--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Nov 14 15:30:46 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/216/Crtp-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4907.69         -4918.37
2      -4907.56         -4921.85
--------------------------------------
TOTAL    -4907.62         -4921.19
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.288466    0.000667    0.238942    0.338765    0.286735    979.32   1240.16    1.000
r(A<->C){all}   0.105905    0.000372    0.068212    0.143809    0.105248    946.05   1065.81    1.001
r(A<->G){all}   0.260922    0.001086    0.196278    0.323346    0.260691    973.19   1062.16    1.001
r(A<->T){all}   0.094717    0.000665    0.046369    0.146464    0.093404    793.45    831.13    1.002
r(C<->G){all}   0.049595    0.000135    0.027967    0.072366    0.048846    902.35   1079.23    1.002
r(C<->T){all}   0.378677    0.001531    0.303119    0.453190    0.378207    881.19    893.58    1.000
r(G<->T){all}   0.110184    0.000462    0.071124    0.153965    0.108901    754.92    932.77    1.000
pi(A){all}      0.247099    0.000081    0.230199    0.264466    0.247059   1218.96   1225.61    1.000
pi(C){all}      0.283665    0.000083    0.266181    0.301618    0.283630    977.77   1051.26    1.000
pi(G){all}      0.311174    0.000086    0.293118    0.329639    0.310906    993.41   1010.38    1.001
pi(T){all}      0.158061    0.000054    0.143992    0.172487    0.157944    835.94    996.05    1.002
alpha{1,2}      0.048859    0.001088    0.000123    0.108434    0.044793    999.82   1250.41    1.000
alpha{3}        3.165348    0.906004    1.619228    5.123354    3.032879   1377.99   1439.49    1.000
pinvar{all}     0.427282    0.002756    0.323126    0.524675    0.430543   1320.05   1373.22    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4585.555853
Model 2: PositiveSelection	-4585.555853
Model 0: one-ratio	-4607.919212
Model 3: discrete	-4585.289128
Model 7: beta	-4585.344644
Model 8: beta&w>1	-4585.344645


Model 0 vs 1	44.72671799999989

Model 2 vs 1	0.0

Model 8 vs 7	2.0000006770715117E-6
>C1
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEEMCPAALVPFGHATEEEEVARQTAKNMEHAELMRAD
IAQRARIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIDAEDRHAFETQVDDSRRQCER
EMLAKERRAYQKLERKQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYI
PCVASCPINCFHRRGMPDTDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSVQPNFRSVVGKALTTLNKPDLAPN
SRESGSSLKGPPPLTSPPISTSKPTAPEPKLAEAKDVPLPKSQPPVRSKM
KRNSKRAGSAVATPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK
>C2
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEDLNE
EIAEAARTQERADEDLCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSHAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EMLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACTGSMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSLPISTSKPTAPEPKLPEAQDVPLPKSQPPVRRKM
KSVSKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK
>C3
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEDLCPAALVPFGHATEEEEVAKQTAKNVEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAHYKCLQDKEEKALKEKKARKIAFNRK
AYKESLQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSPPISTPKPTAPEPKLPEAQDVPLPKSQPPVRRRM
KSISKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK
>C4
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRQYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVARQTAKNMEHAQLMRAD
IAQREKIREAEREQRIFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQLNAEDRHAFETEVDQNRRQCER
EILAKQRRAYQKLEREQDAEKLRCQRELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEDLRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVDIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREQCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQPSMKLPPMPDLTKSTQPTLRSAVGKVLNSLQKPDSAPN
ASDSASHVKGSPPSASPPVSTSKPTAPEAKDVPLPKSQPPVRRRMKSSSK
RAGSLAASPPTGNDRPAPVPNPAGTWGSGPLQPDAKKKSKooooo
>C5
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAAVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRKYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQREKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDAIQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGNHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDLYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREMCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSRDSFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKGTQPTFRSVVGKALSSLTPKARESA
TPPSASPPLSTSKPTAPEPKLPESKDVPLPKSQPPVRRKMKSSSKRASSS
ATPPPTGNDRPAPVPNPAGTWGSGPLQPDPKKKSKoooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=755 

C1              MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
C2              MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
C3              MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
C4              MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
C5              MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
                ***********************************************:**

C1              VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
C2              VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
C3              VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
C4              VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
C5              VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAAVKDVDT
                *******************************************.******

C1              KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
C2              KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEDLNE
C3              KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
C4              KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRQYNEALNE
C5              KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRKYNEALNE
                *********************************:********:*** ***

C1              EIAEAARAQERADEEMCPAALVPFGHATEEEEVARQTAKNMEHAELMRAD
C2              EIAEAARTQERADEDLCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
C3              EIAEAARAQERADEDLCPAALVPFGHATEEEEVAKQTAKNVEHAQLMRED
C4              EIAEAARAQERADEELCPAALVPFGHATEEEEVARQTAKNMEHAQLMRAD
C5              EIAEAARAQERADEELCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
                *******:******::******************:*****:***:*** *

C1              IAQRARIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
C2              IAQRAKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
C3              IAQRAKIREAEREQRVFEEQVDRAHYKCLQDKEEKALKEKKARKIAFNRK
C4              IAQREKIREAEREQRIFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
C5              IAQREKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
                **** :*********:********:*************************

C1              AYKEALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
C2              AYKEALQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
C3              AYKESLQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
C4              AYKDALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
C5              AYKDAIQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGNHVKQLRQ
                ***:::****:*******************************.*******

C1              KRQEERELQALRVSQAQQVLQKKLEERQIDAEDRHAFETQVDDSRRQCER
C2              KRQEERELQALRVSHAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
C3              KRQEERELQALRVSQAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
C4              KCQEERELQALRVAQAQQVLQKKLEDRQLNAEDRHAFETEVDQNRRQCER
C5              KCQEERELQALRVAQAQQVLQKKLEDRQIHAEDRHAFETQVDENRRQCER
                * ***********::**********:**:.*********:**:.******

C1              EMLAKERRAYQKLERKQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
C2              EMLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
C3              EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
C4              EILAKQRRAYQKLEREQDAEKLRCQRELQRFHVARRLKNAEANRFFDASQ
C5              EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
                *:***:*********:******* *:************************

C1              KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
C2              KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
C3              KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
C4              KRKRDKVKEDLRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
C5              KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
                *********:*********:******************************

C1              QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
C2              QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
C3              QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
C4              QAVDIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRIVKRSRLRDYC
C5              QAVEIMEESRKVGRPLYPIATAVDLYERQNQLDMRPEGRIVKRSRLRDYC
                ***:******************** **************:**** *****

C1              WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYI
C2              WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
C3              WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
C4              WPGFFSKAELAYRKYEQREQCREEQVADRHQIYCNSVKIKKLAEVEKPYT
C5              WPGFFSKAELAYRKYEQREMCREEQVADRHQIYCNSVKIKKLAEVEKPYT
                ******************* ***************************** 

C1              PCVASCPINCFHRRGMPDTDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
C2              PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACTGSMQVIH
C3              PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
C4              PCVASCPINCFHRRGMPATDSKESFDYARHVCYTDPPTVAACPGPMQVIH
C5              PCVASCPINCFHRRGMPATDSRDSFDYARHVCYTDPPTVAACPGPMQVIH
                ***************** ***::****.*******.******.*.*****

C1              NDPLDNQRKISQLSMKLPPMPDLTKSVQPNFRSVVGKALTTLNKPDLAPN
C2              NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
C3              NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
C4              NDPLDNQRKISQPSMKLPPMPDLTKSTQPTLRSAVGKVLNSLQKPDSAPN
C5              NDPLDNQRKISQLSMKLPPMPDLTKGTQPTFRSVVGKALSSLT-----PK
                ************ ************..** :** ***.*.:*      *:

C1              SRESGSSLKGPPPLTSPPISTSKPTAPEPKLAEAKDVPLPKSQPPVRSKM
C2              ARESGSSLKGPPPPTSLPISTSKPTAPEPKLPEAQDVPLPKSQPPVRRKM
C3              ARESGSSLKGPPPPTSPPISTPKPTAPEPKLPEAQDVPLPKSQPPVRRRM
C4              ASDSASHVKGSPPSASPPVSTSKPTAP-----EAKDVPLPKSQPPVRRRM
C5              ARESAT-----PPSASPPLSTSKPTAPEPKLPESKDVPLPKSQPPVRRKM
                : :*.:     ** :* *:**.*****     *::************ :*

C1              KRNSKRAGSAVATPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
C2              KSVSKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
C3              KSISKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
C4              KSSSKRAGSLAASPPTGNDRPAPVPNPAGTWGSGPLQPDAKKKSKooooo
C5              KSSSKRASSSATPPPTGNDRPAPVPNPAGTWGSGPLQPDPKKKSKooooo
                *  ****.* .:.**************:******.****.***:*     

C1              -----
C2              -----
C3              -----
C4              -----
C5              ooooo
                     




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  745 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  745 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15430]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [15430]--->[15210]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/216/Crtp-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.384 Mb, Max= 31.000 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEEMCPAALVPFGHATEEEEVARQTAKNMEHAELMRAD
IAQRARIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIDAEDRHAFETQVDDSRRQCER
EMLAKERRAYQKLERKQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYI
PCVASCPINCFHRRGMPDTDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSVQPNFRSVVGKALTTLNKPDLAPN
SRESGSSLKGPPPLTSPPISTSKPTAPEPKLAEAKDVPLPKSQPPVRSKM
KRNSKRAGSAVATPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
-----
>C2
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEDLNE
EIAEAARTQERADEDLCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSHAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EMLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACTGSMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSLPISTSKPTAPEPKLPEAQDVPLPKSQPPVRRKM
KSVSKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
-----
>C3
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEDLCPAALVPFGHATEEEEVAKQTAKNVEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAHYKCLQDKEEKALKEKKARKIAFNRK
AYKESLQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSPPISTPKPTAPEPKLPEAQDVPLPKSQPPVRRRM
KSISKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
-----
>C4
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRQYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVARQTAKNMEHAQLMRAD
IAQREKIREAEREQRIFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQLNAEDRHAFETEVDQNRRQCER
EILAKQRRAYQKLEREQDAEKLRCQRELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEDLRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVDIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREQCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQPSMKLPPMPDLTKSTQPTLRSAVGKVLNSLQKPDSAPN
ASDSASHVKGSPPSASPPVSTSKPTAP-----EAKDVPLPKSQPPVRRRM
KSSSKRAGSLAASPPTGNDRPAPVPNPAGTWGSGPLQPDAKKKSKooooo
-----
>C5
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAAVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRKYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQREKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDAIQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGNHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDLYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREMCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSRDSFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKGTQPTFRSVVGKALSSLT-----PK
ARESAT-----PPSASPPLSTSKPTAPEPKLPESKDVPLPKSQPPVRRKM
KSSSKRASSSATPPPTGNDRPAPVPNPAGTWGSGPLQPDPKKKSKooooo
ooooo

FORMAT of file /tmp/tmp4683471645105554761aln Not Supported[FATAL:T-COFFEE]
>C1
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEEMCPAALVPFGHATEEEEVARQTAKNMEHAELMRAD
IAQRARIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIDAEDRHAFETQVDDSRRQCER
EMLAKERRAYQKLERKQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYI
PCVASCPINCFHRRGMPDTDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSVQPNFRSVVGKALTTLNKPDLAPN
SRESGSSLKGPPPLTSPPISTSKPTAPEPKLAEAKDVPLPKSQPPVRSKM
KRNSKRAGSAVATPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
-----
>C2
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEDLNE
EIAEAARTQERADEDLCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSHAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EMLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACTGSMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSLPISTSKPTAPEPKLPEAQDVPLPKSQPPVRRKM
KSVSKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
-----
>C3
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEDLCPAALVPFGHATEEEEVAKQTAKNVEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAHYKCLQDKEEKALKEKKARKIAFNRK
AYKESLQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSPPISTPKPTAPEPKLPEAQDVPLPKSQPPVRRRM
KSISKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK-----
-----
>C4
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRQYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVARQTAKNMEHAQLMRAD
IAQREKIREAEREQRIFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQLNAEDRHAFETEVDQNRRQCER
EILAKQRRAYQKLEREQDAEKLRCQRELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEDLRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVDIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREQCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQPSMKLPPMPDLTKSTQPTLRSAVGKVLNSLQKPDSAPN
ASDSASHVKGSPPSASPPVSTSKPTAP-----EAKDVPLPKSQPPVRRRM
KSSSKRAGSLAASPPTGNDRPAPVPNPAGTWGSGPLQPDAKKKSKooooo
-----
>C5
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAAVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRKYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQREKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDAIQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGNHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDLYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREMCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSRDSFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKGTQPTFRSVVGKALSSLT-----PK
ARESAT-----PPSASPPLSTSKPTAPEPKLPESKDVPLPKSQPPVRRKM
KSSSKRASSSATPPPTGNDRPAPVPNPAGTWGSGPLQPDPKKKSKooooo
ooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:755 S:99 BS:755
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.44 C1	 C2	 95.44
TOP	    1    0	 95.44 C2	 C1	 95.44
BOT	    0    2	 95.57 C1	 C3	 95.57
TOP	    2    0	 95.57 C3	 C1	 95.57
BOT	    0    3	 91.62 C1	 C4	 91.62
TOP	    3    0	 91.62 C4	 C1	 91.62
BOT	    0    4	 92.24 C1	 C5	 92.24
TOP	    4    0	 92.24 C5	 C1	 92.24
BOT	    1    2	 98.12 C2	 C3	 98.12
TOP	    2    1	 98.12 C3	 C2	 98.12
BOT	    1    3	 91.49 C2	 C4	 91.49
TOP	    3    1	 91.49 C4	 C2	 91.49
BOT	    1    4	 93.33 C2	 C5	 93.33
TOP	    4    1	 93.33 C5	 C2	 93.33
BOT	    2    3	 91.76 C3	 C4	 91.76
TOP	    3    2	 91.76 C4	 C3	 91.76
BOT	    2    4	 93.47 C3	 C5	 93.47
TOP	    4    2	 93.47 C5	 C3	 93.47
BOT	    3    4	 94.56 C4	 C5	 94.56
TOP	    4    3	 94.56 C5	 C4	 94.56
AVG	 0	 C1	  *	 93.72
AVG	 1	 C2	  *	 94.59
AVG	 2	 C3	  *	 94.73
AVG	 3	 C4	  *	 92.36
AVG	 4	 C5	  *	 93.40
TOT	 TOT	  *	 93.76
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAATGTGTGCAAGCCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
C2              ATGAATGTGTGCAAACCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
C3              ATGAATGTGTGCAAACCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
C4              ATGAACGTGTGCAAGCCCAAGGAAGTGGGTCCCGATGGACTCTTTGTCCG
C5              ATGAATGTGTGCAAGCCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
                ***** ********.************************** ********

