.737] -- 0:03:10 Average standard deviation of split frequencies: 0.000824 285500 -- (-3546.052) (-3545.620) [-3544.036] (-3544.916) * [-3550.777] (-3551.753) (-3545.320) (-3551.122) -- 0:03:10 286000 -- [-3548.280] (-3547.657) (-3555.411) (-3544.416) * (-3544.499) (-3551.056) [-3552.474] (-3552.118) -- 0:03:09 286500 -- [-3546.573] (-3542.558) (-3542.496) (-3540.034) * (-3549.200) (-3545.786) (-3548.027) [-3544.693] -- 0:03:11 287000 -- (-3544.845) (-3546.368) [-3547.518] (-3541.358) * (-3558.565) [-3542.009] (-3539.953) (-3542.516) -- 0:03:11 287500 -- [-3550.137] (-3547.085) (-3543.060) (-3544.430) * (-3547.870) (-3544.395) [-3542.026] (-3544.269) -- 0:03:10 288000 -- [-3543.479] (-3547.675) (-3541.725) (-3542.045) * (-3553.667) [-3543.083] (-3547.636) (-3551.517) -- 0:03:10 288500 -- (-3546.664) (-3553.835) [-3546.735] (-3542.246) * (-3547.142) (-3539.023) (-3544.938) [-3542.531] -- 0:03:09 289000 -- (-3543.413) [-3550.519] (-3543.817) (-3541.873) * (-3540.491) (-3543.049) [-3543.846] (-3543.719) -- 0:03:09 289500 -- (-3542.827) (-3549.740) (-3546.044) [-3542.138] * (-3547.077) (-3546.906) [-3547.868] (-3544.452) -- 0:03:08 290000 -- (-3543.446) (-3549.880) [-3553.356] (-3554.246) * (-3548.823) [-3541.402] (-3540.647) (-3548.344) -- 0:03:08 Average standard deviation of split frequencies: 0.000811 290500 -- [-3542.753] (-3557.076) (-3546.677) (-3547.106) * (-3543.314) [-3542.017] (-3541.078) (-3547.549) -- 0:03:10 291000 -- (-3546.191) (-3546.144) (-3542.219) [-3542.664] * (-3546.142) (-3543.790) [-3545.385] (-3545.324) -- 0:03:10 291500 -- (-3545.877) (-3550.763) [-3540.635] (-3543.061) * [-3546.273] (-3542.629) (-3541.357) (-3549.906) -- 0:03:09 292000 -- (-3541.570) (-3544.479) (-3540.224) [-3542.673] * [-3541.182] (-3550.119) (-3549.219) (-3544.882) -- 0:03:09 292500 -- [-3543.590] (-3544.555) (-3548.156) (-3547.021) * (-3546.658) (-3546.927) (-3547.796) [-3547.168] -- 0:03:08 293000 -- (-3543.627) [-3540.720] (-3547.747) (-3550.753) * (-3546.795) (-3543.969) [-3545.195] (-3551.055) -- 0:03:08 293500 -- (-3544.847) (-3555.946) (-3550.388) [-3549.029] * [-3543.489] (-3541.652) (-3543.267) (-3546.934) -- 0:03:07 294000 -- (-3545.866) (-3549.042) [-3539.630] (-3544.572) * (-3547.335) (-3546.181) (-3541.309) [-3542.105] -- 0:03:07 294500 -- (-3544.931) (-3546.101) [-3548.338] (-3542.404) * (-3539.638) (-3545.083) (-3546.533) [-3539.855] -- 0:03:09 295000 -- (-3549.689) (-3542.145) [-3541.384] (-3541.137) * [-3544.551] (-3544.408) (-3544.862) (-3547.859) -- 0:03:08 Average standard deviation of split frequencies: 0.000796 295500 -- [-3544.026] (-3551.725) (-3542.521) (-3545.593) * (-3546.864) (-3542.839) (-3543.933) [-3538.693] -- 0:03:08 296000 -- [-3538.926] (-3548.284) (-3544.462) (-3547.359) * [-3542.367] (-3545.368) (-3546.977) (-3542.830) -- 0:03:07 296500 -- (-3545.407) (-3546.189) [-3543.301] (-3540.673) * [-3545.368] (-3544.989) (-3538.577) (-3540.020) -- 0:03:07 297000 -- [-3546.913] (-3553.459) (-3539.531) (-3544.563) * (-3549.125) (-3544.673) [-3538.772] (-3544.846) -- 0:03:06 297500 -- (-3552.174) (-3550.915) [-3545.143] (-3544.048) * [-3543.429] (-3543.962) (-3546.882) (-3543.945) -- 0:03:06 298000 -- (-3550.423) (-3549.762) (-3544.818) [-3543.431] * [-3542.927] (-3547.143) (-3545.154) (-3545.525) -- 0:03:06 298500 -- (-3542.677) (-3549.505) (-3541.618) [-3549.664] * [-3544.940] (-3546.010) (-3541.939) (-3544.837) -- 0:03:08 299000 -- [-3538.944] (-3543.007) (-3540.045) (-3545.299) * (-3544.232) [-3541.993] (-3540.538) (-3544.968) -- 0:03:07 299500 -- [-3544.967] (-3544.007) (-3541.348) (-3549.152) * (-3543.970) [-3539.533] (-3540.956) (-3546.057) -- 0:03:07 300000 -- (-3540.089) (-3551.729) [-3553.040] (-3545.684) * (-3549.876) (-3545.322) [-3552.518] (-3543.964) -- 0:03:06 Average standard deviation of split frequencies: 0.000784 300500 -- [-3541.061] (-3553.210) (-3544.639) (-3553.767) * [-3546.005] (-3543.307) (-3552.632) (-3541.971) -- 0:03:06 301000 -- [-3548.317] (-3544.135) (-3553.955) (-3546.914) * (-3542.661) [-3550.290] (-3556.374) (-3541.475) -- 0:03:05 301500 -- [-3550.903] (-3549.615) (-3553.383) (-3540.872) * (-3550.931) [-3551.798] (-3546.021) (-3544.960) -- 0:03:05 302000 -- (-3544.099) [-3548.625] (-3547.029) (-3542.542) * (-3548.539) [-3546.554] (-3548.308) (-3541.682) -- 0:03:07 302500 -- (-3547.821) [-3540.438] (-3550.849) (-3543.944) * (-3548.622) (-3543.668) (-3542.263) [-3541.531] -- 0:03:06 303000 -- [-3549.881] (-3547.154) (-3551.824) (-3544.480) * (-3549.393) (-3546.227) (-3551.185) [-3541.529] -- 0:03:06 303500 -- (-3549.157) (-3543.849) [-3544.388] (-3546.845) * [-3547.365] (-3555.460) (-3544.068) (-3549.632) -- 0:03:05 304000 -- (-3540.543) (-3544.577) [-3544.464] (-3547.129) * [-3535.565] (-3549.089) (-3545.057) (-3546.395) -- 0:03:05 304500 -- (-3543.818) [-3547.113] (-3545.211) (-3539.328) * (-3542.526) (-3546.641) [-3543.816] (-3550.243) -- 0:03:05 305000 -- (-3542.844) (-3545.975) [-3539.796] (-3544.031) * (-3543.499) (-3550.795) [-3544.451] (-3549.264) -- 0:03:04 Average standard deviation of split frequencies: 0.000770 305500 -- (-3542.118) (-3541.313) (-3547.366) [-3545.246] * (-3543.849) (-3547.962) (-3547.065) [-3540.837] -- 0:03:04 306000 -- (-3541.111) [-3546.020] (-3547.226) (-3553.561) * [-3551.519] (-3549.020) (-3550.797) (-3544.918) -- 0:03:05 306500 -- [-3546.073] (-3553.616) (-3548.448) (-3539.151) * (-3540.527) [-3546.439] (-3545.929) (-3544.271) -- 0:03:05 307000 -- (-3548.155) (-3551.332) (-3545.134) [-3549.073] * (-3542.458) [-3544.408] (-3546.995) (-3550.020) -- 0:03:05 307500 -- (-3542.304) [-3545.160] (-3544.228) (-3541.786) * (-3548.254) (-3560.065) [-3546.539] (-3550.004) -- 0:03:04 308000 -- [-3545.407] (-3552.077) (-3542.969) (-3547.801) * (-3540.980) [-3546.407] (-3546.988) (-3549.355) -- 0:03:04 308500 -- (-3545.358) [-3547.572] (-3542.691) (-3553.445) * [-3544.799] (-3541.385) (-3541.535) (-3549.842) -- 0:03:03 309000 -- (-3539.292) (-3546.089) (-3547.932) [-3541.976] * (-3544.840) (-3542.272) [-3546.065] (-3544.761) -- 0:03:03 309500 -- (-3541.452) [-3542.476] (-3544.701) (-3542.235) * (-3547.789) (-3542.361) (-3547.594) [-3543.507] -- 0:03:02 310000 -- [-3550.603] (-3541.222) (-3540.383) (-3545.217) * [-3546.716] (-3545.208) (-3542.172) (-3540.848) -- 0:03:04 Average standard deviation of split frequencies: 0.000759 310500 -- (-3546.230) (-3543.753) [-3547.865] (-3551.056) * (-3548.390) [-3541.093] (-3543.945) (-3542.527) -- 0:03:04 311000 -- [-3548.157] (-3538.712) (-3547.126) (-3555.827) * (-3542.794) (-3547.629) [-3545.700] (-3548.259) -- 0:03:03 311500 -- (-3549.031) [-3540.471] (-3548.189) (-3552.875) * [-3544.048] (-3541.586) (-3541.076) (-3550.019) -- 0:03:03 312000 -- (-3546.461) [-3543.825] (-3553.239) (-3546.871) * (-3544.560) (-3549.214) [-3542.536] (-3545.803) -- 0:03:03 312500 -- [-3540.980] (-3547.501) (-3549.706) (-3539.969) * (-3546.923) (-3553.181) [-3541.445] (-3550.896) -- 0:03:02 313000 -- [-3546.154] (-3542.449) (-3546.687) (-3551.300) * (-3540.290) (-3548.175) (-3546.959) [-3546.429] -- 0:03:02 313500 -- (-3550.342) (-3543.947) [-3542.308] (-3545.517) * [-3545.144] (-3547.691) (-3546.764) (-3545.126) -- 0:03:01 314000 -- (-3546.527) (-3547.077) [-3539.924] (-3551.584) * (-3542.945) (-3545.210) [-3550.656] (-3546.355) -- 0:03:03 314500 -- (-3543.314) (-3550.688) [-3541.047] (-3548.034) * (-3548.685) [-3545.931] (-3542.027) (-3547.015) -- 0:03:03 315000 -- (-3546.328) [-3541.633] (-3540.643) (-3546.223) * [-3546.612] (-3547.604) (-3541.513) (-3542.391) -- 0:03:02 Average standard deviation of split frequencies: 0.000746 315500 -- (-3542.110) [-3543.848] (-3542.639) (-3544.928) * [-3545.618] (-3546.077) (-3538.889) (-3549.395) -- 0:03:02 316000 -- (-3542.120) (-3546.895) (-3543.672) [-3551.491] * [-3547.438] (-3549.015) (-3540.651) (-3554.161) -- 0:03:01 316500 -- (-3542.198) (-3542.466) [-3540.124] (-3545.952) * (-3546.399) [-3548.573] (-3542.406) (-3552.236) -- 0:03:01 317000 -- (-3545.341) (-3546.146) [-3541.913] (-3544.259) * (-3540.891) (-3546.788) [-3543.116] (-3544.350) -- 0:03:00 317500 -- (-3546.180) [-3541.826] (-3543.755) (-3543.009) * (-3555.894) (-3547.679) [-3542.026] (-3545.914) -- 0:03:00 318000 -- (-3545.523) [-3543.715] (-3545.214) (-3546.266) * [-3544.080] (-3544.438) (-3543.850) (-3541.832) -- 0:03:02 318500 -- [-3551.250] (-3543.275) (-3548.946) (-3545.779) * (-3540.680) (-3541.724) [-3543.263] (-3547.377) -- 0:03:01 319000 -- (-3548.465) (-3547.659) (-3543.420) [-3546.561] * [-3546.636] (-3539.618) (-3547.957) (-3542.560) -- 0:03:01 319500 -- (-3543.139) [-3537.240] (-3546.351) (-3545.451) * [-3546.615] (-3544.213) (-3548.346) (-3542.453) -- 0:03:01 320000 -- (-3545.271) (-3545.828) (-3548.681) [-3541.840] * (-3541.860) (-3544.218) [-3542.535] (-3551.872) -- 0:03:00 Average standard deviation of split frequencies: 0.000735 320500 -- (-3542.925) (-3544.594) [-3546.456] (-3546.470) * [-3543.687] (-3547.645) (-3541.398) (-3547.168) -- 0:03:00 321000 -- (-3544.894) (-3555.492) [-3543.739] (-3542.451) * (-3548.288) [-3543.129] (-3549.136) (-3548.204) -- 0:02:59 321500 -- [-3541.991] (-3548.366) (-3546.045) (-3546.730) * (-3542.476) (-3541.572) [-3545.599] (-3547.961) -- 0:03:01 322000 -- (-3544.118) (-3548.456) (-3546.856) [-3542.360] * (-3547.539) (-3544.669) (-3551.543) [-3540.912] -- 0:03:01 322500 -- (-3551.611) [-3542.853] (-3553.547) (-3542.335) * (-3544.180) (-3547.248) [-3543.969] (-3548.922) -- 0:03:00 323000 -- (-3550.205) (-3550.452) (-3547.486) [-3542.342] * (-3546.832) [-3545.550] (-3546.483) (-3548.834) -- 0:03:00 323500 -- (-3551.311) [-3551.893] (-3548.735) (-3545.791) * [-3548.251] (-3543.048) (-3544.696) (-3549.055) -- 0:02:59 324000 -- (-3543.948) [-3541.144] (-3550.373) (-3540.569) * (-3547.312) (-3544.107) (-3544.911) [-3546.495] -- 0:02:59 324500 -- [-3540.731] (-3538.674) (-3543.120) (-3549.498) * [-3546.462] (-3548.712) (-3541.181) (-3542.145) -- 0:02:59 325000 -- (-3544.288) (-3543.157) [-3551.939] (-3549.909) * (-3545.579) [-3540.013] (-3545.965) (-3542.921) -- 0:02:58 Average standard deviation of split frequencies: 0.000723 325500 -- [-3546.542] (-3542.776) (-3550.572) (-3543.186) * (-3541.966) (-3544.093) (-3542.801) [-3541.966] -- 0:03:00 326000 -- [-3544.581] (-3542.774) (-3544.455) (-3543.363) * (-3550.351) (-3541.050) [-3544.857] (-3544.204) -- 0:02:59 326500 -- (-3545.185) (-3542.629) [-3548.339] (-3547.948) * (-3553.903) [-3547.808] (-3545.586) (-3544.540) -- 0:02:59 327000 -- (-3543.023) (-3543.312) [-3541.820] (-3541.564) * (-3550.951) (-3547.669) (-3543.615) [-3541.925] -- 0:02:59 327500 -- (-3537.685) [-3538.950] (-3543.347) (-3543.784) * [-3543.220] (-3541.336) (-3543.193) (-3549.321) -- 0:02:58 328000 -- (-3547.645) (-3541.490) [-3545.405] (-3546.071) * [-3543.447] (-3552.880) (-3549.287) (-3543.961) -- 0:02:58 328500 -- (-3540.923) [-3539.226] (-3544.582) (-3543.642) * (-3546.640) [-3544.381] (-3548.495) (-3542.068) -- 0:02:57 329000 -- (-3547.330) (-3548.100) [-3542.496] (-3553.786) * (-3538.894) (-3544.306) [-3547.643] (-3540.099) -- 0:02:57 329500 -- [-3545.385] (-3549.472) (-3543.483) (-3550.032) * (-3545.048) (-3550.916) [-3549.690] (-3544.980) -- 0:02:59 330000 -- (-3543.320) [-3548.834] (-3550.579) (-3549.893) * (-3543.148) [-3546.523] (-3549.072) (-3545.713) -- 0:02:58 Average standard deviation of split frequencies: 0.000713 330500 -- (-3545.941) (-3549.098) (-3542.737) [-3544.431] * (-3540.655) (-3546.405) (-3550.414) [-3540.025] -- 0:02:58 331000 -- (-3545.113) (-3543.386) (-3541.682) [-3546.533] * (-3546.569) (-3546.191) [-3551.381] (-3545.675) -- 0:02:57 331500 -- (-3544.560) (-3542.248) [-3538.780] (-3542.676) * [-3543.404] (-3553.791) (-3547.587) (-3546.464) -- 0:02:57 332000 -- [-3542.195] (-3551.431) (-3543.086) (-3547.767) * (-3546.218) (-3547.628) (-3542.685) [-3539.678] -- 0:02:57 332500 -- (-3543.833) (-3550.307) [-3547.318] (-3547.067) * (-3547.550) (-3546.308) (-3542.986) [-3539.597] -- 0:02:56 333000 -- (-3542.010) (-3545.554) [-3545.879] (-3543.324) * (-3554.971) (-3548.778) (-3542.523) [-3540.706] -- 0:02:56 333500 -- (-3549.420) (-3548.291) (-3547.844) [-3546.800] * (-3547.199) [-3539.802] (-3544.639) (-3546.731) -- 0:02:57 334000 -- (-3544.648) [-3544.483] (-3544.643) (-3548.000) * [-3554.755] (-3546.362) (-3541.575) (-3545.120) -- 0:02:57 334500 -- [-3540.052] (-3542.493) (-3545.606) (-3544.086) * (-3539.676) [-3546.376] (-3545.000) (-3541.544) -- 0:02:57 335000 -- (-3545.003) (-3550.936) (-3539.622) [-3544.108] * (-3543.827) [-3551.762] (-3544.032) (-3542.134) -- 0:02:56 Average standard deviation of split frequencies: 0.000701 335500 -- (-3541.125) (-3548.516) (-3547.382) [-3540.985] * (-3544.965) [-3547.415] (-3541.907) (-3547.296) -- 0:02:56 336000 -- (-3552.798) (-3543.877) (-3544.358) [-3543.173] * (-3545.454) [-3547.623] (-3542.873) (-3548.883) -- 0:02:55 336500 -- (-3543.699) [-3542.089] (-3553.112) (-3542.255) * (-3546.005) (-3550.040) [-3547.685] (-3544.819) -- 0:02:55 337000 -- (-3542.110) (-3552.388) [-3544.736] (-3550.186) * (-3545.142) (-3546.888) (-3551.521) [-3546.309] -- 0:02:57 337500 -- (-3545.274) (-3540.705) [-3542.520] (-3539.016) * (-3545.159) (-3549.429) (-3547.353) [-3542.718] -- 0:02:56 338000 -- (-3544.194) [-3541.919] (-3542.828) (-3539.748) * (-3541.378) (-3543.500) [-3544.602] (-3543.163) -- 0:02:56 338500 -- (-3545.836) (-3540.216) (-3541.272) [-3541.924] * [-3541.663] (-3548.845) (-3544.111) (-3548.516) -- 0:02:55 339000 -- (-3548.854) [-3545.981] (-3540.900) (-3541.264) * (-3544.243) [-3548.835] (-3541.690) (-3546.634) -- 0:02:55 339500 -- (-3557.007) (-3547.360) (-3541.566) [-3541.521] * (-3543.262) (-3552.703) [-3545.230] (-3546.290) -- 0:02:55 340000 -- (-3546.627) (-3547.375) (-3548.358) [-3538.475] * [-3543.948] (-3552.467) (-3547.060) (-3545.909) -- 0:02:54 Average standard deviation of split frequencies: 0.000692 340500 -- [-3546.363] (-3548.340) (-3548.179) (-3552.809) * (-3545.365) (-3545.278) (-3540.294) [-3547.613] -- 0:02:54 341000 -- (-3545.173) [-3549.122] (-3542.453) (-3545.932) * (-3543.727) (-3543.008) (-3553.342) [-3539.789] -- 0:02:55 341500 -- (-3546.357) [-3544.818] (-3548.599) (-3544.951) * (-3546.920) (-3549.807) (-3551.477) [-3543.065] -- 0:02:55 342000 -- [-3544.409] (-3544.678) (-3544.855) (-3551.126) * (-3544.368) (-3540.449) [-3547.163] (-3546.885) -- 0:02:55 342500 -- (-3545.642) [-3544.948] (-3544.057) (-3543.475) * (-3552.046) [-3539.163] (-3550.468) (-3546.026) -- 0:02:54 343000 -- (-3551.280) (-3545.851) (-3543.930) [-3546.000] * (-3541.983) [-3545.129] (-3548.924) (-3544.203) -- 0:02:54 343500 -- (-3541.712) (-3542.582) (-3547.407) [-3543.439] * (-3541.533) (-3544.527) [-3547.186] (-3542.985) -- 0:02:53 344000 -- (-3552.479) (-3541.677) [-3547.802] (-3543.797) * (-3543.416) (-3545.472) (-3545.218) [-3545.175] -- 0:02:53 344500 -- (-3545.060) (-3547.132) [-3548.617] (-3544.534) * [-3549.131] (-3541.410) (-3546.020) (-3547.875) -- 0:02:53 345000 -- (-3540.208) (-3545.780) (-3547.786) [-3543.849] * (-3546.546) (-3542.036) (-3541.052) [-3545.340] -- 0:02:54 Average standard deviation of split frequencies: 0.001362 345500 -- (-3544.200) (-3540.411) [-3545.789] (-3540.628) * [-3546.175] (-3544.690) (-3548.058) (-3553.992) -- 0:02:54 346000 -- (-3542.452) (-3543.765) [-3543.405] (-3547.554) * (-3552.013) (-3542.383) (-3545.262) [-3546.606] -- 0:02:53 346500 -- (-3547.886) [-3540.560] (-3543.362) (-3539.569) * (-3558.773) (-3540.268) [-3542.757] (-3546.820) -- 0:02:53 347000 -- [-3542.232] (-3545.928) (-3546.381) (-3545.371) * (-3550.084) (-3546.871) [-3546.391] (-3543.339) -- 0:02:53 347500 -- (-3548.502) (-3541.871) (-3545.777) [-3541.429] * [-3544.763] (-3546.263) (-3545.385) (-3548.832) -- 0:02:52 348000 -- [-3543.151] (-3544.378) (-3550.188) (-3547.290) * [-3540.559] (-3542.429) (-3550.251) (-3538.634) -- 0:02:52 348500 -- (-3552.308) (-3542.078) (-3543.995) [-3554.374] * [-3541.744] (-3543.579) (-3550.128) (-3548.064) -- 0:02:53 349000 -- (-3542.349) [-3541.019] (-3550.055) (-3547.317) * (-3545.660) [-3543.237] (-3545.990) (-3546.267) -- 0:02:53 349500 -- [-3540.908] (-3553.238) (-3549.800) (-3543.600) * (-3549.847) (-3545.091) [-3540.580] (-3546.469) -- 0:02:53 350000 -- (-3544.132) (-3544.380) [-3541.542] (-3544.351) * (-3540.799) (-3548.208) [-3545.036] (-3551.487) -- 0:02:52 Average standard deviation of split frequencies: 0.001344 350500 -- (-3547.223) [-3539.740] (-3540.256) (-3546.465) * (-3542.631) [-3543.227] (-3539.891) (-3548.734) -- 0:02:52 351000 -- [-3541.299] (-3543.496) (-3542.790) (-3548.592) * [-3546.964] (-3538.520) (-3538.463) (-3545.108) -- 0:02:51 351500 -- (-3543.307) [-3543.721] (-3540.534) (-3542.299) * (-3548.196) [-3539.790] (-3546.066) (-3540.982) -- 0:02:51 352000 -- [-3541.609] (-3545.800) (-3546.956) (-3543.735) * (-3553.438) [-3541.654] (-3546.826) (-3548.621) -- 0:02:51 352500 -- (-3547.489) [-3544.925] (-3550.918) (-3545.471) * (-3551.527) [-3543.785] (-3548.089) (-3542.476) -- 0:02:52 353000 -- (-3545.715) [-3543.208] (-3545.348) (-3546.701) * [-3548.236] (-3543.078) (-3544.198) (-3540.557) -- 0:02:52 353500 -- (-3541.790) (-3549.393) (-3540.911) [-3541.516] * (-3547.087) [-3544.560] (-3551.747) (-3545.633) -- 0:02:51 354000 -- [-3543.090] (-3546.370) (-3543.294) (-3540.813) * (-3542.038) [-3546.264] (-3543.169) (-3545.745) -- 0:02:51 354500 -- (-3543.748) [-3539.755] (-3547.148) (-3541.364) * (-3545.872) [-3548.665] (-3545.797) (-3547.192) -- 0:02:51 355000 -- (-3541.847) (-3546.140) (-3542.462) [-3544.674] * (-3546.894) (-3546.509) (-3544.156) [-3549.161] -- 0:02:50 Average standard deviation of split frequencies: 0.001324 355500 -- (-3543.043) (-3545.027) (-3551.852) [-3543.579] * (-3540.127) (-3546.729) [-3542.247] (-3547.347) -- 0:02:50 356000 -- (-3544.511) (-3549.759) [-3549.522] (-3548.067) * [-3544.950] (-3543.717) (-3546.601) (-3555.498) -- 0:02:50 356500 -- [-3555.781] (-3546.021) (-3544.984) (-3544.035) * [-3543.038] (-3547.011) (-3547.436) (-3544.861) -- 0:02:51 357000 -- (-3543.979) (-3544.499) (-3544.520) [-3544.775] * (-3542.301) (-3537.997) [-3540.243] (-3544.231) -- 0:02:51 357500 -- (-3544.534) (-3549.531) (-3551.428) [-3538.522] * (-3540.061) [-3541.393] (-3545.600) (-3539.047) -- 0:02:50 358000 -- [-3539.633] (-3542.756) (-3553.617) (-3546.792) * (-3547.199) (-3545.819) [-3546.773] (-3545.224) -- 0:02:50 358500 -- [-3546.924] (-3545.109) (-3551.813) (-3545.210) * [-3546.255] (-3547.390) (-3548.065) (-3547.853) -- 0:02:49 359000 -- (-3548.787) [-3542.793] (-3553.170) (-3551.136) * (-3547.929) [-3543.809] (-3545.488) (-3542.944) -- 0:02:49 359500 -- (-3547.376) [-3542.848] (-3550.371) (-3550.167) * (-3550.159) [-3547.634] (-3544.141) (-3542.054) -- 0:02:49 360000 -- (-3544.096) [-3543.969] (-3546.991) (-3550.201) * (-3547.790) (-3543.912) (-3549.083) [-3545.916] -- 0:02:48 Average standard deviation of split frequencies: 0.001307 360500 -- (-3547.656) (-3541.396) [-3547.451] (-3547.449) * [-3540.582] (-3547.749) (-3548.695) (-3542.280) -- 0:02:50 361000 -- (-3546.305) (-3540.101) (-3543.183) [-3553.247] * (-3544.845) (-3541.809) [-3545.086] (-3545.690) -- 0:02:49 361500 -- [-3547.800] (-3549.189) (-3546.956) (-3552.802) * (-3546.070) (-3547.631) (-3550.732) [-3552.129] -- 0:02:49 362000 -- [-3552.520] (-3542.953) (-3549.436) (-3547.404) * (-3550.923) (-3546.582) [-3542.931] (-3541.714) -- 0:02:49 362500 -- [-3546.650] (-3543.494) (-3540.021) (-3547.154) * (-3548.297) (-3548.925) [-3551.406] (-3546.802) -- 0:02:48 363000 -- (-3547.528) (-3559.987) (-3548.044) [-3542.703] * [-3545.709] (-3552.216) (-3545.575) (-3543.554) -- 0:02:48 363500 -- [-3551.720] (-3548.759) (-3546.521) (-3549.404) * (-3542.136) (-3541.119) (-3544.901) [-3541.386] -- 0:02:48 364000 -- (-3547.505) (-3551.138) [-3548.870] (-3543.257) * (-3544.489) (-3548.190) (-3547.588) [-3545.611] -- 0:02:49 364500 -- [-3543.630] (-3548.942) (-3548.072) (-3539.393) * (-3546.787) (-3549.368) (-3549.444) [-3543.483] -- 0:02:49 365000 -- [-3546.799] (-3544.449) (-3542.462) (-3548.515) * [-3542.747] (-3547.710) (-3560.691) (-3551.952) -- 0:02:48 Average standard deviation of split frequencies: 0.001288 365500 -- (-3546.948) (-3555.220) (-3544.503) [-3548.222] * [-3541.981] (-3542.794) (-3553.238) (-3547.597) -- 0:02:48 366000 -- [-3543.298] (-3549.106) (-3550.272) (-3556.332) * (-3541.684) [-3543.399] (-3548.205) (-3550.432) -- 0:02:48 366500 -- [-3545.367] (-3547.267) (-3547.241) (-3554.483) * [-3542.900] (-3542.307) (-3544.225) (-3540.173) -- 0:02:47 367000 -- [-3542.248] (-3547.096) (-3552.971) (-3550.579) * (-3545.804) (-3544.176) (-3549.371) [-3542.319] -- 0:02:47 367500 -- (-3541.655) (-3542.993) [-3542.741] (-3548.230) * [-3547.748] (-3544.981) (-3553.142) (-3547.364) -- 0:02:46 368000 -- (-3547.783) [-3549.110] (-3552.861) (-3550.234) * (-3554.169) [-3541.717] (-3543.305) (-3556.066) -- 0:02:48 368500 -- (-3553.267) (-3544.812) (-3541.789) [-3544.746] * (-3548.602) [-3548.412] (-3548.335) (-3547.089) -- 0:02:47 369000 -- (-3543.711) [-3543.967] (-3541.616) (-3546.510) * (-3547.145) (-3548.556) [-3547.200] (-3551.798) -- 0:02:47 369500 -- (-3547.623) (-3546.802) (-3547.641) [-3543.751] * [-3545.729] (-3545.153) (-3552.681) (-3550.060) -- 0:02:47 370000 -- (-3546.350) (-3542.095) (-3548.484) [-3542.134] * (-3544.263) [-3548.675] (-3552.057) (-3543.386) -- 0:02:46 Average standard deviation of split frequencies: 0.001272 370500 -- (-3550.447) [-3550.772] (-3547.180) (-3548.483) * (-3546.047) (-3551.236) [-3551.289] (-3550.266) -- 0:02:46 371000 -- (-3546.981) [-3540.353] (-3549.805) (-3541.625) * [-3540.872] (-3546.433) (-3543.769) (-3549.187) -- 0:02:46 371500 -- (-3545.598) (-3548.087) [-3544.969] (-3545.950) * (-3546.653) [-3543.411] (-3544.121) (-3546.277) -- 0:02:45 372000 -- [-3549.859] (-3555.381) (-3547.970) (-3541.550) * [-3544.129] (-3545.652) (-3542.151) (-3552.333) -- 0:02:47 372500 -- (-3546.474) (-3553.538) (-3547.896) [-3542.855] * (-3546.249) (-3547.546) [-3546.556] (-3542.401) -- 0:02:46 373000 -- (-3542.906) (-3556.961) (-3544.275) [-3547.649] * (-3548.523) (-3544.651) [-3541.847] (-3550.133) -- 0:02:46 373500 -- (-3543.489) (-3556.311) [-3541.322] (-3546.207) * (-3547.198) [-3542.768] (-3547.821) (-3547.157) -- 0:02:46 374000 -- (-3544.483) (-3544.764) [-3547.199] (-3542.434) * (-3542.786) (-3541.062) (-3545.689) [-3543.144] -- 0:02:45 374500 -- [-3544.248] (-3545.244) (-3546.449) (-3542.350) * (-3544.142) (-3545.878) [-3543.915] (-3545.774) -- 0:02:45 375000 -- [-3540.575] (-3542.458) (-3559.546) (-3543.345) * [-3541.797] (-3545.424) (-3542.698) (-3544.640) -- 0:02:45 Average standard deviation of split frequencies: 0.001254 375500 -- [-3542.289] (-3541.654) (-3549.673) (-3546.989) * (-3541.383) (-3546.246) (-3546.093) [-3545.736] -- 0:02:46 376000 -- (-3543.362) [-3543.371] (-3545.407) (-3547.763) * [-3542.269] (-3540.871) (-3545.378) (-3546.493) -- 0:02:45 376500 -- (-3547.350) (-3543.710) (-3542.218) [-3546.262] * [-3550.646] (-3539.867) (-3544.653) (-3548.668) -- 0:02:45 377000 -- (-3541.778) (-3548.318) [-3543.765] (-3542.985) * (-3543.720) [-3543.877] (-3547.991) (-3545.704) -- 0:02:45 377500 -- (-3547.971) (-3547.784) [-3548.001] (-3544.011) * [-3544.486] (-3544.428) (-3549.997) (-3547.360) -- 0:02:44 378000 -- [-3548.366] (-3544.278) (-3545.288) (-3547.719) * [-3543.590] (-3559.923) (-3542.733) (-3541.460) -- 0:02:44 378500 -- (-3550.551) (-3547.667) [-3551.500] (-3543.284) * (-3544.604) (-3549.759) (-3542.021) [-3544.832] -- 0:02:44 379000 -- (-3541.750) (-3544.508) [-3540.838] (-3542.437) * (-3548.427) (-3546.540) (-3547.997) [-3539.014] -- 0:02:43 379500 -- (-3542.325) (-3547.413) [-3544.906] (-3543.934) * (-3542.745) [-3540.893] (-3548.449) (-3539.971) -- 0:02:45 380000 -- (-3550.102) [-3543.148] (-3550.687) (-3541.146) * (-3548.773) (-3545.437) (-3547.580) [-3544.051] -- 0:02:44 Average standard deviation of split frequencies: 0.001238 380500 -- (-3547.408) (-3544.612) (-3546.994) [-3543.862] * [-3546.505] (-3545.048) (-3548.522) (-3546.311) -- 0:02:44 381000 -- (-3539.880) [-3550.457] (-3539.925) (-3546.250) * (-3541.391) (-3546.349) (-3550.227) [-3541.799] -- 0:02:44 381500 -- (-3548.230) (-3545.034) (-3544.959) [-3543.234] * (-3545.591) [-3549.644] (-3550.769) (-3545.088) -- 0:02:43 382000 -- (-3546.260) (-3546.766) (-3542.886) [-3548.767] * (-3544.739) (-3543.412) (-3544.914) [-3545.510] -- 0:02:43 382500 -- (-3546.430) (-3539.215) [-3545.653] (-3550.476) * (-3543.672) (-3542.245) (-3546.948) [-3541.983] -- 0:02:43 383000 -- [-3546.538] (-3546.215) (-3544.313) (-3544.923) * (-3553.772) (-3547.114) [-3538.164] (-3544.663) -- 0:02:42 383500 -- (-3545.017) [-3542.724] (-3554.913) (-3549.852) * (-3544.270) (-3544.996) (-3548.624) [-3547.327] -- 0:02:43 384000 -- (-3547.237) (-3550.279) [-3545.172] (-3549.175) * [-3546.215] (-3543.389) (-3549.703) (-3544.104) -- 0:02:43 384500 -- [-3543.961] (-3549.481) (-3543.328) (-3552.798) * (-3548.021) (-3546.624) (-3549.937) [-3541.223] -- 0:02:43 385000 -- (-3537.378) (-3548.381) (-3550.549) [-3549.413] * [-3542.615] (-3552.741) (-3542.624) (-3541.891) -- 0:02:42 Average standard deviation of split frequencies: 0.001221 385500 -- (-3545.873) (-3552.804) [-3540.059] (-3546.536) * [-3545.446] (-3546.838) (-3545.800) (-3546.042) -- 0:02:42 386000 -- [-3546.318] (-3540.336) (-3541.991) (-3543.992) * (-3547.403) (-3546.713) [-3539.008] (-3546.535) -- 0:02:42 386500 -- (-3546.007) (-3546.573) [-3546.577] (-3545.712) * (-3547.295) (-3548.799) [-3544.242] (-3545.954) -- 0:02:41 387000 -- (-3544.897) (-3544.301) [-3545.124] (-3545.179) * (-3539.739) [-3551.027] (-3547.259) (-3546.345) -- 0:02:43 387500 -- [-3543.971] (-3542.710) (-3546.093) (-3542.880) * [-3546.963] (-3548.688) (-3549.098) (-3548.330) -- 0:02:42 388000 -- [-3544.421] (-3542.739) (-3546.894) (-3542.586) * (-3541.712) (-3546.180) [-3539.735] (-3543.008) -- 0:02:42 388500 -- (-3548.365) (-3541.241) (-3551.416) [-3545.759] * (-3549.166) [-3540.793] (-3539.203) (-3546.885) -- 0:02:42 389000 -- [-3541.886] (-3549.077) (-3556.055) (-3539.893) * (-3543.760) (-3542.436) [-3545.082] (-3552.604) -- 0:02:41 389500 -- (-3541.848) (-3538.885) [-3546.347] (-3541.844) * (-3551.218) (-3543.685) (-3543.859) [-3542.140] -- 0:02:41 390000 -- (-3541.911) (-3540.375) [-3543.601] (-3542.382) * (-3554.098) (-3547.087) (-3543.494) [-3543.852] -- 0:02:41 Average standard deviation of split frequencies: 0.001207 390500 -- (-3545.032) [-3545.437] (-3543.504) (-3549.624) * (-3546.993) (-3545.206) [-3548.971] (-3547.675) -- 