C1              GAAGCGCTTTACGCGGCATCCGGTGGTGATCTCGGCCAAGCGGTTTGCAG
C2              AAAACGCTTTACGCGGCATCCGGTGGTGATCTCGGCCAAGCGGTTTGCAG
C3              AAAGCGCTTTACGCGGCATCCTGTGGTGATCTCGGCCAAGCGGTTTGCAG
C4              GAAGCGCTTTACGCGTCATCCGGTGGTGATCTCGGCGAAGCGGTTTGCAG
C5              GAAGCGCTTTACGCGGCATCCGGTGGTGATCTCGGCAAAGCGGTTTGCAG
                .**.*********** ***** ************** *************

C1              CCATAAAGGGACGTTCTCGCCAGGATGAGAAGCATGCCCAAATGGAGGCC
C2              CCATAAAGGGACGTTCTCGCCAGGATGAGAAGCATGCCCAATTGGAGGCC
C3              CCATAAAGGGGCGATCTCGCCAGGATGAGAAGCATGCCCAAATGGAGGCC
C4              CCATCAAGGGCCGTTCTCGCCAGGATGAGAAACATGCCCAGCTGGAGGCC
C5              CCATTAAGGGACGTTCTCGCCAGGATGAGAAACATGCCCAATTGGAGGCC
                **** ***** **:*****************.********. ********

C1              GTCGAGGAGGAACGCAGGTATCGGCAGTACCTGAAGGACGGCAACGAGCT
C2              GTCGAGGAGGAACGCAGGTACCGGCAGTACCTGAAGGACGGCAACGAGCT
C3              GTCGAGGAGGAACGCAGGTACCGGCAGTACCTGAAGGACGGCAACGAGCT
C4              GTCGAGGAGGAGCGCAGGTACCGGCAGTACCTCAAGGACGGCAACGAGCT
C5              GTCGAGGAGGAGCGCAGGTACCGGCAGTACCTGAAGGACGGCAACGAGCT
                ***********.******** *********** *****************

C1              TCTTTGCAGCCTGTTCACAGATCCCAATGCTCCGAAGGTCAAGAAATCAG
C2              CCTGTGCAGCCTGTTCACAGATCCCAATGCTCCGAAGGTCAAGAAATCAG
C3              CCTGTGCAGCCTGTTCACAGATCCCAATGCTCCGAAGGTCAAGAAATCAG
C4              CCTGTGCAGCCTGTTCACGGATCCCAATGCTCCGAAGGTCAAGAAATCAG
C5              CTTGTGTAGTCTGTTCACGGATCCCAATGCTCCCAAGGTCAAGAAATCGG
                  * ** ** ********.************** **************.*

C1              CTAGGGCGCAGAGCAAGGAAGCCATGGCAGTGGTAAAGGATGTGGACACA
C2              CTAGGGCGCAGAGCAAGGAGGCCATGGCAGTGGTAAAGGATGTGGACACA
C3              CTAGGGCGCAGAGCAAGGAGGCCATGGCAGTGGTAAAGGATGTGGACACA
C4              CCAGGGCTCAGAGCAAGGAAGCCATGGCAGTGGTGAAGGATGTGGACACA
C5              CAAGGGCTCAGAGCAAGGAAGCCATGGCGGCAGTAAAGGACGTGGACACA
                * ***** ***********.********.* .**.***** *********

C1              AAGTTGGCGGACGAGCGGCTGCGCAAGCAAAGGATCTTGCGAGCCAATCG
C2              AAGCTAGCAGACGAGCGGCTGCGCAAGCAGAGGATCCTGCGAGCCAACCG
C3              AAGTTAGCAGACGAGCGGCTGCGCAAGCAGAGGATCCTGCGAGCCAACCG
C4              AAGCTGGCAGACGAGCGGCTGCGCAAACAGAGGATCCTGCGGGCCAACCG
C5              AAGTTGGCAGACGAGCGGCTGCGCAAGCAGAGGATCCTGCGGGCCAACCG
                *** *.**.*****************.**.****** ****.***** **

C1              TCTACTGGATCAACTGAAGCCCGGACCCCGCGCTCTGCACCAGGCGCTCA
C2              CCTACTGGATCAACTGAAGCCTGGACCCCGCGCTCTGCACCAGGCGCTCA
C3              CCTACTGGATCAACTGAAGCCTGGACCCCGCGCTCTGCACCAGGCGCTCA
C4              ACTGCTGGATCAACTGAAGCCTGGACCCCGAGCTCTGCACCAGGCTCTAC
C5              GCTACTGGATCAACTGAAGCCTGGACCCCGCGCTCTACACCAGGCTCTTC
                 **.***************** ********.*****.******** ** .

C1              TTTACAGCGAAATGATTCATCAGAGGAAGTACAATGAGGCCCTTAACGAG
C2              TTTACAGCGAAATGATTCACCAGAGGAAGTACAATGAGGACCTTAACGAG
C3              TTTACAGCGAAATGATTCACCAGAGGAAGTACAATGAGGCCCTTAACGAG
C4              TCTACAGCGAAATGATTCACCAGAGGCAGTACAATGAGGCCCTCAACGAG
C5              TGTACAGCGAAATGATTCATCAGAGGAAGTACAATGAGGCCCTTAACGAG
                * ***************** ******.************.*** ******

C1              GAGATAGCGGAGGCAGCCCGTGCCCAGGAAAGGGCCGATGAGGAGATGTG
C2              GAGATAGCGGAGGCAGCCCGTACCCAGGAAAGGGCCGATGAGGACCTGTG
C3              GAGATAGCGGAGGCAGCCCGTGCCCAGGAAAGGGCCGATGAGGACCTGTG
C4              GAGATTGCGGAGGCAGCCCGCGCCCAGGAAAGGGCCGACGAGGAGCTGTG
C5              GAGATAGCGGAGGCGGCCCGTGCCCAGGAACGGGCCGATGAGGAGTTGTG
                *****:********.***** .********.******* *****  ****

C1              TCCTGCGGCCCTGGTGCCCTTCGGCCACGCCACCGAGGAGGAGGAGGTGG
C2              TCCTGCGGCCCTGGTGCCCTTCGGCCACGCCACCGAGGAGGAGGAGGTGG
C3              TCCTGCGGCCCTGGTGCCCTTCGGCCACGCCACCGAGGAGGAGGAGGTGG
C4              TCCGGCTGCCTTGGTGCCCTTTGGCCACGCCACCGAGGAGGAGGAGGTGG
C5              TCCTGCTGCCCTAGTGCCCTTTGGCCACGCCACCGAGGAGGAGGAGGTGG
                *** ** *** *.******** ****************************

C1              CCAGGCAGACCGCGAAGAATATGGAACATGCCGAGCTCATGCGGGCGGAC
C2              CCAAGCAGACCGCTAAGAATATGGAACATGCCCAGCTCATGCGGGAGGAC
C3              CCAAGCAGACCGCTAAGAATGTGGAACATGCCCAGCTCATGCGGGAGGAC
C4              CCAGGCAGACCGCCAAGAACATGGAACATGCGCAGCTCATGCGGGCGGAC
C5              CCAAGCAGACCGCCAAGAACATGGAACATGCCCAGCTCATGCGAGAGGAC
                ***.********* ***** .**********  **********.*.****

C1              ATCGCGCAGCGGGCAAGGATCAGGGAGGCCGAGCGGGAGCAACGGGTCTT
C2              ATCGCGCAGCGGGCCAAGATCAGGGAGGCAGAGCGGGAGCAAAGGGTCTT
C3              ATCGCGCAGCGGGCGAAGATCAGGGAGGCCGAGCGGGAGCAACGGGTCTT
C4              ATCGCGCAGCGGGAGAAGATCAGGGAGGCCGAGCGGGAGCAGCGGATCTT
C5              ATCGCGCAGCGGGAGAAGATCAGGGAGGCCGAGCGGGAGCAACGGGTCTT
                *************. *.************.***********..**.****

C1              CGAGGAGCAGGTGGATCGGGCTCAGTACAAGTGTCTGCAGGACAAGGAGG
C2              CGAGGAGCAGGTGGATCGGGCGCAGTACAAGTGTCTGCAGGACAAGGAGG
C3              CGAGGAGCAGGTGGATCGGGCGCATTACAAGTGTCTGCAGGACAAGGAGG
C4              CGAGGAGCAGGTGGACCGGGCGCAGTACAAGTGTCTGCAGGACAAGGAGG
C5              CGAGGAGCAAGTGGATCGGGCGCAGTACAAGTGTCTGCAGGACAAGGAGG
                *********.***** ***** ** *************************

C1              AGAAGGCGCTCAAAGAGAAGAAGGCCCGGAAAATCGCCTTCAATCGAAAG
C2              AGAAGGCGCTCAAAGAGAAGAAGGCCCGGAAAATCGCCTTCAATCGAAAG
C3              AGAAGGCGCTCAAAGAGAAGAAGGCCCGGAAAATCGCCTTCAATCGAAAG
C4              AGAAGGCGCTCAAGGAGAAGAAGGCCCGCAAGATCGCCTTCAATCGCAAG
C5              AGAAGGCGCTAAAGGAGAAGAAGGCCCGGAAAATAGCCTTCAATCGAAAG
                **********.**.************** **.**.***********.***

C1              GCCTACAAGGAGGCCCTCCAAGAGAAGGCGGAGATTGCAGAACACGAGCG
C2              GCTTACAAGGAGGCCCTCCAAGAGAAGGCGGATATTGCAGAACATGAGCG
C3              GCTTACAAGGAGTCCCTCCAAGAGAAGGCGGATATTGCAGAACATGAGCG
C4              GCATACAAGGATGCCCTCCAGGAGAAGGCGGAGATTGCCGAACATGAGCG
C5              GCTTACAAGGATGCCATCCAGGAGAAGGCGGAGATTGCAGAGCATGAGCG
                ** ********  **.****.*********** *****.**.** *****

C1              GATTTGCGACGCCATTGACGACCGGCGCAACTGTGTTTACATCGTGGCTA
C2              GATTTGCGACGCCATTGACGACCGGCGCAACTGCGTTTACATCGTGGCTA
C3              CATTTGCGACGCCATTGACGACCGGCGCAACTGCGTTTACATCGTGGCTA
C4              CATTTGCGACGCCATTGACGACCGACGCAACTGCGTCTACATCGTGGCCA
C5              TATTTGCGACGCCATTGACGACCGGCGCAACTGCGTCTACATCGTGGCTA
                 ***********************.******** ** *********** *

C1              GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTGAAGCAGCTGCGGCAG
C2              GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTGAAGCAGCTGCGGCAG
C3              GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTAAAGCAGCTGCGGCAG
C4              GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTGAAGCAGCTGCGGCAA
C5              GTCGCAATCTGGACAGTCGCTATGGAAACCACGTGAAGCAGCTTCGGCAA
                ***************************.******.******** *****.

C1              AAGCGTCAGGAGGAGAGGGAGCTACAGGCACTCCGTGTCTCCCAGGCGCA
C2              AAGCGTCAGGAGGAGAGGGAGCTACAGGCACTCCGTGTCTCCCATGCGCA
C3              AAGCGTCAGGAAGAGAGGGAGCTACAGGCACTCCGTGTCTCCCAGGCGCA
C4              AAGTGCCAGGAGGAGAGGGAACTACAGGCACTCCGCGTCGCCCAGGCGCA
C5              AAGTGTCAGGAGGAGAGGGAGCTACAGGCACTCCGCGTCGCCCAGGCGCA
                *** * *****.********.************** *** **** *****

C1              GCAAGTGCTTCAAAAGAAGCTGGAAGAGCGCCAGATTGACGCGGAGGACC
C2              GCAAGTGCTTCAAAAGAAGCTGGAAGAGCGCCAGATTCACGCGGAGGACC
C3              GCAAGTGCTCCAAAAGAAGCTGGAAGAGCGCCAGATTCACGCGGAGGACC
C4              GCAGGTGCTGCAAAAGAAGCTCGAGGATCGGCAGTTGAACGCGGAGGATC
C5              GCAGGTGCTTCAAAAGAAGCTGGAAGATCGGCAGATACACGCGGAGGACC
                ***.***** *********** **.** ** ***:*  ********** *

C1              GCCATGCCTTTGAGACGCAGGTGGACGACAGCCGGCGTCAGTGCGAAAGG
C2              GCCATGCCTTTGAGACGCAGGTGGACGAGAACCGGCGCCAGTGCGAAAGG
C3              GCCATGCCTTTGAGACGCAGGTGGACGAGAACCGGCGCCAGTGCGAAAGG
C4              GCCACGCTTTCGAGACGGAGGTGGACCAGAACCGGCGACAGTGCGAAAGA
C5              GCCACGCTTTTGAGACGCAGGTGGACGAGAACCGCCGCCAGTGCGAAAGG
                **** ** ** ****** ******** * *.*** ** ***********.

C1              GAGATGCTGGCCAAGGAGCGCCGTGCGTATCAGAAATTGGAGCGGAAGCA
C2              GAGATGCTGGCCAAGGAGCGCCGTGCGTATCAGAAATTGGAGCGGGAGCA
C3              GAGGTGCTGGCCAAGGAGCGCCGTGCGTATCAGAAATTGGAGCGGGAGCA
C4              GAGATCCTGGCCAAGCAGCGGCGCGCGTATCAGAAACTAGAGCGGGAGCA
C5              GAGGTACTGGCCAAGGAGCGCCGGGCGTATCAGAAATTGGAGCGAGAGCA
                ***.* ********* **** ** ************ *.*****..****

C1              GGACGCCGAGAAGCTCCGCCGCCAGCAGGAGCTGCAGCGCTTCCATGTGG
C2              GGACGCCGAGAAGCTCCGCCGCCAGCAGGAGCTGCAGCGCTTCCATGTGG
C3              GGACGCCGAGAAGCTCCGCCGCCAGCAGGAGCTGCAGCGATTCCATGTGG
C4              GGACGCCGAGAAGCTCCGCTGCCAGCGGGAGCTGCAGCGCTTCCATGTGG
C5              GGACGCCGAGAAGCTCCGCCGCCAGCAAGAGCTGCAGCGCTTCCATGTGG
                ******************* ******..***********.**********

C1              CGCGCCGCCTTAAGAACGCCGAGGCGAATCGCTTCTTCGATGCCTCTCAG
C2              CGCGCCGCCTAAAGAACGCCGAGGCGAATCGCTTCTTCGATGCCTCTCAG
C3              CGCGCCGCCTAAAGAACGCCGAGGCGAATCGCTTCTTCGATGCCTCTCAG
C4              CGCGCCGCTTGAAGAACGCTGAGGCGAATCGCTTCTTCGATGCCTCCCAG
C5              CGCGCCGCTTGAAGAACGCTGAGGCGAATCGCTTCTTCGATGCCTCTCAG
                ******** * ******** ************************** ***

C1              AAGCGAAAGAGGGACAAGGTAAAGGAGGAGCTGCGCAACGTTCTCTTTGG
C2              AAGCGAAAGAGGGACAAGGTGAAGGAGGAGCTGCGCAACGTTCTCTTTGG
C3              AAGCGAAAGAGGGACAAGGTGAAGGAGGAGCTGCGCAACGTTCTCTTTGG
C4              AAGCGGAAGAGGGACAAGGTGAAGGAGGATCTGCGCAACGTGCTCTTCGG
C5              AAGCGTAAGAGGGACAAGGTGAAGGAGGAGCTGCGCAACGTTCTCTTTGG
                ***** **************.******** *********** ***** **

C1              CCAGCGGGAAGAGTTCCTCGAGAAGCGGCGCGCCGAGCTAATGAACCTGG
C2              CCAGCGGGATGAGTTCCTCGAGAAGCGGCGCGCCGAGCTAATGAACCTGG
C3              CCAGCGGGATGAGTTCCTCGAGAAGCGGCGCGCCGAGCTAATGAACCTAG
C4              CCAGCGGGAGGAGTTCCTCGAGAAGCGGCGCGCCGAGCTGATGAACCTGG
C5              CCAGCGGGAGGAGTTCCTCGAGAAGCGCCGTGCCGAACTGATGAACCTGG
                ********* ***************** ** *****.**.********.*

C1              CCGCCTGCAATGAGGATCCATACCTGGAGGATGACAAGAAGTTCTTTGAG
C2              CCGCCTGCAATGAGGATCCATACCTGGAGGATGACAAGAAGTTTTTTGAG
C3              CCGCCTGCAATGAGGATCCATACCTGGAGGATGACAAGAAGTTCTTTGAG
C4              CCGCCTGCAATGAGGATCCATACTTGGAGGACGACAAGAAGTTCTTCGAG
C5              CCGCCTGCAATGAGGATCCATACTTGGAGGACGACAAGAAGTTCTTTGAG
                *********************** ******* *********** ** ***

C1              CAGGCGGTCGAGATCATGGAGGAGTCGAGAAAGGTGGGGCGACCTCTCTA
C2              CAGGCGGTCGAGATCATGGAGGAGTCGAGGAAGGTGGGGCGACCTCTGTA
C3              CAGGCGGTCGAGATCATGGAGGAGTCGAGGAAGGTAGGGCGACCTCTGTA
C4              CAGGCGGTCGACATCATGGAGGAGTCCAGGAAGGTGGGGCGACCCCTGTA
C5              CAGGCGGTCGAGATCATGGAGGAGTCCAGGAAGGTGGGCCGGCCCCTGTA
                *********** ************** **.*****.** **.** ** **

C1              TCCCATTGCCACCGCCGTAGATCGCTACGAGCGGCAGAACCAGCTGGACA
C2              TCCCATTGCCACCGCCGTGGATCGCTACGAGCGGCAGAACCAGCTGGACA
C3              TCCCATTGCCACCGCCGTGGATCGCTACGAGCGGCAGAACCAGCTGGACA
C4              TCCCATTGCCACCGCCGTGGATCGCTACGAGCGGCAGAACCAGCTGGACA
C5              CCCAATTGCCACCGCCGTGGATCTCTACGAGCGGCAGAACCAGCTGGACA
                 **.**************.**** **************************

C1              TGCGACCAGAGGGCAGGATGGTGAAGAGAAGCAGTCTAAGGGACTACTGC
C2              TGCGACCGGAGGGCAGGATGGTGAAGAGGAGCAGTCTAAGGGACTACTGC
C3              TGCGACCGGAGGGCAGGATGGTGAAGAGGAGCAGTCTAAGGGACTACTGC
C4              TGCGACCGGAGGGCAGGATAGTGAAGAGGAGCCGTCTGAGGGACTACTGC
C5              TGCGACCGGAGGGCAGAATAGTGAAGAGGAGCCGTCTCAGGGACTACTGC
                *******.********.**.********.***.**** ************

C1              TGGCCAGGATTCTTTTCCAAGGCGGAACTGGCGTACCGCAAGTACGAGCA
C2              TGGCCAGGATTCTTTTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
C3              TGGCCAGGATTCTTTTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
C4              TGGCCGGGATTCTTCTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
C5              TGGCCTGGATTCTTTTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
                ***** ******** ***********.***** *****************

C1              GCGGGAGAAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATTTACT
C2              GCGGGAGAAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATCTACT
C3              GCGGGAGAAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATCTACT
C4              GCGGGAGCAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATCTACT
C5              GCGCGAGATGTGCCGCGAAGAGCAGGTGGCCGATCGCCACCAGATCTACT
                *** ***.:*********.************************** ****

C1              GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAGCCATACATT
C2              GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAGCCATACACT
C3              GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAGCCATACACT
C4              GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAACCATACACT
C5              GCAACTCCGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAACCATACACT
                ******* ********************************.******* *

C1              CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTTCACCGAAGGGGAATGCC
C2              CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTCCACCGCAGGGGAATGCC
C3              CCCTGTGTCGCCTCCTGTCCCATCAACTGCTTCCACCGCAGGGGAATGCC
C4              CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTCCACCGCCGGGGAATGCC
C5              CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTCCACCGCAGGGGAATGCC
                ************************** ***** *****..**********

C1              CGACACGGACAGCAAAGAGTCCTTTGACTATGGCCGTCATGTTTGCTATA
C2              CGCCACGGACAGCAAGGAGTCCTTTGACTATGGCCGTCATGTTTGCTATA
C3              CGCCACGGACAGCAAGGAGTCCTTTGACTATGGCCGTCATGTTTGCTATA
C4              CGCCACGGACAGCAAGGAGTCCTTTGACTACGCCCGTCATGTTTGCTACA
C5              CGCCACGGACAGCAGGGATTCCTTTGACTATGCCCGTCATGTTTGCTATA
                **.***********..** *********** * *************** *

C1              CGGATACTCCTACGGTCGCCGCTTGTCCCGGTCCCATGCAGGTGATCCAC
C2              CGGATACTCCAACGGTCGCCGCTTGTACCGGTTCCATGCAGGTGATCCAC
C3              CGGATACTCCAACGGTCGCCGCTTGTCCCGGTCCCATGCAGGTGATCCAC
C4              CGGATCCCCCAACGGTAGCCGCCTGTCCCGGTCCCATGCAGGTGATCCAC
C5              CGGATCCTCCAACGGTGGCCGCTTGTCCTGGTCCCATGCAGGTCATCCAC
                *****.* **:***** ***** ***.* *** ********** ******

C1              AATGACCCGCTGGATAACCAGAGGAAAATCAGCCAGCTTTCCATGAAGCT
C2              AACGACCCGCTGGATAACCAGAGGAAAATCAGCCAGCTATCCATGAAGCT
C3              AACGACCCGCTGGATAACCAGAGGAAAATCAGCCAGCTTTCCATGAAGCT
C4              AACGACCCGCTGGACAACCAGCGGAAAATTAGCCAGCCTTCCATGAAGCT
C5              AACGATCCGCTGGACAACCAGAGGAAAATTAGCCAGCTTTCCATGAAGCT
                ** ** ******** ******.******* ******* :***********

C1              GCCGCCCATGCCGGACTTGACCAAAAGTGTACAGCCCAATTTCCGAAGTG
C2              GCCACCCATGCCGGACTTGACCAAGAGTGCACAGCCCCCTTTCCGAAGTC
C3              GCCACCCATGCCGGACTTGACCAAGAGTGCACAGCCCCCTTTCCGAAGTC
C4              GCCACCCATGCCAGACTTGACCAAGAGTACTCAGCCCACTTTGCGCAGTG
C5              GCCACCCATGCCAGACTTAACCAAGGGTACTCAGCCCACTTTTCGAAGTG
                ***.********.*****.*****..**. :******..*** **.*** 

C1              TTGTGGGCAAGGCTTTGACTACCCTCAACAAACCAGACTTGGCTCCCAAT
C2              TTGTGGGCAAGGCTTTGAGTACCCTCAACAAACCTGACTTGGCTCCCAAT
C3              TTGTGGGCAAGGCTTTGAGTACCCTCAACAAACCAGACTTGGCTCCCAAT
C4              CTGTGGGCAAGGTTTTGAATTCCCTTCAGAAACCCGACTCGGCTCCCAAT
C5              TTGTGGGCAAGGCTTTGAGTTCCCTGACT---------------CCCAAA
                 *********** ***** *:**** ..                *****:

C1              TCCAGGGAATCAGGTTCCAGCCTGAAAGGTCCTCCTCCGCTTACTAGTCC
C2              GCCAGGGAATCAGGTTCCAGCCTGAAAGGTCCTCCTCCGCCTACTAGTCT
C3              GCCAGGGAATCAGGTTCCAGCCTGAAAGGTCCTCCTCCGCCTACTAGTCC
C4              GCCAGTGATTCGGCTTCACACGTGAAAGGCTCTCCTCCGTCCGCTAGTCC
C5              GCCAGGGAGTCAGCTACT---------------CCTCCGTCCGCTAGTCC
                 **** ** **.* *:*                ******   .****** 

C1              ACCCATCAGCACATCCAAGCCCACTGCACCGGAACCAAAACTTGCCGAGG
C2              ACCCATCAGCACATCCAAGCCCACTGCACCGGAGCCAAAACTTCCCGAGG
C3              ACCCATCAGCACACCCAAGCCCACTGCACCGGAACCAAAACTTCCCGAGG
C4              ACCCGTCAGCACATCCAAGCCCACTGCACCG---------------GAAG
C5              ACCCCTCAGCACATCCAAGCCCACTGCACCGGAACCAAAACTGCCAGAGT
                **** ******** *****************               **. 

C1              CCAAAGATGTGCCCCTTCCCAAATCCCAGCCTCCAGTGAGAAGTAAGATG
C2              CCCAGGATGTGCCCCTTCCCAAATCCCAGCCTCCAGTGAGACGTAAGATG
C3              CCCAGGATGTGCCTCTTCCCAAATCCCAGCCTCCAGTGAGACGTAGGATG
C4              CAAAGGATGTGCCCCTTCCCAAGTCGCAGCCTCCAGTGAGACGCAGGATG
C5              CCAAAGATGTGCCCCTTCCCAAATCGCAGCCTCCAGTGAGACGTAAGATG
                *..*.******** ********.** ***************.* *.****

C1              AAGAGGAACTCCAAAAGAGCTGGTTCCGCGGTGGCAACTCCTCCAACTGG
C2              AAGAGCGTCTCCAAGAGAGCTGGTTCCTCGGTGGCTCCTCCTCCAACTGG
C3              AAGAGCATCTCCAAGAGAGCTGGTTCCTCGGTGGCACCTCCTCCAACTGG
C4              AAGAGCAGCTCCAAGAGAGCTGGTTCCTTGGCGGCATCTCCTCCAACTGG
C5              AAGAGCAGCTCAAAGAGAGCTAGTTCCTCGGCAACACCTCCTCCAACTGG
                ***** . ***.**.******.*****  ** ..*: *************

C1              TAACGATAGGCCAGCACCCGTGCCCAATCCCACTGGAACCTGGGGATCCG
C2              TAACGATAGGCCAGCACCCGTGCCCAATCCAACTGGAACCTGGGGATCCG
C3              TAACGATAGGCCAGCACCCGTGCCCAATCCAACTGGAACCTGGGGATCCG
C4              CAACGATAGACCAGCACCCGTGCCCAATCCCGCTGGAACCTGGGGCTCCG
C5              CAACGACAGGCCAGCACCCGTGCCCAATCCCGCTGGAACCTGGGGATCCG
                 ***** **.********************..*************.****

C1              GATCCCTACAGCCAGATTCAAAGAAAAAAGCCAAG---------------
C2              GATCCCTGCAGCCAGACTCGAAGAAGAAGGCCAAG---------------
C3              GATCCCTGCAGCCAGATTCTAAGAAGAAGGCCAAG---------------
C4              GACCCCTGCAGCCGGATGCGAAGAAGAAATCCAAG---------------
C5              GACCCCTGCAGCCAGATCCGAAGAAGAAATCCAAG---------------
                ** ****.*****.**  * *****.**. *****               

C1              ---------------
C2              ---------------
C3              ---------------
C4              ---------------
C5              ---------------
                               