0:02:40 391000 -- (-3543.495) (-3548.683) [-3552.973] (-3553.231) * (-3544.805) (-3544.771) (-3542.261) [-3545.914] -- 0:02:41 391500 -- (-3543.108) (-3555.693) (-3546.787) [-3545.712] * (-3553.765) (-3545.040) (-3544.069) [-3544.713] -- 0:02:41 392000 -- [-3545.254] (-3545.841) (-3539.421) (-3544.584) * (-3547.831) [-3542.614] (-3541.438) (-3549.529) -- 0:02:41 392500 -- (-3544.340) (-3544.896) [-3543.010] (-3543.050) * (-3547.406) (-3543.367) (-3548.525) [-3545.737] -- 0:02:40 393000 -- (-3543.729) (-3542.491) [-3541.604] (-3544.109) * (-3540.879) (-3541.871) (-3545.750) [-3547.617] -- 0:02:40 393500 -- (-3546.268) (-3548.750) [-3543.513] (-3541.742) * [-3544.706] (-3546.728) (-3541.948) (-3543.541) -- 0:02:40 394000 -- (-3546.783) (-3546.443) [-3544.750] (-3552.539) * (-3546.891) (-3541.969) (-3546.671) [-3547.220] -- 0:02:39 394500 -- (-3550.823) (-3549.377) [-3546.143] (-3542.516) * (-3554.587) (-3541.501) (-3545.046) [-3547.909] -- 0:02:39 395000 -- (-3541.974) [-3547.594] (-3545.520) (-3543.393) * [-3543.785] (-3543.486) (-3550.628) (-3545.890) -- 0:02:40 Average standard deviation of split frequencies: 0.001190 395500 -- (-3541.079) (-3550.710) [-3539.658] (-3541.375) * (-3544.938) (-3543.209) (-3540.288) [-3542.371] -- 0:02:40 396000 -- [-3544.387] (-3550.092) (-3542.806) (-3541.466) * (-3544.988) [-3550.485] (-3551.051) (-3541.603) -- 0:02:40 396500 -- (-3550.531) (-3549.904) (-3541.715) [-3540.739] * (-3547.431) (-3548.204) (-3545.937) [-3544.299] -- 0:02:39 397000 -- [-3540.741] (-3545.279) (-3546.664) (-3547.215) * (-3547.737) (-3545.496) (-3546.437) [-3551.250] -- 0:02:39 397500 -- [-3543.093] (-3544.519) (-3541.686) (-3542.489) * (-3546.886) (-3543.337) [-3545.323] (-3543.764) -- 0:02:39 398000 -- (-3540.499) (-3542.272) (-3545.237) [-3540.548] * (-3542.340) [-3545.582] (-3550.109) (-3542.850) -- 0:02:38 398500 -- (-3547.334) (-3546.994) [-3543.590] (-3552.072) * (-3549.879) (-3542.151) [-3541.043] (-3540.818) -- 0:02:39 399000 -- (-3549.272) (-3539.425) (-3544.500) [-3539.995] * (-3547.739) (-3542.978) [-3542.852] (-3545.062) -- 0:02:39 399500 -- (-3549.349) (-3543.049) [-3546.669] (-3542.474) * (-3542.945) [-3545.330] (-3546.276) (-3542.435) -- 0:02:39 400000 -- (-3544.542) [-3544.165] (-3548.920) (-3546.374) * (-3544.360) (-3544.673) (-3550.799) [-3541.131] -- 0:02:39 Average standard deviation of split frequencies: 0.001177 400500 -- [-3552.475] (-3542.791) (-3550.335) (-3546.415) * (-3553.985) [-3543.316] (-3553.539) (-3541.520) -- 0:02:38 401000 -- (-3539.956) [-3555.251] (-3542.263) (-3545.860) * (-3545.245) [-3548.200] (-3547.771) (-3543.720) -- 0:02:38 401500 -- [-3548.800] (-3543.204) (-3556.527) (-3551.793) * [-3544.163] (-3544.474) (-3541.123) (-3546.007) -- 0:02:38 402000 -- (-3554.118) (-3545.006) [-3541.121] (-3541.236) * (-3540.877) (-3542.671) (-3541.207) [-3541.672] -- 0:02:37 402500 -- [-3543.648] (-3546.053) (-3540.408) (-3542.288) * [-3544.676] (-3542.212) (-3546.270) (-3544.937) -- 0:02:38 403000 -- [-3539.673] (-3551.494) (-3540.784) (-3546.417) * (-3541.521) (-3541.499) (-3544.512) [-3542.267] -- 0:02:38 403500 -- [-3542.843] (-3546.523) (-3547.498) (-3549.254) * (-3548.047) (-3545.239) [-3543.376] (-3543.358) -- 0:02:38 404000 -- (-3544.418) [-3540.585] (-3543.923) (-3553.643) * (-3548.461) [-3542.749] (-3547.819) (-3544.951) -- 0:02:37 404500 -- [-3543.121] (-3548.038) (-3544.087) (-3547.550) * (-3556.777) (-3546.046) [-3540.265] (-3542.945) -- 0:02:37 405000 -- (-3552.109) [-3545.828] (-3546.140) (-3542.690) * (-3552.028) (-3540.368) (-3541.438) [-3541.095] -- 0:02:37 Average standard deviation of split frequencies: 0.001161 405500 -- (-3547.132) (-3541.549) (-3539.785) [-3544.436] * [-3544.549] (-3543.722) (-3543.388) (-3544.003) -- 0:02:36 406000 -- [-3544.012] (-3544.223) (-3543.320) (-3547.346) * (-3542.868) (-3544.920) [-3547.817] (-3542.170) -- 0:02:36 406500 -- [-3543.565] (-3546.071) (-3546.443) (-3540.649) * [-3544.540] (-3542.516) (-3540.118) (-3549.703) -- 0:02:37 407000 -- (-3543.088) (-3544.212) [-3544.424] (-3538.389) * [-3546.370] (-3542.979) (-3547.854) (-3545.610) -- 0:02:37 407500 -- (-3544.138) (-3543.801) [-3540.756] (-3541.580) * [-3539.831] (-3549.438) (-3554.266) (-3541.084) -- 0:02:37 408000 -- (-3545.722) (-3545.807) [-3542.101] (-3546.755) * (-3552.974) (-3548.161) (-3542.924) [-3547.876] -- 0:02:36 408500 -- [-3547.583] (-3547.541) (-3548.314) (-3549.213) * [-3550.881] (-3545.205) (-3541.065) (-3546.572) -- 0:02:36 409000 -- (-3554.876) (-3546.488) (-3546.683) [-3543.259] * (-3543.219) (-3545.851) (-3545.687) [-3542.083] -- 0:02:36 409500 -- (-3551.740) [-3540.904] (-3547.952) (-3548.197) * (-3543.523) [-3544.553] (-3550.326) (-3543.800) -- 0:02:35 410000 -- (-3545.659) [-3544.695] (-3542.493) (-3544.162) * [-3545.620] (-3542.812) (-3544.082) (-3552.988) -- 0:02:36 Average standard deviation of split frequencies: 0.001148 410500 -- [-3540.334] (-3546.573) (-3551.469) (-3540.722) * [-3541.699] (-3540.705) (-3541.813) (-3548.497) -- 0:02:36 411000 -- [-3547.780] (-3548.511) (-3545.409) (-3543.833) * (-3546.093) [-3543.088] (-3549.596) (-3541.906) -- 0:02:36 411500 -- (-3546.751) (-3551.124) (-3550.378) [-3548.063] * (-3543.603) (-3546.337) (-3546.721) [-3542.792] -- 0:02:35 412000 -- (-3543.578) (-3543.666) [-3548.440] (-3545.293) * [-3544.010] (-3545.630) (-3541.945) (-3543.488) -- 0:02:35 412500 -- [-3545.309] (-3550.221) (-3551.522) (-3545.813) * [-3546.862] (-3543.793) (-3545.008) (-3539.479) -- 0:02:35 413000 -- (-3546.436) [-3549.051] (-3547.287) (-3549.068) * (-3549.943) (-3538.582) (-3543.245) [-3540.232] -- 0:02:34 413500 -- [-3546.402] (-3552.342) (-3543.868) (-3548.480) * (-3544.467) [-3539.289] (-3543.590) (-3549.916) -- 0:02:34 414000 -- [-3543.174] (-3549.357) (-3545.361) (-3542.319) * (-3543.444) [-3543.999] (-3552.570) (-3548.153) -- 0:02:35 414500 -- [-3544.630] (-3551.831) (-3544.108) (-3542.826) * (-3546.718) [-3548.918] (-3547.694) (-3549.287) -- 0:02:35 415000 -- [-3539.439] (-3545.923) (-3542.806) (-3542.220) * (-3543.997) [-3545.400] (-3546.112) (-3540.451) -- 0:02:35 Average standard deviation of split frequencies: 0.001133 415500 -- (-3543.253) (-3547.650) (-3545.170) [-3541.740] * (-3550.950) (-3549.564) [-3543.328] (-3546.492) -- 0:02:34 416000 -- (-3541.605) [-3538.788] (-3544.132) (-3546.812) * (-3556.291) (-3549.080) [-3540.615] (-3551.291) -- 0:02:34 416500 -- (-3550.610) [-3541.558] (-3546.864) (-3537.803) * (-3548.311) (-3547.600) (-3542.955) [-3540.202] -- 0:02:34 417000 -- (-3541.583) (-3549.717) [-3545.516] (-3544.703) * (-3543.910) [-3545.785] (-3541.812) (-3542.283) -- 