>C1
ATGAATGTGTGCAAGCCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
GAAGCGCTTTACGCGGCATCCGGTGGTGATCTCGGCCAAGCGGTTTGCAG
CCATAAAGGGACGTTCTCGCCAGGATGAGAAGCATGCCCAAATGGAGGCC
GTCGAGGAGGAACGCAGGTATCGGCAGTACCTGAAGGACGGCAACGAGCT
TCTTTGCAGCCTGTTCACAGATCCCAATGCTCCGAAGGTCAAGAAATCAG
CTAGGGCGCAGAGCAAGGAAGCCATGGCAGTGGTAAAGGATGTGGACACA
AAGTTGGCGGACGAGCGGCTGCGCAAGCAAAGGATCTTGCGAGCCAATCG
TCTACTGGATCAACTGAAGCCCGGACCCCGCGCTCTGCACCAGGCGCTCA
TTTACAGCGAAATGATTCATCAGAGGAAGTACAATGAGGCCCTTAACGAG
GAGATAGCGGAGGCAGCCCGTGCCCAGGAAAGGGCCGATGAGGAGATGTG
TCCTGCGGCCCTGGTGCCCTTCGGCCACGCCACCGAGGAGGAGGAGGTGG
CCAGGCAGACCGCGAAGAATATGGAACATGCCGAGCTCATGCGGGCGGAC
ATCGCGCAGCGGGCAAGGATCAGGGAGGCCGAGCGGGAGCAACGGGTCTT
CGAGGAGCAGGTGGATCGGGCTCAGTACAAGTGTCTGCAGGACAAGGAGG
AGAAGGCGCTCAAAGAGAAGAAGGCCCGGAAAATCGCCTTCAATCGAAAG
GCCTACAAGGAGGCCCTCCAAGAGAAGGCGGAGATTGCAGAACACGAGCG
GATTTGCGACGCCATTGACGACCGGCGCAACTGTGTTTACATCGTGGCTA
GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTGAAGCAGCTGCGGCAG
AAGCGTCAGGAGGAGAGGGAGCTACAGGCACTCCGTGTCTCCCAGGCGCA
GCAAGTGCTTCAAAAGAAGCTGGAAGAGCGCCAGATTGACGCGGAGGACC
GCCATGCCTTTGAGACGCAGGTGGACGACAGCCGGCGTCAGTGCGAAAGG
GAGATGCTGGCCAAGGAGCGCCGTGCGTATCAGAAATTGGAGCGGAAGCA
GGACGCCGAGAAGCTCCGCCGCCAGCAGGAGCTGCAGCGCTTCCATGTGG
CGCGCCGCCTTAAGAACGCCGAGGCGAATCGCTTCTTCGATGCCTCTCAG
AAGCGAAAGAGGGACAAGGTAAAGGAGGAGCTGCGCAACGTTCTCTTTGG
CCAGCGGGAAGAGTTCCTCGAGAAGCGGCGCGCCGAGCTAATGAACCTGG
CCGCCTGCAATGAGGATCCATACCTGGAGGATGACAAGAAGTTCTTTGAG
CAGGCGGTCGAGATCATGGAGGAGTCGAGAAAGGTGGGGCGACCTCTCTA
TCCCATTGCCACCGCCGTAGATCGCTACGAGCGGCAGAACCAGCTGGACA
TGCGACCAGAGGGCAGGATGGTGAAGAGAAGCAGTCTAAGGGACTACTGC
TGGCCAGGATTCTTTTCCAAGGCGGAACTGGCGTACCGCAAGTACGAGCA
GCGGGAGAAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATTTACT
GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAGCCATACATT
CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTTCACCGAAGGGGAATGCC
CGACACGGACAGCAAAGAGTCCTTTGACTATGGCCGTCATGTTTGCTATA
CGGATACTCCTACGGTCGCCGCTTGTCCCGGTCCCATGCAGGTGATCCAC
AATGACCCGCTGGATAACCAGAGGAAAATCAGCCAGCTTTCCATGAAGCT
GCCGCCCATGCCGGACTTGACCAAAAGTGTACAGCCCAATTTCCGAAGTG
TTGTGGGCAAGGCTTTGACTACCCTCAACAAACCAGACTTGGCTCCCAAT
TCCAGGGAATCAGGTTCCAGCCTGAAAGGTCCTCCTCCGCTTACTAGTCC
ACCCATCAGCACATCCAAGCCCACTGCACCGGAACCAAAACTTGCCGAGG
CCAAAGATGTGCCCCTTCCCAAATCCCAGCCTCCAGTGAGAAGTAAGATG
AAGAGGAACTCCAAAAGAGCTGGTTCCGCGGTGGCAACTCCTCCAACTGG
TAACGATAGGCCAGCACCCGTGCCCAATCCCACTGGAACCTGGGGATCCG
GATCCCTACAGCCAGATTCAAAGAAAAAAGCCAAG---------------
---------------
>C2
ATGAATGTGTGCAAACCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
AAAACGCTTTACGCGGCATCCGGTGGTGATCTCGGCCAAGCGGTTTGCAG
CCATAAAGGGACGTTCTCGCCAGGATGAGAAGCATGCCCAATTGGAGGCC
GTCGAGGAGGAACGCAGGTACCGGCAGTACCTGAAGGACGGCAACGAGCT
CCTGTGCAGCCTGTTCACAGATCCCAATGCTCCGAAGGTCAAGAAATCAG
CTAGGGCGCAGAGCAAGGAGGCCATGGCAGTGGTAAAGGATGTGGACACA
AAGCTAGCAGACGAGCGGCTGCGCAAGCAGAGGATCCTGCGAGCCAACCG
CCTACTGGATCAACTGAAGCCTGGACCCCGCGCTCTGCACCAGGCGCTCA
TTTACAGCGAAATGATTCACCAGAGGAAGTACAATGAGGACCTTAACGAG
GAGATAGCGGAGGCAGCCCGTACCCAGGAAAGGGCCGATGAGGACCTGTG
TCCTGCGGCCCTGGTGCCCTTCGGCCACGCCACCGAGGAGGAGGAGGTGG
CCAAGCAGACCGCTAAGAATATGGAACATGCCCAGCTCATGCGGGAGGAC
ATCGCGCAGCGGGCCAAGATCAGGGAGGCAGAGCGGGAGCAAAGGGTCTT
CGAGGAGCAGGTGGATCGGGCGCAGTACAAGTGTCTGCAGGACAAGGAGG
AGAAGGCGCTCAAAGAGAAGAAGGCCCGGAAAATCGCCTTCAATCGAAAG
GCTTACAAGGAGGCCCTCCAAGAGAAGGCGGATATTGCAGAACATGAGCG
GATTTGCGACGCCATTGACGACCGGCGCAACTGCGTTTACATCGTGGCTA
GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTGAAGCAGCTGCGGCAG
AAGCGTCAGGAGGAGAGGGAGCTACAGGCACTCCGTGTCTCCCATGCGCA
GCAAGTGCTTCAAAAGAAGCTGGAAGAGCGCCAGATTCACGCGGAGGACC
GCCATGCCTTTGAGACGCAGGTGGACGAGAACCGGCGCCAGTGCGAAAGG
GAGATGCTGGCCAAGGAGCGCCGTGCGTATCAGAAATTGGAGCGGGAGCA
GGACGCCGAGAAGCTCCGCCGCCAGCAGGAGCTGCAGCGCTTCCATGTGG
CGCGCCGCCTAAAGAACGCCGAGGCGAATCGCTTCTTCGATGCCTCTCAG
AAGCGAAAGAGGGACAAGGTGAAGGAGGAGCTGCGCAACGTTCTCTTTGG
CCAGCGGGATGAGTTCCTCGAGAAGCGGCGCGCCGAGCTAATGAACCTGG
CCGCCTGCAATGAGGATCCATACCTGGAGGATGACAAGAAGTTTTTTGAG
CAGGCGGTCGAGATCATGGAGGAGTCGAGGAAGGTGGGGCGACCTCTGTA
TCCCATTGCCACCGCCGTGGATCGCTACGAGCGGCAGAACCAGCTGGACA
TGCGACCGGAGGGCAGGATGGTGAAGAGGAGCAGTCTAAGGGACTACTGC
TGGCCAGGATTCTTTTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
GCGGGAGAAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATCTACT
GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAGCCATACACT
CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTCCACCGCAGGGGAATGCC
CGCCACGGACAGCAAGGAGTCCTTTGACTATGGCCGTCATGTTTGCTATA
CGGATACTCCAACGGTCGCCGCTTGTACCGGTTCCATGCAGGTGATCCAC
AACGACCCGCTGGATAACCAGAGGAAAATCAGCCAGCTATCCATGAAGCT
GCCACCCATGCCGGACTTGACCAAGAGTGCACAGCCCCCTTTCCGAAGTC
TTGTGGGCAAGGCTTTGAGTACCCTCAACAAACCTGACTTGGCTCCCAAT
GCCAGGGAATCAGGTTCCAGCCTGAAAGGTCCTCCTCCGCCTACTAGTCT
ACCCATCAGCACATCCAAGCCCACTGCACCGGAGCCAAAACTTCCCGAGG
CCCAGGATGTGCCCCTTCCCAAATCCCAGCCTCCAGTGAGACGTAAGATG
AAGAGCGTCTCCAAGAGAGCTGGTTCCTCGGTGGCTCCTCCTCCAACTGG
TAACGATAGGCCAGCACCCGTGCCCAATCCAACTGGAACCTGGGGATCCG
GATCCCTGCAGCCAGACTCGAAGAAGAAGGCCAAG---------------
---------------
>C3
ATGAATGTGTGCAAACCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
AAAGCGCTTTACGCGGCATCCTGTGGTGATCTCGGCCAAGCGGTTTGCAG
CCATAAAGGGGCGATCTCGCCAGGATGAGAAGCATGCCCAAATGGAGGCC
GTCGAGGAGGAACGCAGGTACCGGCAGTACCTGAAGGACGGCAACGAGCT
CCTGTGCAGCCTGTTCACAGATCCCAATGCTCCGAAGGTCAAGAAATCAG
CTAGGGCGCAGAGCAAGGAGGCCATGGCAGTGGTAAAGGATGTGGACACA
AAGTTAGCAGACGAGCGGCTGCGCAAGCAGAGGATCCTGCGAGCCAACCG
CCTACTGGATCAACTGAAGCCTGGACCCCGCGCTCTGCACCAGGCGCTCA
TTTACAGCGAAATGATTCACCAGAGGAAGTACAATGAGGCCCTTAACGAG
GAGATAGCGGAGGCAGCCCGTGCCCAGGAAAGGGCCGATGAGGACCTGTG
TCCTGCGGCCCTGGTGCCCTTCGGCCACGCCACCGAGGAGGAGGAGGTGG
CCAAGCAGACCGCTAAGAATGTGGAACATGCCCAGCTCATGCGGGAGGAC
ATCGCGCAGCGGGCGAAGATCAGGGAGGCCGAGCGGGAGCAACGGGTCTT
CGAGGAGCAGGTGGATCGGGCGCATTACAAGTGTCTGCAGGACAAGGAGG
AGAAGGCGCTCAAAGAGAAGAAGGCCCGGAAAATCGCCTTCAATCGAAAG
GCTTACAAGGAGTCCCTCCAAGAGAAGGCGGATATTGCAGAACATGAGCG
CATTTGCGACGCCATTGACGACCGGCGCAACTGCGTTTACATCGTGGCTA
GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTAAAGCAGCTGCGGCAG
AAGCGTCAGGAAGAGAGGGAGCTACAGGCACTCCGTGTCTCCCAGGCGCA
GCAAGTGCTCCAAAAGAAGCTGGAAGAGCGCCAGATTCACGCGGAGGACC
GCCATGCCTTTGAGACGCAGGTGGACGAGAACCGGCGCCAGTGCGAAAGG
GAGGTGCTGGCCAAGGAGCGCCGTGCGTATCAGAAATTGGAGCGGGAGCA
GGACGCCGAGAAGCTCCGCCGCCAGCAGGAGCTGCAGCGATTCCATGTGG
CGCGCCGCCTAAAGAACGCCGAGGCGAATCGCTTCTTCGATGCCTCTCAG
AAGCGAAAGAGGGACAAGGTGAAGGAGGAGCTGCGCAACGTTCTCTTTGG
CCAGCGGGATGAGTTCCTCGAGAAGCGGCGCGCCGAGCTAATGAACCTAG
CCGCCTGCAATGAGGATCCATACCTGGAGGATGACAAGAAGTTCTTTGAG
CAGGCGGTCGAGATCATGGAGGAGTCGAGGAAGGTAGGGCGACCTCTGTA
TCCCATTGCCACCGCCGTGGATCGCTACGAGCGGCAGAACCAGCTGGACA
TGCGACCGGAGGGCAGGATGGTGAAGAGGAGCAGTCTAAGGGACTACTGC
TGGCCAGGATTCTTTTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
GCGGGAGAAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATCTACT
GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAGCCATACACT
CCCTGTGTCGCCTCCTGTCCCATCAACTGCTTCCACCGCAGGGGAATGCC
CGCCACGGACAGCAAGGAGTCCTTTGACTATGGCCGTCATGTTTGCTATA
CGGATACTCCAACGGTCGCCGCTTGTCCCGGTCCCATGCAGGTGATCCAC
AACGACCCGCTGGATAACCAGAGGAAAATCAGCCAGCTTTCCATGAAGCT
GCCACCCATGCCGGACTTGACCAAGAGTGCACAGCCCCCTTTCCGAAGTC
TTGTGGGCAAGGCTTTGAGTACCCTCAACAAACCAGACTTGGCTCCCAAT
GCCAGGGAATCAGGTTCCAGCCTGAAAGGTCCTCCTCCGCCTACTAGTCC
ACCCATCAGCACACCCAAGCCCACTGCACCGGAACCAAAACTTCCCGAGG
CCCAGGATGTGCCTCTTCCCAAATCCCAGCCTCCAGTGAGACGTAGGATG
AAGAGCATCTCCAAGAGAGCTGGTTCCTCGGTGGCACCTCCTCCAACTGG
TAACGATAGGCCAGCACCCGTGCCCAATCCAACTGGAACCTGGGGATCCG
GATCCCTGCAGCCAGATTCTAAGAAGAAGGCCAAG---------------
---------------
>C4
ATGAACGTGTGCAAGCCCAAGGAAGTGGGTCCCGATGGACTCTTTGTCCG
GAAGCGCTTTACGCGTCATCCGGTGGTGATCTCGGCGAAGCGGTTTGCAG
CCATCAAGGGCCGTTCTCGCCAGGATGAGAAACATGCCCAGCTGGAGGCC
GTCGAGGAGGAGCGCAGGTACCGGCAGTACCTCAAGGACGGCAACGAGCT
CCTGTGCAGCCTGTTCACGGATCCCAATGCTCCGAAGGTCAAGAAATCAG
CCAGGGCTCAGAGCAAGGAAGCCATGGCAGTGGTGAAGGATGTGGACACA
AAGCTGGCAGACGAGCGGCTGCGCAAACAGAGGATCCTGCGGGCCAACCG
ACTGCTGGATCAACTGAAGCCTGGACCCCGAGCTCTGCACCAGGCTCTAC
TCTACAGCGAAATGATTCACCAGAGGCAGTACAATGAGGCCCTCAACGAG
GAGATTGCGGAGGCAGCCCGCGCCCAGGAAAGGGCCGACGAGGAGCTGTG
TCCGGCTGCCTTGGTGCCCTTTGGCCACGCCACCGAGGAGGAGGAGGTGG
CCAGGCAGACCGCCAAGAACATGGAACATGCGCAGCTCATGCGGGCGGAC
ATCGCGCAGCGGGAGAAGATCAGGGAGGCCGAGCGGGAGCAGCGGATCTT
CGAGGAGCAGGTGGACCGGGCGCAGTACAAGTGTCTGCAGGACAAGGAGG
AGAAGGCGCTCAAGGAGAAGAAGGCCCGCAAGATCGCCTTCAATCGCAAG
GCATACAAGGATGCCCTCCAGGAGAAGGCGGAGATTGCCGAACATGAGCG
CATTTGCGACGCCATTGACGACCGACGCAACTGCGTCTACATCGTGGCCA
GTCGCAATCTGGACAGTCGCTATGGAAGCCACGTGAAGCAGCTGCGGCAA
AAGTGCCAGGAGGAGAGGGAACTACAGGCACTCCGCGTCGCCCAGGCGCA
GCAGGTGCTGCAAAAGAAGCTCGAGGATCGGCAGTTGAACGCGGAGGATC
GCCACGCTTTCGAGACGGAGGTGGACCAGAACCGGCGACAGTGCGAAAGA
GAGATCCTGGCCAAGCAGCGGCGCGCGTATCAGAAACTAGAGCGGGAGCA
GGACGCCGAGAAGCTCCGCTGCCAGCGGGAGCTGCAGCGCTTCCATGTGG
CGCGCCGCTTGAAGAACGCTGAGGCGAATCGCTTCTTCGATGCCTCCCAG
AAGCGGAAGAGGGACAAGGTGAAGGAGGATCTGCGCAACGTGCTCTTCGG
CCAGCGGGAGGAGTTCCTCGAGAAGCGGCGCGCCGAGCTGATGAACCTGG
CCGCCTGCAATGAGGATCCATACTTGGAGGACGACAAGAAGTTCTTCGAG
CAGGCGGTCGACATCATGGAGGAGTCCAGGAAGGTGGGGCGACCCCTGTA
TCCCATTGCCACCGCCGTGGATCGCTACGAGCGGCAGAACCAGCTGGACA
TGCGACCGGAGGGCAGGATAGTGAAGAGGAGCCGTCTGAGGGACTACTGC
TGGCCGGGATTCTTCTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
GCGGGAGCAGTGCCGCGAGGAGCAGGTGGCCGATCGCCACCAGATCTACT
GCAACTCGGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAACCATACACT
CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTCCACCGCCGGGGAATGCC
CGCCACGGACAGCAAGGAGTCCTTTGACTACGCCCGTCATGTTTGCTACA
CGGATCCCCCAACGGTAGCCGCCTGTCCCGGTCCCATGCAGGTGATCCAC
AACGACCCGCTGGACAACCAGCGGAAAATTAGCCAGCCTTCCATGAAGCT
GCCACCCATGCCAGACTTGACCAAGAGTACTCAGCCCACTTTGCGCAGTG
CTGTGGGCAAGGTTTTGAATTCCCTTCAGAAACCCGACTCGGCTCCCAAT
GCCAGTGATTCGGCTTCACACGTGAAAGGCTCTCCTCCGTCCGCTAGTCC
ACCCGTCAGCACATCCAAGCCCACTGCACCG---------------GAAG
CAAAGGATGTGCCCCTTCCCAAGTCGCAGCCTCCAGTGAGACGCAGGATG
AAGAGCAGCTCCAAGAGAGCTGGTTCCTTGGCGGCATCTCCTCCAACTGG
CAACGATAGACCAGCACCCGTGCCCAATCCCGCTGGAACCTGGGGCTCCG
GACCCCTGCAGCCGGATGCGAAGAAGAAATCCAAG---------------
---------------
>C5
ATGAATGTGTGCAAGCCCAAGGAAGTGGGTCCCGATGGACTTTTTGTCCG
GAAGCGCTTTACGCGGCATCCGGTGGTGATCTCGGCAAAGCGGTTTGCAG
CCATTAAGGGACGTTCTCGCCAGGATGAGAAACATGCCCAATTGGAGGCC
GTCGAGGAGGAGCGCAGGTACCGGCAGTACCTGAAGGACGGCAACGAGCT
CTTGTGTAGTCTGTTCACGGATCCCAATGCTCCCAAGGTCAAGAAATCGG
CAAGGGCTCAGAGCAAGGAAGCCATGGCGGCAGTAAAGGACGTGGACACA
AAGTTGGCAGACGAGCGGCTGCGCAAGCAGAGGATCCTGCGGGCCAACCG
GCTACTGGATCAACTGAAGCCTGGACCCCGCGCTCTACACCAGGCTCTTC
TGTACAGCGAAATGATTCATCAGAGGAAGTACAATGAGGCCCTTAACGAG
GAGATAGCGGAGGCGGCCCGTGCCCAGGAACGGGCCGATGAGGAGTTGTG
TCCTGCTGCCCTAGTGCCCTTTGGCCACGCCACCGAGGAGGAGGAGGTGG
CCAAGCAGACCGCCAAGAACATGGAACATGCCCAGCTCATGCGAGAGGAC
ATCGCGCAGCGGGAGAAGATCAGGGAGGCCGAGCGGGAGCAACGGGTCTT
CGAGGAGCAAGTGGATCGGGCGCAGTACAAGTGTCTGCAGGACAAGGAGG
AGAAGGCGCTAAAGGAGAAGAAGGCCCGGAAAATAGCCTTCAATCGAAAG
GCTTACAAGGATGCCATCCAGGAGAAGGCGGAGATTGCAGAGCATGAGCG
TATTTGCGACGCCATTGACGACCGGCGCAACTGCGTCTACATCGTGGCTA
GTCGCAATCTGGACAGTCGCTATGGAAACCACGTGAAGCAGCTTCGGCAA
AAGTGTCAGGAGGAGAGGGAGCTACAGGCACTCCGCGTCGCCCAGGCGCA
GCAGGTGCTTCAAAAGAAGCTGGAAGATCGGCAGATACACGCGGAGGACC
GCCACGCTTTTGAGACGCAGGTGGACGAGAACCGCCGCCAGTGCGAAAGG
GAGGTACTGGCCAAGGAGCGCCGGGCGTATCAGAAATTGGAGCGAGAGCA
GGACGCCGAGAAGCTCCGCCGCCAGCAAGAGCTGCAGCGCTTCCATGTGG
CGCGCCGCTTGAAGAACGCTGAGGCGAATCGCTTCTTCGATGCCTCTCAG
AAGCGTAAGAGGGACAAGGTGAAGGAGGAGCTGCGCAACGTTCTCTTTGG
CCAGCGGGAGGAGTTCCTCGAGAAGCGCCGTGCCGAACTGATGAACCTGG
CCGCCTGCAATGAGGATCCATACTTGGAGGACGACAAGAAGTTCTTTGAG
CAGGCGGTCGAGATCATGGAGGAGTCCAGGAAGGTGGGCCGGCCCCTGTA
CCCAATTGCCACCGCCGTGGATCTCTACGAGCGGCAGAACCAGCTGGACA
TGCGACCGGAGGGCAGAATAGTGAAGAGGAGCCGTCTCAGGGACTACTGC
TGGCCTGGATTCTTTTCCAAGGCGGAGCTGGCCTACCGCAAGTACGAGCA
GCGCGAGATGTGCCGCGAAGAGCAGGTGGCCGATCGCCACCAGATCTACT
GCAACTCCGTGAAGATCAAGAAGCTGGCCGAGGTGGAGAAACCATACACT
CCCTGTGTCGCCTCCTGTCCCATCAATTGCTTCCACCGCAGGGGAATGCC
CGCCACGGACAGCAGGGATTCCTTTGACTATGCCCGTCATGTTTGCTATA
CGGATCCTCCAACGGTGGCCGCTTGTCCTGGTCCCATGCAGGTCATCCAC
AACGATCCGCTGGACAACCAGAGGAAAATTAGCCAGCTTTCCATGAAGCT
GCCACCCATGCCAGACTTAACCAAGGGTACTCAGCCCACTTTTCGAAGTG
TTGTGGGCAAGGCTTTGAGTTCCCTGACT---------------CCCAAA
GCCAGGGAGTCAGCTACT---------------CCTCCGTCCGCTAGTCC
ACCCCTCAGCACATCCAAGCCCACTGCACCGGAACCAAAACTGCCAGAGT
CCAAAGATGTGCCCCTTCCCAAATCGCAGCCTCCAGTGAGACGTAAGATG
AAGAGCAGCTCAAAGAGAGCTAGTTCCTCGGCAACACCTCCTCCAACTGG
CAACGACAGGCCAGCACCCGTGCCCAATCCCGCTGGAACCTGGGGATCCG
GACCCCTGCAGCCAGATCCGAAGAAGAAATCCAAG---------------
---------------
>C1
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEEMCPAALVPFGHATEEEEVARQTAKNMEHAELMRAD
IAQRARIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIDAEDRHAFETQVDDSRRQCER
EMLAKERRAYQKLERKQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYI
PCVASCPINCFHRRGMPDTDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSVQPNFRSVVGKALTTLNKPDLAPN
SRESGSSLKGPPPLTSPPISTSKPTAPEPKLAEAKDVPLPKSQPPVRSKM
KRNSKRAGSAVATPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK
>C2
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEDLNE
EIAEAARTQERADEDLCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKEALQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSHAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EMLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACTGSMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSLPISTSKPTAPEPKLPEAQDVPLPKSQPPVRRKM
KSVSKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK
>C3
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQMEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALIYSEMIHQRKYNEALNE
EIAEAARAQERADEDLCPAALVPFGHATEEEEVAKQTAKNVEHAQLMRED
IAQRAKIREAEREQRVFEEQVDRAHYKCLQDKEEKALKEKKARKIAFNRK
AYKESLQEKADIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KRQEERELQALRVSQAQQVLQKKLEERQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQRDEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRMVKRSSLRDYC
WPGFFSKAELAYRKYEQREKCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYGRHVCYTDTPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKSAQPPFRSLVGKALSTLNKPDLAPN
ARESGSSLKGPPPPTSPPISTPKPTAPEPKLPEAQDVPLPKSQPPVRRRM
KSISKRAGSSVAPPPTGNDRPAPVPNPTGTWGSGSLQPDSKKKAK
>C4
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAVVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRQYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVARQTAKNMEHAQLMRAD
IAQREKIREAEREQRIFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDALQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGSHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQLNAEDRHAFETEVDQNRRQCER
EILAKQRRAYQKLEREQDAEKLRCQRELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEDLRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVDIMEESRKVGRPLYPIATAVDRYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREQCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSKESFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQPSMKLPPMPDLTKSTQPTLRSAVGKVLNSLQKPDSAPN
ASDSASHVKGSPPSASPPVSTSKPTAPoooooEAKDVPLPKSQPPVRRRM
KSSSKRAGSLAASPPTGNDRPAPVPNPAGTWGSGPLQPDAKKKSK
>C5
MNVCKPKEVGPDGLFVRKRFTRHPVVISAKRFAAIKGRSRQDEKHAQLEA
VEEERRYRQYLKDGNELLCSLFTDPNAPKVKKSARAQSKEAMAAVKDVDT
KLADERLRKQRILRANRLLDQLKPGPRALHQALLYSEMIHQRKYNEALNE
EIAEAARAQERADEELCPAALVPFGHATEEEEVAKQTAKNMEHAQLMRED
IAQREKIREAEREQRVFEEQVDRAQYKCLQDKEEKALKEKKARKIAFNRK
AYKDAIQEKAEIAEHERICDAIDDRRNCVYIVASRNLDSRYGNHVKQLRQ
KCQEERELQALRVAQAQQVLQKKLEDRQIHAEDRHAFETQVDENRRQCER
EVLAKERRAYQKLEREQDAEKLRRQQELQRFHVARRLKNAEANRFFDASQ
KRKRDKVKEELRNVLFGQREEFLEKRRAELMNLAACNEDPYLEDDKKFFE
QAVEIMEESRKVGRPLYPIATAVDLYERQNQLDMRPEGRIVKRSRLRDYC
WPGFFSKAELAYRKYEQREMCREEQVADRHQIYCNSVKIKKLAEVEKPYT
PCVASCPINCFHRRGMPATDSRDSFDYARHVCYTDPPTVAACPGPMQVIH
NDPLDNQRKISQLSMKLPPMPDLTKGTQPTFRSVVGKALSSLToooooPK
ARESAToooooPPSASPPLSTSKPTAPEPKLPESKDVPLPKSQPPVRRKM
KSSSKRASSSATPPPTGNDRPAPVPNPAGTWGSGPLQPDPKKKSK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 2265 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479137030
      Setting output file names to "/opt/ADOPS/216/Crtp-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1632513100
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 2219259020
      Seed = 134703981
      Swapseed = 1479137030
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 61 unique site patterns
      Division 2 has 36 unique site patterns
      Division 3 has 95 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5787.984588 -- -25.624409
         Chain 2 -- -5961.322747 -- -25.624409
         Chain 3 -- -5960.867433 -- -25.624409
         Chain 4 -- -5958.664688 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5910.312986 -- -25.624409
         Chain 2 -- -5787.984588 -- -25.624409
         Chain 3 -- -5961.322747 -- -25.624409
         Chain 4 -- -5981.115025 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5787.985] (-5961.323) (-5960.867) (-5958.665) * [-5910.313] (-5787.985) (-5961.323) (-5981.115) 
        500 -- (-4994.147) [-5011.138] (-5040.755) (-5067.999) * (-5051.274) [-5020.004] (-5052.909) (-4994.390) -- 0:00:00
       1000 -- [-4945.415] (-4990.462) (-5002.267) (-5015.218) * (-5019.548) (-4986.766) (-5028.462) [-4964.239] -- 0:16:39
       1500 -- [-4918.977] (-4959.032) (-4964.724) (-4986.534) * (-4971.548) (-4962.974) (-4964.167) [-4928.450] -- 0:11:05
       2000 -- [-4913.103] (-4948.679) (-4955.496) (-4964.983) * (-4950.407) (-4944.350) (-4939.545) [-4913.489] -- 0:08:19
       2500 -- (-4911.908) (-4925.495) [-4921.616] (-4932.318) * (-4927.258) (-4932.108) [-4919.330] (-4914.685) -- 0:06:39
       3000 -- (-4912.268) (-4914.339) (-4923.619) [-4915.068] * (-4921.700) (-4932.452) [-4911.015] (-4910.573) -- 0:05:32
       3500 -- (-4910.457) [-4912.047] (-4916.756) (-4912.562) * [-4916.262] (-4921.131) (-4919.681) (-4915.506) -- 0:04:44
       4000 -- [-4908.968] (-4913.471) (-4917.619) (-4915.850) * (-4910.664) (-4919.181) [-4912.512] (-4912.039) -- 0:08:18
       4500 -- (-4913.492) (-4909.535) (-4919.007) [-4913.973] * (-4908.682) (-4917.261) [-4904.846] (-4910.422) -- 0:07:22
       5000 -- [-4907.726] (-4909.970) (-4924.762) (-4912.662) * (-4906.881) [-4910.636] (-4910.420) (-4914.170) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-4909.914) (-4911.840) (-4919.775) [-4920.997] * [-4909.609] (-4904.575) (-4913.955) (-4908.457) -- 0:06:01
       6000 -- (-4911.106) (-4916.472) [-4914.458] (-4913.271) * (-4914.048) [-4908.516] (-4909.579) (-4906.415) -- 0:05:31
       6500 -- (-4915.769) (-4913.916) (-4914.530) [-4912.849] * [-4908.879] (-4910.925) (-4916.363) (-4906.136) -- 0:05:05
       7000 -- (-4921.892) (-4912.220) (-4920.611) [-4907.711] * [-4906.279] (-4910.975) (-4912.269) (-4912.762) -- 0:07:05
       7500 -- (-4922.592) (-4910.941) [-4911.578] (-4908.102) * [-4907.332] (-4914.373) (-4907.848) (-4906.843) -- 0:06:37
       8000 -- [-4910.675] (-4910.290) (-4912.579) (-4909.738) * [-4909.224] (-4916.528) (-4908.976) (-4912.566) -- 0:06:12
       8500 -- (-4908.828) (-4910.350) (-4911.257) [-4907.323] * [-4907.890] (-4907.142) (-4917.672) (-4908.800) -- 0:05:49
       9000 -- (-4912.177) (-4909.905) (-4911.107) [-4909.548] * (-4911.142) (-4911.487) [-4911.081] (-4907.930) -- 0:05:30
       9500 -- [-4910.473] (-4912.036) (-4912.548) (-4919.056) * [-4908.925] (-4916.329) (-4911.743) (-4910.153) -- 0:05:12
      10000 -- (-4915.296) [-4924.636] (-4910.078) (-4912.948) * (-4910.369) (-4915.521) [-4911.152] (-4910.470) -- 0:06:36

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-4917.276) [-4913.783] (-4912.043) (-4911.299) * (-4920.732) (-4915.015) (-4911.226) [-4910.361] -- 0:06:16
      11000 -- (-4911.045) (-4910.001) [-4911.455] (-4914.723) * [-4915.393] (-4912.991) (-4916.974) (-4910.638) -- 0:05:59
      11500 -- (-4913.680) (-4910.645) (-4914.641) [-4908.881] * (-4910.069) (-4911.176) (-4916.864) [-4912.779] -- 0:05:43
      12000 -- (-4907.664) (-4915.997) (-4920.426) [-4914.743] * (-4905.564) [-4909.091] (-4917.254) (-4916.171) -- 0:05:29
      12500 -- [-4909.250] (-4913.539) (-4914.391) (-4907.743) * (-4910.983) [-4911.241] (-4909.960) (-4916.521) -- 0:05:16
      13000 -- (-4914.293) (-4913.391) [-4908.919] (-4908.198) * (-4909.297) [-4909.061] (-4918.525) (-4911.379) -- 0:06:19
      13500 -- (-4906.105) (-4917.024) (-4914.953) [-4906.170] * (-4912.667) [-4909.714] (-4912.570) (-4906.972) -- 0:06:05
      14000 -- (-4909.634) (-4913.282) [-4917.785] (-4917.172) * [-4915.821] (-4909.779) (-4909.656) (-4909.676) -- 0:05:52
      14500 -- (-4908.934) (-4908.854) (-4910.246) [-4910.527] * (-4915.315) (-4912.250) (-4910.462) [-4905.251] -- 0:05:39
      15000 -- (-4910.149) [-4908.992] (-4913.753) (-4909.463) * (-4919.552) (-4906.770) [-4907.733] (-4905.264) -- 0:05:28