0:02:33 417500 -- (-3544.150) [-3541.641] (-3547.458) (-3541.677) * (-3546.205) (-3544.415) [-3544.854] (-3542.786) -- 0:02:33 418000 -- (-3544.884) (-3549.195) (-3548.996) [-3551.893] * [-3553.583] (-3538.852) (-3545.757) (-3541.548) -- 0:02:34 418500 -- (-3546.565) [-3543.052] (-3553.326) (-3546.168) * [-3548.894] (-3541.965) (-3539.728) (-3543.280) -- 0:02:34 419000 -- (-3540.837) (-3541.185) [-3555.418] (-3545.791) * (-3550.769) [-3542.209] (-3538.520) (-3544.101) -- 0:02:33 419500 -- (-3539.311) [-3541.086] (-3548.471) (-3544.300) * (-3541.536) [-3543.354] (-3539.760) (-3543.970) -- 0:02:33 420000 -- (-3543.024) [-3546.577] (-3545.748) (-3547.310) * (-3545.902) (-3544.618) [-3552.214] (-3544.651) -- 0:02:33 Average standard deviation of split frequencies: 0.001121 420500 -- [-3542.687] (-3551.998) (-3546.361) (-3547.649) * (-3548.435) [-3544.885] (-3544.745) (-3545.680) -- 0:02:32 421000 -- (-3544.702) (-3543.348) (-3543.515) [-3547.693] * (-3544.940) (-3546.299) (-3539.861) [-3542.139] -- 0:02:32 421500 -- (-3544.486) (-3549.454) (-3544.707) [-3545.205] * (-3547.935) (-3546.763) (-3545.461) [-3542.828] -- 0:02:33 422000 -- (-3550.264) (-3546.820) (-3550.133) [-3540.907] * (-3546.409) (-3544.548) [-3545.143] (-3551.748) -- 0:02:33 422500 -- (-3549.803) [-3543.826] (-3543.978) (-3543.643) * [-3547.303] (-3546.692) (-3540.592) (-3547.828) -- 0:02:33 423000 -- [-3548.218] (-3544.386) (-3547.574) (-3548.863) * (-3545.160) [-3543.441] (-3542.051) (-3551.654) -- 0:02:32 423500 -- (-3549.056) (-3544.184) (-3549.120) [-3540.725] * (-3545.522) [-3540.413] (-3548.121) (-3551.690) -- 0:02:32 424000 -- (-3544.740) (-3548.388) (-3548.542) [-3538.582] * [-3547.144] (-3545.102) (-3543.629) (-3549.851) -- 0:02:32 424500 -- (-3543.099) (-3544.096) (-3547.290) [-3546.394] * [-3548.876] (-3543.853) (-3542.587) (-3550.385) -- 0:02:31 425000 -- (-3545.647) [-3542.674] (-3548.485) (-3548.694) * (-3543.650) (-3544.625) (-3543.108) [-3538.182] -- 0:02:31 Average standard deviation of split frequencies: 0.001107 425500 -- (-3543.961) [-3543.715] (-3553.613) (-3544.111) * (-3547.702) (-3548.611) (-3541.530) [-3542.000] -- 0:02:32 426000 -- [-3541.090] (-3549.649) (-3555.287) (-3545.546) * (-3552.138) [-3544.175] (-3549.808) (-3542.579) -- 0:02:32 426500 -- (-3550.146) (-3555.477) [-3541.829] (-3543.244) * (-3544.089) (-3545.659) [-3542.992] (-3540.329) -- 0:02:31 427000 -- (-3545.815) (-3550.650) (-3548.422) [-3542.378] * (-3542.743) [-3546.516] (-3544.223) (-3541.955) -- 0:02:31 427500 -- (-3547.836) (-3551.952) (-3548.892) [-3543.889] * (-3544.528) (-3544.999) [-3550.346] (-3544.469) -- 0:02:31 428000 -- (-3554.087) (-3547.275) (-3546.563) [-3546.724] * (-3545.511) [-3545.304] (-3545.088) (-3544.333) -- 0:02:31 428500 -- (-3546.137) (-3546.561) [-3545.514] (-3547.002) * (-3549.177) (-3548.142) [-3546.884] (-3546.640) -- 0:02:30 429000 -- (-3548.325) (-3541.508) (-3548.028) [-3544.978] * (-3544.555) (-3543.916) (-3548.314) [-3542.120] -- 0:02:30 429500 -- (-3542.981) (-3550.041) (-3550.994) [-3545.609] * (-3547.918) (-3548.043) (-3540.482) [-3549.190] -- 0:02:31 430000 -- [-3545.667] (-3545.029) (-3547.722) (-3544.630) * (-3549.664) (-3543.139) (-3543.299) [-3546.658] -- 0:02:31 Average standard deviation of split frequencies: 0.001095 430500 -- [-3543.926] (-3543.679) (-3547.925) (-3544.676) * (-3544.540) (-3541.450) (-3546.629) [-3539.416] -- 0:02:30 431000 -- (-3539.822) (-3544.219) [-3546.694] (-3549.655) * [-3543.253] (-3546.181) (-3547.176) (-3552.916) -- 0:02:30 431500 -- (-3544.893) [-3539.929] (-3547.291) (-3544.358) * [-3540.482] (-3548.095) (-3544.760) (-3547.257) -- 0:02:30 432000 -- (-3541.633) (-3545.114) [-3540.065] (-3547.354) * (-3542.509) [-3547.370] (-3544.032) (-3542.909) -- 0:02:29 432500 -- (-3542.590) [-3547.601] (-3541.112) (-3541.781) * [-3549.270] (-3544.718) (-3544.629) (-3545.749) -- 0:02:29 433000 -- (-3539.480) (-3546.894) (-3544.549) [-3542.897] * (-3542.828) [-3548.505] (-3549.320) (-3555.214) -- 0:02:30 433500 -- (-3550.029) [-3543.494] (-3547.513) (-3544.562) * (-3547.922) [-3541.608] (-3543.864) (-3552.732) -- 0:02:30 434000 -- (-3546.122) (-3542.694) (-3552.162) [-3544.076] * [-3541.293] (-3550.098) (-3546.278) (-3543.965) -- 0:02:29 434500 -- (-3544.042) [-3545.601] (-3547.178) (-3552.129) * (-3541.656) [-3540.743] (-3544.392) (-3546.987) -- 0:02:29 435000 -- (-3544.829) (-3547.086) [-3546.152] (-3542.957) * (-3543.263) [-3543.607] (-3545.642) (-3543.260) -- 0:02:29 Average standard deviation of split frequencies: 0.001081 435500 -- (-3544.805) (-3542.794) [-3544.414] (-3543.642) * (-3542.697) [-3540.740] (-3543.754) (-3543.033) -- 0:02:29 436000 -- [-3546.331] (-3549.687) (-3545.619) (-3542.718) * (-3545.244) [-3546.566] (-3544.205) (-3547.856) -- 0:02:28 436500 -- [-3547.244] (-3545.431) (-3541.964) (-3548.046) * (-3543.403) (-3543.915) [-3542.597] (-3551.222) -- 0:02:28 437000 -- (-3543.788) [-3545.607] (-3552.868) (-3548.267) * (-3546.387) (-3547.190) (-3545.997) [-3546.080] -- 0:02:29 437500 -- (-3542.721) [-3544.338] (-3548.944) (-3545.221) * (-3548.078) [-3542.405] (-3547.050) (-3546.178) -- 0:02:29 438000 -- (-3544.546) [-3540.750] (-3544.195) (-3542.585) * [-3544.851] (-3545.586) (-3546.737) (-3542.837) -- 0:02:28 438500 -- (-3543.479) [-3543.961] (-3540.959) (-3549.427) * (-3549.029) (-3545.098) (-3542.948) [-3545.222] -- 0:02:28 439000 -- (-3543.390) (-3538.184) (-3541.771) [-3540.785] * (-3544.582) [-3543.504] (-3541.460) (-3543.770) -- 0:02:28 439500 -- (-3540.903) (-3548.983) (-3543.784) [-3549.369] * (-3552.925) (-3542.612) (-3545.956) [-3545.179] -- 0:02:27 440000 -- [-3539.397] (-3542.446) (-3547.211) (-3545.736) * (-3554.950) [-3543.123] (-3542.186) (-3546.808) -- 0:02:27 Average standard deviation of split frequencies: 0.001070 440500 -- (-3548.448) [-3543.931] (-3549.356) (-3544.699) * (-3548.831) (-3545.964) (-3544.801) [-3541.733] -- 0:02:27 441000 -- (-3544.974) (-3543.685) [-3542.677] (-3545.862) * (-3548.470) [-3545.788] (-3550.133) (-3546.448) -- 0:02:28 441500 -- (-3537.551) (-3546.851) (-3543.997) [-3544.280] * (-3539.536) (-3544.837) (-3547.424) [-3542.713] -- 0:02:28 442000 -- (-3547.538) (-3544.860) (-3544.666) [-3542.804] * (-3546.367) [-3544.348] (-3541.786) (-3543.912) -- 0:02:27 442500 -- (-3544.159) [-3543.170] (-3543.936) (-3541.097) * (-3543.207) (-3546.140) [-3547.076] (-3539.654) -- 0:02:27 443000 -- (-3541.666) [-3542.414] (-3549.003) (-3541.264) * [-3543.193] (-3542.653) (-3546.647) (-3543.996) -- 0:02:27 443500 -- [-3540.393] (-3544.730) (-3544.171) (-3544.300) * [-3543.427] (-3546.525) (-3544.445) (-3545.701) -- 