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-4916.101) (-4909.949) (-4912.535) [-4906.650] * [-4915.334] (-4914.191) (-4913.270) (-4910.035) -- 0:05:17
      16000 -- (-4916.204) (-4914.790) (-4914.524) [-4910.902] * (-4912.823) (-4922.465) (-4908.894) [-4911.829] -- 0:06:09
      16500 -- (-4915.213) (-4908.166) (-4917.482) [-4909.855] * [-4913.008] (-4917.528) (-4913.568) (-4919.576) -- 0:05:57
      17000 -- (-4912.409) [-4911.055] (-4914.437) (-4908.068) * (-4909.098) (-4915.691) [-4915.583] (-4913.042) -- 0:05:46
      17500 -- [-4911.305] (-4913.761) (-4911.741) (-4910.567) * [-4911.052] (-4918.221) (-4905.237) (-4908.238) -- 0:05:36
      18000 -- [-4913.954] (-4916.112) (-4907.579) (-4915.016) * [-4915.002] (-4913.620) (-4905.892) (-4916.947) -- 0:05:27
      18500 -- (-4913.521) [-4913.879] (-4914.380) (-4914.544) * (-4913.608) (-4917.386) [-4907.897] (-4915.120) -- 0:05:18
      19000 -- [-4917.991] (-4909.262) (-4915.071) (-4910.197) * [-4910.411] (-4914.056) (-4909.052) (-4914.765) -- 0:05:09
      19500 -- (-4913.110) (-4913.062) (-4910.682) [-4918.052] * (-4921.911) [-4911.615] (-4912.638) (-4913.295) -- 0:05:51
      20000 -- (-4910.834) (-4913.754) [-4920.341] (-4920.063) * (-4914.861) [-4912.037] (-4913.718) (-4915.948) -- 0:05:43

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-4914.080) (-4914.277) [-4914.079] (-4911.480) * (-4916.044) [-4910.476] (-4908.830) (-4922.624) -- 0:05:34
      21000 -- (-4910.065) (-4916.827) [-4907.236] (-4914.624) * (-4914.264) (-4911.077) [-4908.905] (-4914.636) -- 0:05:26
      21500 -- [-4911.774] (-4919.400) (-4905.441) (-4914.576) * (-4917.435) (-4909.591) [-4911.104] (-4916.312) -- 0:05:18
      22000 -- (-4910.372) [-4914.481] (-4910.703) (-4911.721) * (-4908.879) (-4913.951) [-4909.687] (-4913.771) -- 0:05:11
      22500 -- [-4913.030] (-4914.828) (-4912.460) (-4916.422) * (-4912.390) (-4909.314) [-4908.217] (-4918.524) -- 0:05:47
      23000 -- (-4912.112) (-4905.646) [-4912.509] (-4913.454) * [-4907.533] (-4909.628) (-4909.091) (-4912.181) -- 0:05:39
      23500 -- (-4915.424) (-4910.764) [-4910.959] (-4913.297) * (-4912.625) (-4910.992) (-4907.644) [-4911.909] -- 0:05:32
      24000 -- (-4919.212) (-4907.211) [-4916.211] (-4914.549) * (-4911.301) (-4912.931) [-4907.149] (-4911.923) -- 0:05:25
      24500 -- (-4916.556) (-4913.154) [-4910.777] (-4912.811) * (-4911.645) (-4904.633) [-4913.263] (-4920.313) -- 0:05:18
      25000 -- [-4916.516] (-4911.896) (-4914.175) (-4909.525) * (-4911.577) [-4909.468] (-4910.534) (-4915.460) -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-4911.271) (-4916.259) [-4907.020] (-4912.042) * [-4908.448] (-4910.284) (-4906.547) (-4909.531) -- 0:05:43
      26000 -- (-4910.758) (-4910.821) [-4910.942] (-4912.172) * (-4909.947) (-4904.913) (-4912.687) [-4907.688] -- 0:05:37
      26500 -- (-4916.230) (-4908.538) [-4909.966] (-4905.611) * (-4908.388) (-4906.109) (-4913.198) [-4908.745] -- 0:05:30
      27000 -- (-4914.973) (-4905.569) [-4911.512] (-4912.038) * (-4910.549) [-4916.299] (-4914.008) (-4908.923) -- 0:05:24
      27500 -- (-4910.792) [-4911.474] (-4912.366) (-4910.094) * (-4914.549) (-4915.383) [-4906.474] (-4911.429) -- 0:05:18
      28000 -- (-4909.427) (-4920.543) [-4911.286] (-4913.931) * (-4914.640) [-4910.299] (-4913.558) (-4906.288) -- 0:05:12
      28500 -- (-4909.427) (-4907.478) [-4911.054] (-4913.307) * (-4908.471) (-4912.340) [-4909.397] (-4918.454) -- 0:05:40
      29000 -- (-4912.533) [-4910.824] (-4909.363) (-4914.590) * (-4907.463) (-4907.319) (-4912.453) [-4907.957] -- 0:05:34
      29500 -- [-4909.025] (-4909.343) (-4909.327) (-4914.802) * (-4910.149) (-4913.305) (-4926.901) [-4911.094] -- 0:05:28
      30000 -- (-4909.467) [-4908.252] (-4909.410) (-4908.671) * (-4910.197) (-4907.584) (-4906.244) [-4914.332] -- 0:05:23

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-4913.163) (-4908.130) (-4914.873) [-4911.762] * [-4907.888] (-4908.194) (-4909.703) (-4916.374) -- 0:05:17
      31000 -- [-4913.088] (-4915.131) (-4915.808) (-4914.360) * (-4907.956) [-4907.089] (-4909.959) (-4914.604) -- 0:05:12
      31500 -- (-4907.982) (-4920.865) [-4908.860] (-4915.684) * (-4907.252) [-4908.750] (-4913.356) (-4915.048) -- 0:05:38
      32000 -- (-4915.837) (-4916.782) (-4914.927) [-4908.546] * [-4909.617] (-4924.522) (-4909.936) (-4907.592) -- 0:05:32
      32500 -- (-4911.122) (-4918.349) [-4912.953] (-4913.948) * (-4910.218) (-4916.573) [-4910.700] (-4917.496) -- 0:05:27
      33000 -- (-4911.495) [-4913.889] (-4910.828) (-4916.685) * (-4911.058) (-4912.353) [-4909.931] (-4913.259) -- 0:05:22
      33500 -- [-4909.841] (-4919.666) (-4909.956) (-4916.269) * (-4911.108) (-4912.538) (-4909.157) [-4915.480] -- 0:05:17
      34000 -- (-4910.216) (-4917.641) [-4907.298] (-4918.182) * (-4906.951) (-4914.542) [-4907.968] (-4913.497) -- 0:05:12
      34500 -- (-4907.023) (-4919.419) (-4915.490) [-4914.234] * (-4914.412) (-4913.321) (-4906.392) [-4907.032] -- 0:05:07
      35000 -- (-4908.735) (-4913.158) (-4908.275) [-4909.597] * (-4915.114) [-4910.513] (-4905.944) (-4912.712) -- 0:05:30

      Average standard deviation of split frequencies: 0.006547

      35500 -- [-4908.991] (-4914.609) (-4913.452) (-4917.874) * [-4915.623] (-4909.687) (-4908.831) (-4915.214) -- 0:05:26
      36000 -- (-4910.763) (-4917.301) (-4914.791) [-4918.363] * (-4908.870) [-4912.782] (-4907.919) (-4917.755) -- 0:05:21
      36500 -- (-4911.301) (-4906.518) [-4910.624] (-4910.419) * [-4908.117] (-4909.376) (-4908.355) (-4915.138) -- 0:05:16
      37000 -- [-4914.345] (-4916.586) (-4912.246) (-4910.641) * [-4912.484] (-4913.353) (-4910.165) (-4916.370) -- 0:05:12
      37500 -- (-4910.795) (-4915.176) (-4911.036) [-4911.549] * (-4907.530) (-4915.176) [-4910.527] (-4911.008) -- 0:05:08
      38000 -- (-4921.364) [-4913.149] (-4905.661) (-4912.123) * (-4909.797) [-4909.571] (-4918.752) (-4910.513) -- 0:05:29
      38500 -- (-4914.984) (-4910.403) (-4906.752) [-4911.548] * (-4910.050) [-4909.039] (-4908.749) (-4909.040) -- 0:05:24
      39000 -- (-4914.874) (-4914.697) [-4914.974] (-4906.444) * (-4912.495) (-4910.736) (-4910.216) [-4910.637] -- 0:05:20
      39500 -- (-4909.650) (-4915.059) (-4911.336) [-4910.913] * (-4908.366) (-4908.959) [-4907.018] (-4914.872) -- 0:05:16
      40000 -- (-4913.626) [-4913.689] (-4908.998) (-4908.010) * (-4909.552) (-4913.759) [-4910.512] (-4912.672) -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-4908.420) (-4910.082) [-4909.937] (-4912.290) * (-4907.786) (-4916.547) [-4909.507] (-4907.408) -- 0:05:31
      41000 -- (-4911.747) [-4915.711] (-4912.790) (-4914.128) * [-4911.262] (-4918.407) (-4911.337) (-4911.283) -- 0:05:27
      41500 -- [-4915.154] (-4909.216) (-4909.408) (-4913.197) * (-4915.276) [-4906.842] (-4909.016) (-4917.524) -- 0:05:23
      42000 -- (-4909.367) (-4911.151) (-4908.212) [-4916.156] * (-4917.328) (-4908.215) [-4911.029] (-4910.610) -- 0:05:19
      42500 -- [-4910.300] (-4912.640) (-4910.978) (-4917.083) * [-4910.533] (-4916.963) (-4906.028) (-4914.189) -- 0:05:15
      43000 -- [-4909.361] (-4906.337) (-4915.094) (-4911.802) * [-4913.776] (-4917.059) (-4905.903) (-4912.963) -- 0:05:11
      43500 -- [-4912.667] (-4909.577) (-4906.125) (-4909.976) * (-4921.002) (-4917.550) [-4908.143] (-4911.755) -- 0:05:29
      44000 -- (-4909.250) (-4909.638) [-4910.485] (-4914.106) * (-4912.802) (-4910.675) [-4916.617] (-4922.043) -- 0:05:25
      44500 -- [-4907.682] (-4910.360) (-4912.446) (-4915.425) * (-4915.067) [-4912.035] (-4909.347) (-4914.198) -- 0:05:22
      45000 -- [-4906.074] (-4910.412) (-4911.756) (-4918.231) * (-4914.622) (-4912.936) [-4905.068] (-4912.911) -- 0:05:18

      Average standard deviation of split frequencies: 0.005124

      45500 -- (-4916.570) (-4911.840) [-4913.095] (-4910.448) * (-4911.911) (-4911.996) [-4910.669] (-4906.577) -- 0:05:14
      46000 -- (-4914.477) (-4921.091) [-4912.207] (-4906.774) * (-4910.028) (-4916.517) [-4909.716] (-4911.622) -- 0:05:11
      46500 -- (-4913.279) (-4913.556) (-4909.703) [-4911.857] * (-4914.885) [-4910.901] (-4911.482) (-4907.495) -- 0:05:28
      47000 -- (-4918.364) (-4915.788) (-4915.959) [-4908.914] * (-4919.449) (-4908.231) [-4911.071] (-4910.063) -- 0:05:24
      47500 -- (-4908.052) (-4919.738) (-4911.867) [-4908.254] * (-4921.743) (-4908.791) [-4912.168] (-4913.711) -- 0:05:20
      48000 -- [-4909.189] (-4912.617) (-4912.547) (-4914.354) * (-4917.635) [-4910.375] (-4915.506) (-4915.582) -- 0:05:17
      48500 -- (-4911.713) (-4907.016) (-4908.824) [-4909.289] * (-4911.277) [-4907.294] (-4908.030) (-4906.500) -- 0:05:13
      49000 -- [-4910.296] (-4910.160) (-4910.408) (-4909.118) * (-4913.144) (-4910.730) (-4909.403) [-4905.254] -- 0:05:10
      49500 -- [-4910.436] (-4911.882) (-4915.482) (-4914.271) * (-4912.084) [-4908.250] (-4908.046) (-4905.558) -- 0:05:26
      50000 -- [-4910.253] (-4915.283) (-4919.071) (-4912.363) * (-4914.880) (-4913.126) (-4910.440) [-4906.103] -- 0:05:23

      Average standard deviation of split frequencies: 0.004652

      50500 -- (-4911.785) (-4918.750) (-4910.999) [-4913.350] * [-4910.679] (-4907.533) (-4907.550) (-4905.556) -- 0:05:19
      51000 -- (-4914.300) [-4913.277] (-4908.571) (-4911.233) * (-4912.372) (-4906.683) [-4909.851] (-4905.226) -- 0:05:16
      51500 -- [-4908.895] (-4913.755) (-4910.545) (-4911.562) * (-4915.650) (-4911.520) [-4905.344] (-4917.189) -- 0:05:13
      52000 -- (-4919.968) [-4917.115] (-4922.334) (-4911.382) * (-4912.455) (-4912.804) [-4911.417] (-4914.216) -- 0:05:09
      52500 -- (-4918.518) [-4918.128] (-4917.161) (-4913.560) * (-4910.932) (-4914.713) [-4909.006] (-4912.942) -- 0:05:24
      53000 -- [-4920.233] (-4915.038) (-4915.597) (-4908.558) * (-4912.636) (-4910.542) [-4907.748] (-4911.214) -- 0:05:21
      53500 -- (-4925.296) [-4912.587] (-4915.382) (-4914.826) * (-4909.494) (-4920.406) (-4907.561) [-4909.473] -- 0:05:18
      54000 -- (-4924.145) [-4911.075] (-4916.517) (-4915.124) * (-4910.155) (-4915.780) [-4907.418] (-4912.293) -- 0:05:15
      54500 -- (-4918.515) (-4915.442) (-4908.555) [-4908.893] * (-4916.963) (-4920.978) [-4908.434] (-4915.659) -- 0:05:12
      55000 -- (-4919.086) [-4914.008] (-4914.910) (-4914.093) * [-4911.343] (-4913.469) (-4914.371) (-4915.722) -- 0:05:09

      Average standard deviation of split frequencies: 0.004209

      55500 -- (-4922.806) (-4919.942) (-4914.006) [-4917.036] * (-4913.175) [-4912.434] (-4919.375) (-4914.714) -- 0:05:23
      56000 -- (-4921.716) (-4923.797) (-4912.337) [-4907.599] * (-4911.155) (-4910.942) (-4919.583) [-4913.044] -- 0:05:20
      56500 -- [-4918.348] (-4913.444) (-4911.283) (-4909.723) * (-4909.122) (-4910.662) [-4912.996] (-4910.944) -- 0:05:17
      57000 -- (-4918.855) [-4910.446] (-4915.883) (-4915.675) * (-4913.104) (-4908.273) [-4915.083] (-4918.581) -- 0:05:14
      57500 -- (-4918.333) (-4908.115) [-4906.843] (-4919.607) * (-4907.644) (-4907.651) [-4906.975] (-4910.814) -- 0:05:11
      58000 -- [-4918.662] (-4909.520) (-4909.374) (-4910.973) * [-4909.119] (-4909.705) (-4911.323) (-4913.321) -- 0:05:08
      58500 -- [-4910.884] (-4909.815) (-4907.326) (-4919.347) * [-4913.776] (-4909.786) (-4911.866) (-4906.340) -- 0:05:21
      59000 -- (-4914.659) (-4911.691) [-4910.843] (-4909.841) * (-4914.970) (-4912.236) (-4911.219) [-4915.807] -- 0:05:18
      59500 -- (-4918.403) [-4912.436] (-4913.061) (-4909.914) * (-4921.460) (-4909.110) (-4919.517) [-4909.298] -- 0:05:16
      60000 -- [-4912.051] (-4917.111) (-4910.781) (-4904.136) * (-4922.474) (-4915.633) (-4910.748) [-4910.148] -- 0:05:13

      Average standard deviation of split frequencies: 0.003885

      60500 -- (-4909.943) [-4907.967] (-4914.149) (-4911.242) * (-4911.725) [-4907.845] (-4912.445) (-4911.803) -- 0:05:10
      61000 -- (-4910.652) [-4918.331] (-4913.103) (-4918.298) * (-4908.638) [-4909.615] (-4925.047) (-4928.813) -- 0:05:07
      61500 -- (-4908.011) (-4918.127) [-4915.574] (-4914.348) * [-4911.879] (-4907.161) (-4919.595) (-4919.619) -- 0:05:20
      62000 -- [-4908.152] (-4907.417) (-4915.080) (-4919.453) * (-4912.754) [-4910.872] (-4909.716) (-4916.181) -- 0:05:17
      62500 -- (-4908.453) (-4910.424) (-4919.366) [-4916.546] * (-4909.460) (-4913.416) [-4912.873] (-4909.522) -- 0:05:15
      63000 -- [-4911.065] (-4909.560) (-4916.028) (-4907.730) * (-4905.962) (-4911.936) (-4911.486) [-4912.168] -- 0:05:12
      63500 -- [-4910.517] (-4909.794) (-4916.591) (-4906.300) * (-4908.050) (-4915.726) (-4914.438) [-4907.288] -- 0:05:09
      64000 -- [-4909.045] (-4914.123) (-4916.403) (-4911.576) * (-4909.178) (-4920.748) [-4914.124] (-4918.118) -- 0:05:07
      64500 -- (-4911.995) (-4909.361) [-4912.341] (-4916.859) * (-4909.963) [-4910.584] (-4909.903) (-4912.402) -- 0:05:19
      65000 -- [-4909.235] (-4908.286) (-4921.065) (-4916.712) * (-4913.459) (-4911.357) (-4905.582) [-4913.440] -- 0:05:16

      Average standard deviation of split frequencies: 0.003571

      65500 -- (-4911.175) (-4911.059) (-4917.410) [-4905.105] * (-4912.411) (-4913.711) (-4914.719) [-4909.036] -- 0:05:13
      66000 -- (-4913.982) (-4911.529) (-4910.649) [-4910.955] * (-4911.527) (-4919.156) (-4908.869) [-4909.501] -- 0:05:11
      66500 -- (-4910.824) [-4911.295] (-4918.733) (-4914.431) * (-4916.614) (-4914.487) (-4915.381) [-4908.768] -- 0:05:08
      67000 -- (-4906.994) (-4918.463) [-4912.458] (-4913.648) * (-4917.440) [-4915.736] (-4919.403) (-4911.185) -- 0:05:06
      67500 -- [-4906.857] (-4918.726) (-4914.952) (-4907.018) * [-4913.339] (-4918.091) (-4914.972) (-4910.315) -- 0:05:17
      68000 -- (-4910.051) (-4909.431) [-4911.850] (-4906.831) * (-4914.940) (-4917.378) [-4914.224] (-4911.691) -- 0:05:15
      68500 -- (-4913.850) (-4910.243) [-4914.889] (-4906.490) * [-4913.084] (-4910.089) (-4907.114) (-4915.265) -- 0:05:12
      69000 -- (-4911.059) [-4909.730] (-4909.257) (-4908.913) * [-4912.384] (-4919.301) (-4911.913) (-4917.115) -- 0:05:10
      69500 -- [-4908.667] (-4910.557) (-4918.782) (-4911.688) * (-4913.586) (-4917.839) [-4913.496] (-4909.316) -- 0:05:07
      70000 -- (-4912.568) (-4912.459) [-4912.092] (-4911.687) * (-4909.616) (-4914.260) (-4909.371) [-4913.092] -- 0:05:05

      Average standard deviation of split frequencies: 0.003335

      70500 -- (-4922.418) [-4909.387] (-4913.128) (-4907.908) * [-4911.704] (-4910.573) (-4909.471) (-4912.528) -- 0:05:16
      71000 -- (-4921.474) (-4912.501) [-4912.772] (-4914.243) * (-4906.795) [-4911.011] (-4913.614) (-4906.045) -- 0:05:14
      71500 -- [-4910.859] (-4917.621) (-4912.621) (-4912.460) * (-4910.557) (-4907.991) (-4911.302) [-4911.303] -- 0:05:11
      72000 -- (-4910.840) (-4908.773) [-4907.779] (-4909.222) * (-4908.686) (-4915.023) [-4914.278] (-4908.609) -- 0:05:09
      72500 -- [-4910.237] (-4919.643) (-4915.926) (-4910.258) * (-4912.889) (-4917.447) (-4918.336) [-4914.758] -- 0:05:07
      73000 -- (-4906.946) (-4919.454) (-4912.966) [-4909.399] * (-4916.227) [-4911.909] (-4913.104) (-4910.752) -- 0:05:04
      73500 -- (-4912.230) (-4916.545) [-4915.370] (-4911.633) * (-4918.022) (-4924.246) [-4912.032] (-4911.564) -- 0:05:15
      74000 -- [-4910.883] (-4909.876) (-4909.430) (-4913.577) * (-4905.596) (-4909.160) [-4907.396] (-4911.681) -- 0:05:12
      74500 -- (-4920.319) [-4909.894] (-4908.710) (-4918.516) * (-4912.074) (-4909.818) [-4914.988] (-4912.619) -- 0:05:10
      75000 -- (-4915.821) [-4911.022] (-4910.412) (-4914.210) * (-4911.983) (-4908.092) (-4918.044) [-4916.455] -- 0:05:08

      Average standard deviation of split frequencies: 0.003101

      75500 -- (-4907.845) (-4910.995) (-4908.485) [-4915.180] * (-4915.950) [-4907.644] (-4915.062) (-4910.642) -- 0:05:06
      76000 -- (-4913.486) (-4917.277) (-4910.114) [-4908.784] * (-4910.605) (-4909.872) (-4914.764) [-4906.597] -- 0:05:03
      76500 -- (-4918.624) (-4917.662) [-4910.371] (-4912.035) * (-4912.409) (-4908.579) (-4914.231) [-4915.254] -- 0:05:01
      77000 -- (-4919.434) [-4907.024] (-4914.886) (-4908.841) * (-4914.121) (-4909.145) [-4910.732] (-4913.711) -- 0:05:11
      77500 -- (-4911.351) (-4916.389) (-4910.740) [-4906.412] * (-4916.778) (-4912.972) [-4908.619] (-4913.006) -- 0:05:09
      78000 -- (-4912.148) (-4919.078) [-4909.662] (-4915.746) * (-4912.349) (-4908.157) [-4915.058] (-4907.278) -- 0:05:07
      78500 -- [-4906.222] (-4918.193) (-4911.998) (-4912.381) * (-4913.059) [-4910.025] (-4917.128) (-4914.667) -- 0:05:05
      79000 -- (-4913.300) (-4907.087) [-4911.275] (-4915.246) * (-4915.514) (-4911.894) [-4913.900] (-4911.319) -- 0:05:03
      79500 -- (-4912.880) [-4910.357] (-4909.047) (-4913.815) * (-4917.164) (-4915.577) [-4914.384] (-4913.621) -- 0:05:01
      80000 -- (-4922.094) (-4909.843) [-4910.302] (-4908.907) * [-4907.890] (-4908.052) (-4912.709) (-4915.062) -- 0:05:10

      Average standard deviation of split frequencies: 0.002922

      80500 -- (-4910.963) (-4909.193) (-4912.363) [-4918.544] * (-4910.793) [-4910.757] (-4911.627) (-4916.801) -- 0:05:08
      81000 -- (-4910.438) [-4908.746] (-4914.250) (-4906.737) * (-4909.684) (-4912.609) [-4908.059] (-4920.090) -- 0:05:06
      81500 -- (-4910.514) (-4911.388) (-4917.043) [-4911.780] * [-4914.602] (-4917.949) (-4912.605) (-4917.076) -- 0:05:04
      82000 -- (-4909.812) (-4907.857) [-4916.770] (-4914.029) * (-4910.782) [-4909.174] (-4912.467) (-4906.905) -- 0:05:02
      82500 -- (-4911.965) (-4911.177) (-4909.232) [-4910.176] * [-4910.470] (-4918.625) (-4906.743) (-4907.260) -- 0:05:00
      83000 -- (-4911.911) (-4905.850) [-4911.243] (-4911.017) * (-4912.767) (-4917.673) [-4908.057] (-4907.612) -- 0:05:09
      83500 -- (-4916.117) [-4917.545] (-4915.498) (-4921.076) * (-4910.638) [-4908.791] (-4908.810) (-4924.788) -- 0:05:07
      84000 -- (-4931.074) (-4916.222) [-4911.062] (-4916.027) * [-4910.188] (-4914.760) (-4911.358) (-4915.500) -- 0:05:05
      84500 -- [-4917.133] (-4911.737) (-4909.429) (-4909.217) * (-4910.957) [-4921.301] (-4912.126) (-4910.320) -- 0:05:03
      85000 -- [-4908.353] (-4907.058) (-4913.625) (-4910.986) * [-4908.314] (-4910.721) (-4916.148) (-4910.361) -- 0:05:01

      Average standard deviation of split frequencies: 0.002741

      85500 -- (-4910.433) (-4907.839) [-4909.659] (-4911.689) * [-4911.838] (-4911.468) (-4908.564) (-4912.087) -- 0:04:59
      86000 -- (-4909.311) (-4918.962) [-4907.303] (-4913.462) * (-4922.633) [-4910.000] (-4915.727) (-4913.580) -- 0:05:08
      86500 -- [-4907.356] (-4908.247) (-4910.945) (-4916.274) * [-4912.439] (-4913.439) (-4910.334) (-4906.253) -- 0:05:06
      87000 -- (-4911.921) [-4908.178] (-4912.963) (-4913.029) * (-4911.586) (-4906.328) (-4918.887) [-4910.375] -- 0:05:04
      87500 -- (-4914.199) (-4914.312) (-4909.129) [-4907.254] * [-4909.609] (-4908.956) (-4907.657) (-4909.132) -- 0:05:02
      88000 -- (-4910.764) (-4912.858) [-4907.173] (-4910.579) * (-4916.394) (-4911.053) (-4905.364) [-4911.219] -- 0:05:00
      88500 -- (-4908.890) (-4911.820) [-4912.503] (-4906.455) * (-4909.328) [-4908.741] (-4904.180) (-4912.622) -- 0:04:58
      89000 -- (-4922.192) (-4914.915) (-4913.565) [-4912.419] * (-4909.281) [-4915.938] (-4907.804) (-4913.265) -- 0:05:07
      89500 -- (-4909.040) [-4909.219] (-4911.318) (-4915.030) * (-4912.237) [-4910.522] (-4906.395) (-4920.709) -- 0:05:05
      90000 -- (-4911.309) (-4907.803) [-4919.028] (-4910.391) * (-4915.043) (-4910.967) [-4907.778] (-4912.608) -- 0:05:03

      Average standard deviation of split frequencies: 0.002600

      90500 -- (-4916.888) (-4916.685) [-4915.132] (-4910.346) * (-4909.833) (-4923.090) (-4908.440) [-4912.721] -- 0:05:01
      91000 -- [-4913.895] (-4912.436) (-4923.275) (-4913.349) * (-4906.468) (-4918.684) [-4905.330] (-4913.543) -- 0:04:59
      91500 -- (-4920.744) [-4912.429] (-4918.069) (-4918.891) * (-4916.795) [-4910.998] (-4906.584) (-4916.517) -- 0:04:57
      92000 -- (-4915.825) [-4911.237] (-4915.312) (-4918.432) * (-4910.324) (-4917.284) [-4910.061] (-4912.217) -- 0:05:05
      92500 -- (-4915.846) (-4910.594) (-4915.669) [-4915.144] * (-4908.554) (-4911.810) (-4906.472) [-4908.646] -- 0:05:04
      93000 -- (-4918.960) (-4908.216) [-4910.484] (-4917.083) * (-4911.473) (-4909.493) [-4911.271] (-4913.494) -- 0:05:02
      93500 -- (-4910.710) (-4915.891) (-4910.296) [-4908.855] * (-4907.138) (-4917.770) (-4910.675) [-4917.841] -- 0:05:00
      94000 -- (-4916.082) (-4913.182) (-4913.482) [-4911.061] * (-4922.190) (-4911.227) [-4909.207] (-4914.665) -- 0:04:58
      94500 -- (-4910.978) (-4910.353) (-4915.963) [-4905.746] * (-4916.545) [-4907.333] (-4912.881) (-4910.347) -- 0:04:57
      95000 -- (-4911.471) (-4906.658) [-4907.824] (-4906.466) * [-4908.020] (-4915.992) (-4919.696) (-4913.126) -- 0:05:04

      Average standard deviation of split frequencies: 0.002455

      95500 -- (-4908.465) [-4912.098] (-4915.166) (-4906.859) * (-4915.045) (-4909.785) [-4918.322] (-4909.047) -- 0:05:03
      96000 -- [-4910.467] (-4914.178) (-4914.101) (-4908.822) * [-4915.645] (-4910.978) (-4907.470) (-4915.274) -- 0:05:01
      96500 -- [-4918.206] (-4912.567) (-4908.508) (-4917.063) * [-4911.267] (-4912.642) (-4914.951) (-4915.484) -- 0:04:59
      97000 -- (-4911.559) (-4909.860) (-4917.816) [-4909.717] * [-4913.671] (-4909.592) (-4911.193) (-4915.668) -- 0:04:57
      97500 -- (-4918.942) (-4913.310) [-4913.930] (-4918.719) * [-4908.059] (-4912.085) (-4910.718) (-4913.755) -- 0:04:56
      98000 -- (-4915.724) (-4917.735) [-4913.183] (-4907.240) * [-4910.465] (-4915.947) (-4910.976) (-4912.627) -- 0:04:54
      98500 -- [-4918.221] (-4916.074) (-4916.170) (-4913.498) * [-4910.192] (-4910.815) (-4927.232) (-4918.364) -- 0:05:02
      99000 -- [-4911.155] (-4908.016) (-4907.915) (-4914.734) * (-4910.456) [-4915.765] (-4917.041) (-4912.341) -- 0:05:00
      99500 -- [-4911.414] (-4917.258) (-4907.486) (-4911.994) * (-4912.490) (-4907.226) [-4909.325] (-4915.910) -- 0:04:58
      100000 -- (-4913.295) (-4921.088) (-4909.245) [-4914.412] * [-4908.596] (-4910.243) (-4917.552) (-4912.157) -- 0:04:57

      Average standard deviation of split frequencies: 0.002341

      100500 -- (-4907.330) [-4911.368] (-4910.914) (-4916.807) * [-4906.631] (-4908.848) (-4918.487) (-4908.948) -- 0:04:55
      101000 -- (-4917.684) (-4910.944) (-4912.592) [-4914.499] * (-4907.971) (-4910.939) [-4912.437] (-4912.664) -- 0:04:53
      101500 -- (-4909.218) [-4910.437] (-4912.460) (-4909.442) * [-4909.792] (-4908.771) (-4912.564) (-4907.701) -- 0:05:00
      102000 -- (-4912.315) (-4912.322) [-4910.120] (-4910.506) * (-4911.523) (-4908.989) (-4909.914) [-4906.570] -- 0:04:59
      102500 -- (-4905.533) (-4910.951) [-4905.510] (-4909.089) * (-4909.024) (-4910.975) (-4915.326) [-4910.099] -- 0:04:57
      103000 -- (-4912.977) [-4914.828] (-4912.524) (-4908.667) * (-4905.539) (-4910.622) [-4910.706] (-4911.062) -- 0:04:56
      103500 -- (-4917.558) (-4911.693) (-4914.099) [-4911.975] * [-4903.573] (-4912.360) (-4909.484) (-4910.471) -- 0:04:54
      104000 -- (-4910.555) (-4922.842) (-4912.753) [-4913.151] * (-4908.467) (-4910.350) [-4907.936] (-4916.793) -- 0:04:52
      104500 -- (-4909.029) (-4912.574) [-4911.328] (-4910.515) * [-4909.445] (-4908.179) (-4914.264) (-4914.589) -- 0:04:59
      105000 -- (-4910.522) (-4917.283) [-4908.258] (-4916.611) * [-4912.752] (-4907.993) (-4917.038) (-4922.849) -- 0:04:58

      Average standard deviation of split frequencies: 0.002224

      105500 -- [-4910.709] (-4914.990) (-4910.940) (-4909.440) * (-4913.349) (-4912.521) (-4910.643) [-4909.961] -- 0:04:56
      106000 -- [-4911.144] (-4907.833) (-4917.095) (-4915.585) * (-4921.606) (-4911.680) [-4911.397] (-4916.446) -- 0:04:55
      106500 -- (-4909.965) (-4912.317) (-4919.408) [-4909.720] * (-4918.919) (-4908.729) [-4912.508] (-4911.676) -- 0:04:53
      107000 -- (-4913.874) (-4911.409) (-4914.219) [-4911.514] * (-4916.746) (-4911.968) (-4915.797) [-4913.358] -- 0:04:52
      107500 -- (-4917.305) (-4908.579) [-4911.326] (-4909.926) * (-4915.294) (-4907.904) (-4909.683) [-4914.114] -- 0:04:58
      108000 -- [-4912.771] (-4916.764) (-4917.019) (-4907.483) * [-4917.258] (-4912.149) (-4911.240) (-4910.369) -- 0:04:57
      108500 -- (-4913.942) (-4912.686) [-4913.459] (-4908.249) * [-4913.778] (-4909.719) (-4913.370) (-4914.046) -- 0:04:55
      109000 -- (-4913.721) (-4911.746) (-4912.616) [-4917.979] * (-4915.234) (-4905.201) [-4905.451] (-4913.911) -- 0:04:54
      109500 -- (-4913.730) (-4910.718) [-4910.169] (-4918.634) * (-4903.408) [-4915.343] (-4911.551) (-4915.182) -- 0:04:52
      110000 -- (-4908.614) (-4920.304) (-4912.473) [-4912.524] * [-4909.427] (-4910.599) (-4910.331) (-4914.517) -- 0:04:51

      Average standard deviation of split frequencies: 0.002130

      110500 -- (-4909.625) [-4906.967] (-4909.728) (-4912.692) * (-4904.519) [-4911.866] (-4907.640) (-4918.829) -- 0:04:57
      111000 -- (-4909.712) (-4918.167) [-4916.377] (-4916.625) * (-4911.149) (-4925.433) (-4915.454) [-4912.149] -- 0:04:56
      111500 -- [-4910.241] (-4911.534) (-4909.152) (-4913.322) * (-4910.221) [-4907.360] (-4917.781) (-4912.963) -- 0:04:54
      112000 -- [-4912.138] (-4906.500) (-4913.180) (-4913.018) * [-4912.935] (-4908.283) (-4914.760) (-4910.460) -- 0:04:53
      112500 -- (-4912.092) (-4909.250) (-4910.926) [-4920.430] * (-4913.964) [-4909.466] (-4917.280) (-4910.883) -- 0:04:51
      113000 -- [-4910.183] (-4912.838) (-4909.840) (-4916.852) * (-4914.994) (-4914.545) (-4907.558) [-4909.844] -- 0:04:50
      113500 -- (-4912.376) (-4909.084) (-4909.487) [-4910.315] * (-4915.824) [-4916.083] (-4914.531) (-4906.710) -- 0:04:56
      114000 -- (-4914.858) [-4914.813] (-4908.842) (-4910.999) * (-4913.050) (-4913.797) [-4909.981] (-4912.849) -- 0:04:55
      114500 -- (-4911.117) (-4916.874) [-4909.049] (-4909.019) * [-4915.407] (-4916.377) (-4910.231) (-4903.699) -- 0:04:53
      115000 -- (-4911.372) (-4921.016) [-4916.151] (-4911.425) * (-4909.468) (-4908.082) (-4910.360) [-4910.639] -- 0:04:52

      Average standard deviation of split frequencies: 0.002032

      115500 -- [-4918.450] (-4919.953) (-4916.049) (-4910.902) * (-4910.550) [-4908.516] (-4918.281) (-4906.553) -- 0:04:51
      116000 -- [-4918.148] (-4916.107) (-4913.301) (-4909.780) * (-4914.828) (-4912.155) (-4912.784) [-4912.512] -- 0:04:49
      116500 -- [-4911.687] (-4914.146) (-4913.668) (-4915.602) * (-4911.671) (-4914.690) (-4914.657) [-4908.768] -- 0:04:55
      117000 -- [-4914.078] (-4914.230) (-4911.556) (-4911.473) * (-4907.516) (-4909.739) (-4919.846) [-4912.137] -- 0:04:54
      117500 -- (-4909.806) (-4911.662) (-4911.381) [-4907.470] * [-4907.657] (-4910.205) (-4914.023) (-4910.548) -- 0:04:52
      118000 -- (-4910.130) (-4908.345) (-4911.181) [-4910.157] * (-4911.356) [-4906.358] (-4919.670) (-4908.496) -- 0:04:51
      118500 -- (-4917.913) (-4912.306) (-4909.271) [-4911.691] * [-4910.652] (-4907.526) (-4916.978) (-4914.401) -- 0:04:50
      119000 -- (-4912.325) (-4916.002) (-4912.874) [-4911.018] * (-4909.138) (-4914.723) [-4910.541] (-4908.897) -- 0:04:48
      119500 -- (-4915.803) (-4911.856) [-4912.828] (-4912.343) * (-4911.982) (-4910.218) [-4908.561] (-4914.250) -- 0:04:54
      120000 -- [-4910.656] (-4911.382) (-4907.916) (-4918.597) * [-4909.708] (-4914.480) (-4915.865) (-4910.220) -- 0:04:53

      Average standard deviation of split frequencies: 0.001953

      120500 -- (-4928.697) (-4909.742) (-4916.627) [-4910.159] * (-4921.386) [-4909.836] (-4916.910) (-4915.746) -- 0:04:51
      121000 -- (-4917.497) (-4911.653) (-4913.610) [-4908.096] * (-4912.927) (-4919.768) (-4921.828) [-4910.238] -- 0:04:50
      121500 -- (-4919.740) (-4913.266) (-4907.726) [-4913.873] * (-4909.382) (-4912.194) (-4924.886) [-4910.272] -- 0:04:49
      122000 -- [-4914.544] (-4911.547) (-4913.631) (-4908.143) * [-4910.541] (-4914.471) (-4918.651) (-4912.752) -- 0:04:47
      122500 -- (-4910.639) (-4916.464) (-4916.330) [-4909.477] * (-4920.808) (-4909.015) (-4915.345) [-4910.226] -- 0:04:53
      123000 -- (-4911.762) (-4911.526) [-4914.360] (-4910.965) * (-4908.834) (-4912.042) (-4914.377) [