0:02:26 444000 -- (-3543.810) (-3551.334) [-3541.528] (-3547.705) * (-3540.788) [-3540.279] (-3541.446) (-3548.165) -- 0:02:26 444500 -- [-3541.170] (-3547.635) (-3548.450) (-3543.274) * (-3541.158) (-3541.773) (-3545.719) [-3547.760] -- 0:02:26 445000 -- [-3539.072] (-3547.018) (-3539.922) (-3540.424) * (-3544.420) [-3544.055] (-3548.526) (-3545.063) -- 0:02:27 Average standard deviation of split frequencies: 0.001057 445500 -- (-3541.077) (-3542.500) [-3544.535] (-3544.902) * (-3549.635) [-3547.179] (-3547.324) (-3551.210) -- 0:02:26 446000 -- [-3541.275] (-3552.889) (-3547.500) (-3546.889) * (-3546.508) (-3540.506) [-3542.998] (-3549.807) -- 0:02:26 446500 -- [-3545.906] (-3552.564) (-3547.505) (-3548.037) * (-3541.752) (-3547.238) [-3540.921] (-3544.413) -- 0:02:26 447000 -- [-3548.501] (-3547.343) (-3549.276) (-3549.418) * (-3548.951) (-3541.301) [-3543.801] (-3545.994) -- 0:02:25 447500 -- [-3548.293] (-3539.483) (-3541.979) (-3554.434) * (-3552.404) [-3544.969] (-3547.139) (-3547.281) -- 0:02:25 448000 -- (-3544.037) (-3548.690) (-3547.990) [-3544.380] * [-3544.404] (-3548.726) (-3544.152) (-3549.642) -- 0:02:25 448500 -- [-3547.333] (-3545.527) (-3543.609) (-3542.493) * [-3542.010] (-3540.905) (-3542.422) (-3544.167) -- 0:02:26 449000 -- (-3543.946) [-3546.793] (-3547.908) (-3544.831) * [-3544.519] (-3544.654) (-3545.296) (-3542.580) -- 0:02:26 449500 -- [-3545.736] (-3551.903) (-3552.642) (-3542.597) * (-3543.311) [-3540.248] (-3545.399) (-3545.982) -- 0:02:25 450000 -- [-3546.762] (-3542.183) (-3551.525) (-3540.656) * (-3547.239) [-3539.491] (-3544.969) (-3545.189) -- 0:02:25 Average standard deviation of split frequencies: 0.001046 450500 -- (-3556.762) (-3547.171) (-3544.688) [-3541.150] * [-3546.963] (-3541.745) (-3553.015) (-3551.746) -- 0:02:25 451000 -- (-3553.542) (-3542.057) [-3542.725] (-3545.418) * (-3546.538) (-3542.065) (-3544.555) [-3543.838] -- 0:02:24 451500 -- (-3544.041) (-3541.526) (-3546.194) [-3543.716] * [-3541.423] (-3544.177) (-3551.103) (-3544.777) -- 0:02:24 452000 -- (-3550.932) [-3543.685] (-3547.245) (-3549.052) * (-3544.780) (-3544.881) [-3542.689] (-3544.452) -- 0:02:24 452500 -- [-3550.296] (-3539.717) (-3541.246) (-3548.414) * (-3546.945) (-3550.732) (-3549.837) [-3540.979] -- 0:02:25 453000 -- (-3553.407) (-3543.021) [-3540.981] (-3555.466) * (-3554.518) (-3543.243) (-3544.775) [-3542.990] -- 0:02:24 453500 -- (-3544.834) [-3542.731] (-3545.840) (-3546.956) * (-3546.668) (-3541.929) [-3548.253] (-3541.271) -- 0:02:24 454000 -- (-3546.460) [-3536.715] (-3543.913) (-3545.233) * [-3546.300] (-3550.614) (-3548.485) (-3545.399) -- 0:02:24 454500 -- [-3548.817] (-3540.516) (-3544.640) (-3545.476) * (-3540.701) (-3551.411) (-3549.931) [-3541.514] -- 0:02:24 455000 -- [-3544.943] (-3550.082) (-3544.558) (-3551.648) * (-3545.702) [-3539.748] (-3553.124) (-3541.563) -- 0:02:23 Average standard deviation of split frequencies: 0.001034 455500 -- (-3542.713) (-3543.827) [-3541.761] (-3553.266) * (-3543.307) [-3545.199] (-3550.365) (-3544.497) -- 0:02:23 456000 -- [-3547.451] (-3542.510) (-3541.793) (-3552.591) * (-3551.187) (-3548.928) [-3550.145] (-3553.862) -- 0:02:23 456500 -- (-3543.571) (-3544.805) [-3545.436] (-3551.318) * (-3545.680) (-3545.621) (-3543.583) [-3546.275] -- 0:02:24 457000 -- (-3546.293) (-3548.376) (-3550.051) [-3551.214] * (-3539.265) (-3543.911) [-3539.547] (-3547.172) -- 0:02:23 457500 -- (-3549.666) (-3544.832) [-3546.294] (-3546.749) * (-3539.150) (-3543.922) [-3540.440] (-3551.333) -- 0:02:23 458000 -- [-3546.382] (-3547.412) (-3550.432) (-3542.122) * (-3540.133) [-3543.108] (-3539.473) (-3545.979) -- 0:02:23 458500 -- [-3545.393] (-3544.410) (-3546.134) (-3547.594) * [-3547.326] (-3550.687) (-3544.977) (-3543.240) -- 0:02:22 459000 -- [-3545.848] (-3542.994) (-3543.181) (-3545.514) * [-3544.874] (-3545.728) (-3545.390) (-3543.709) -- 0:02:22 459500 -- (-3542.456) (-3549.994) [-3543.993] (-3542.765) * (-3548.715) (-3550.251) [-3543.701] (-3545.833) -- 0:02:22 460000 -- (-3542.976) (-3549.661) (-3550.714) [-3542.428] * (-3541.425) [-3543.803] (-3544.952) (-3547.385) -- 0:02:23 Average standard deviation of split frequencies: 0.001023 460500 -- [-3543.918] (-3546.805) (-3543.298) (-3542.465) * (-3540.996) [-3543.925] (-3548.313) (-3547.595) -- 0:02:22 461000 -- (-3545.131) (-3548.806) (-3547.350) [-3546.839] * (-3544.948) (-3545.900) [-3547.021] (-3554.960) -- 0:02:22 461500 -- (-3546.912) (-3547.378) [-3551.796] (-3542.392) * [-3550.583] (-3544.599) (-3544.375) (-3549.343) -- 0:02:22 462000 -- (-3542.593) [-3544.139] (-3543.843) (-3546.346) * [-3543.746] (-3540.835) (-3541.965) (-3544.781) -- 0:02:22 462500 -- (-3552.074) [-3545.789] (-3541.001) (-3541.834) * (-3544.332) (-3557.429) [-3554.614] (-3542.232) -- 0:02:21 463000 -- (-3542.992) (-3548.407) (-3544.967) [-3543.685] * (-3545.608) (-3553.657) [-3550.933] (-3546.446) -- 0:02:21 463500 -- (-3543.180) (-3554.863) [-3553.362] (-3543.122) * (-3549.096) (-3552.596) (-3550.040) [-3545.653] -- 0:02:21 464000 -- (-3542.756) (-3545.005) (-3543.306) [-3544.294] * (-3546.964) [-3545.211] (-3543.357) (-3545.909) -- 0:02:22 464500 -- (-3544.494) [-3542.553] (-3547.069) (-3545.165) * (-3541.636) (-3543.213) [-3541.136] (-3544.345) -- 0:02:21 465000 -- (-3542.836) [-3545.602] (-3549.352) (-3547.543) * (-3546.710) (-3551.659) [-3540.553] (-3540.723) -- 0:02:21 Average standard deviation of split frequencies: 0.001012 465500 -- [-3546.020] (-3546.049) (-3555.632) (-3551.852) * (-3554.835) [-3545.000] (-3542.034) (-3547.022) -- 0:02:21 466000 -- (-3548.053) [-3543.750] (-3544.012) (-3546.204) * (-3558.730) (-3547.001) [-3546.726] (-3541.341) -- 0:02:20 466500 -- [-3542.642] (-3546.902) (-3544.070) (-3540.941) * [-3549.282] (-3546.816) (-3555.114) (-3557.513) -- 0:02:20 467000 -- (-3546.673) (-3543.495) [-3544.325] (-3545.822) * [-3541.719] (-3544.275) (-3549.861) (-3543.128) -- 0:02:20 467500 -- (-3543.206) [-3541.645] (-3544.913) (-3543.953) * [-3544.392] (-3544.109) (-3548.651) (-3544.245) -- 0:02:20 468000 -- (-3553.476) (-3545.869) [-3541.399] (-3542.309) * [-3547.216] (-3545.217) (-3541.935) (-3546.384) -- 0:02:20 468500 -- (-3541.887) [-3543.561] (-3542.795) (-3548.675) * (-3548.408) (-3544.626) [-3540.057] (-3543.193) -- 0:02:20 469000 -- (-3543.672) [-3540.075] (-3543.995) (-3548.046) * (-3542.800) (-3547.223) [-3547.464] (-3543.540) -- 0:02:20 469500 -- (-3547.075) [-3545.933] (-3548.769) (-3547.892) * [-3543.658] (-3545.209) (-3542.007) (-3541.612) -- 0:02:20 470000 -- (-3544.707) [-3544.286] (-3543.088) (-3538.735) * [-3544.678] (-3548.110) (-3548.454) (-3543.857) -- 0:02:19 Average standard deviation of split frequencies: 0.001002 470500 -- [-3541.281] (-3544.840) (-3549.366) (-3539.730) * (-3545.656) (-3548.737) (-3546.336) [-3544.945] -- 0:02:19 471000 -- (-3553.098) [-3542.092] (-3548.747) (-3538.554) * (-3547.091) [-3540.308] (-3548.861) (-3542.101) -- 0:02:19 471500 -- (-3551.841) [-3547.345] (-3540.591) (-3544.870) * (-3546.772) (-3539.682) (-3552.161) [-3544.614] -- 0:02:20 472000 -- (-3546.848) [-3541.319] (-3548.566) (-3548.392) * (-3545.576) (-3543.330) (-3549.584) [-3541.827] -- 0:02:19 472500 -- (-3550.266) (-3541.394) (-3544.837) [-3548.196] * (-3548.809) (-3546.254) [-3544.358] (-3549.006) -- 0:02:19 473000 -- (-3555.436) (-3545.145) [-3542.217] (-3548.831) * (-3543.270) (-3546.311) (-3542.037) [-3548.794] -- 0:02:19 473500 -- (-3547.676) (-3547.458) [-3547.382] (-3540.920) * (-3546.796) (-3545.280) [-3547.868] (-3545.019) -- 0:02:18 474000 -- (-3545.665) (-3541.451) (-3547.542) [-3542.360] * (-3548.801) [-3549.367] (-3542.968) (-3544.858) -- 0:02:18 474500 -- (-3541.459) (-3546.197) (-3542.907) [-3542.104] * [-3536.743] (-3545.863) (-3543.617) (-3542.005) -- 0:02:18 475000 -- (-3541.383) [-3543.728] (-3546.842) (-3548.274) * (-3540.401) (-3548.380) (-3543.594) [-3545.667] -- 0:02:18 Average standard deviation of split frequencies: 0.000990 475500 -- (-3548.931) [-3542.606] (-3547.234) (-3542.460) * (-3544.367) (-3544.221) (-3541.656) [-3541.918] -- 0:02:18 476000 -- [-3547.238] (-3547.669) (-3552.653) (-3548.375) * (-3548.171) (-3542.185) (-3543.273) [-3546.663] -- 0:02:18 476500 -- (-3547.273) (-3544.486) [-3544.195] (-3548.588) * (-3542.277) (-3540.729) [-3540.711] (-3544.867) -- 0:02:18 477000 -- [-3543.369] (-3539.805) (-3547.606) (-3543.187) * [-3549.017] (-3543.417) (-3542.415) (-3547.563) -- 0:02:18 477500 -- (-3548.458) [-3553.953] (-3556.961) (-3542.941) * (-3543.963) (-3544.634) (-3545.581) [-3543.157] -- 0:02:17 478000 -- [-3543.800] (-3551.161) (-3554.667) (-3547.017) * [-3540.463] (-3541.279) (-3548.105) (-3540.570) -- 0:02:17 478500 -- (-3547.910) (-3540.005) [-3545.846] (-3542.908) * [-3549.219] (-3543.992) (-3550.504) (-3543.968) -- 0:02:17 479000 -- (-3541.932) [-3540.072] (-3548.237) (-3551.764) * [-3540.488] (-3539.089) (-3543.167) (-3547.760) -- 0:02:17 479500 -- (-3555.969) (-3544.159) (-3554.053) [-3542.515] * (-3541.980) [-3542.820] (-3541.064) (-3549.754) -- 0:02:17 480000 -- (-3543.650) (-3548.441) [-3548.558] (-3547.555) * (-3540.854) (-3542.201) [-3543.426] (-3542.354) -- 0:02:17 Average standard deviation of split frequencies: 0.000981 480500 -- (-3543.387) (-3546.235) (-3546.433) [-3545.091] * [-3539.901] (-3548.109) (-3544.679) (-3540.147) -- 0:02:17 481000 -- (-3540.219) [-3543.800] (-3546.522) (-3546.646) * (-3542.305) (-3545.154) [-3543.715] (-3544.797) -- 0:02:17 481500 -- (-3539.819) [-3543.251] (-3543.194) (-3547.283) * (-3538.612) (-3546.450) [-3544.908] (-3543.658) -- 0:02:16 482000 -- [-3538.837] (-3541.977) (-3540.717) (-3545.293) * (-3548.403) [-3542.363] (-3549.870) (-3548.544) -- 0:02:16 482500 -- [-3539.131] (-3546.028) (-3544.803) (-3545.483) * (-3545.460) (-3540.295) (-3540.184) [-3551.965] -- 0:02:16 483000 -- [-3539.659] (-3548.867) (-3541.573) (-3541.004) * (-3553.849) (-3545.152) [-3539.848] (-3540.869) -- 0:02:17 483500 -- (-3545.278) [-3545.065] (-3541.367) (-3548.429) * (-3549.692) [-3539.030] (-3538.862) (-3543.482) -- 0:02:16 484000 -- (-3543.467) (-3544.264) [-3547.402] (-3549.526) * (-3552.721) [-3541.037] (-3541.311) (-3542.468) -- 0:02:16 484500 -- (-3546.413) [-3545.993] (-3545.998) (-3548.370) * (-3549.957) (-3551.135) (-3546.854) [-3542.045] -- 0:02:16 485000 -- (-3550.713) (-3542.063) (-3546.828) [-3547.238] * (-3551.407) (-3547.474) (-3544.210) [-3544.166] -- 0:02:15 Average standard deviation of split frequencies: 0.000970 485500 -- (-3543.930) (-3548.568) [-3540.860] (-3541.669) * [-3544.082] (-3541.615) (-3541.007) (-3543.569) -- 0:02:15 486000 -- [-3541.909] (-3544.459) (-3541.015) (-3542.687) * (-3548.135) (-3544.465) [-3547.163] (-3542.085) -- 0:02:15 486500 -- (-3547.695) (-3547.780) [-3539.994] (-3547.068) * [-3543.145] (-3545.414) (-3553.413) (-3547.695) -- 0:02:15 487000 -- [-3541.165] (-3548.435) (-3543.840) (-3550.303) * (-3543.833) (-3543.693) (-3545.919) [-3541.835] -- 0:02:15 487500 -- (-3545.363) (-3547.587) [-3544.189] (-3549.227) * (-3543.374) [-3548.463] (-3544.084) (-3549.712) -- 0:02:15 488000 -- (-3543.873) [-3537.775] (-3546.809) (-3545.473) * (-3544.948) (-3543.338) (-3547.919) [-3544.061] -- 0:02:15 488500 -- (-3547.757) (-3549.573) (-3542.693) [-3548.739] * (-3545.533) [-3540.664] (-3541.742) (-3544.598) -- 0:02:15 489000 -- [-3543.617] (-3551.718) (-3552.475) (-3543.348) * (-3544.787) (-3544.304) (-3542.799) [-3544.653] -- 0:02:14 489500 -- (-3543.624) [-3543.168] (-3554.486) (-3546.763) * (-3547.686) (-3544.153) [-3540.640] (-3542.529) -- 0:02:14 490000 -- (-3552.413) [-3539.825] (-3547.652) (-3559.481) * (-3544.975) (-3551.988) (-3543.420) [-3546.314] -- 0:02:14 Average standard deviation of split frequencies: 0.000961 490500 -- (-3541.836) (-3546.867) [-3542.137] (-3553.503) * (-3548.705) (-3546.099) (-3547.563) [-3546.965] -- 0:02:13 491000 -- (-3545.508) (-3546.540) (-3542.837) [-3553.596] * (-3547.295) (-3547.396) (-3548.940) [-3543.864] -- 0:02:14 491500 -- [-3542.054] (-3543.449) (-3552.154) (-3545.717) * (-3543.397) [-3542.268] (-3548.087) (-3548.943) -- 0:02:14 492000 -- [-3540.878] (-3543.992) (-3546.251) (-3547.290) * [-3542.648] (-3541.763) (-3545.935) (-3551.962) -- 0:02:14 492500 -- (-3540.043) [-3547.976] (-3549.537) (-3549.880) * (-3549.872) (-3550.024) [-3541.962] (-3543.631) -- 0:02:13 493000 -- [-3543.445] (-3554.407) (-3547.019) (-3543.946) * (-3546.274) (-3545.238) [-3540.442] (-3546.277) -- 0:02:13 493500 -- (-3545.853) [-3545.432] (-3544.947) (-3542.672) * (-3542.467) (-3546.553) [-3540.882] (-3544.874) -- 0:02:13 494000 -- (-3545.282) (-3551.226) (-3545.296) [-3540.933] * [-3538.830] (-3552.369) (-3542.950) (-3546.915) -- 0:02:13 494500 -- (-3541.789) (-3553.522) [-3540.323] (-3543.656) * [-3543.896] (-3540.856) (-3543.213) (-3548.961) -- 0:02:13 495000 -- [-3555.939] (-3538.417) (-3546.287) (-3551.025) * (-3543.887) (-3545.510) (-3546.511) [-3547.836] -- 0:02:13 Average standard deviation of split frequencies: 0.000950 495500 -- [-3544.572] (-3544.672) (-3545.947) (-3550.026) * (-3545.525) [-3542.069] (-3547.044) (-3545.764) -- 0:02:13 496000 -- (-3541.380) (-3554.745) (-3544.731) [-3542.836] * (-3543.126) (-3542.588) [-3548.660] (-3544.266) -- 0: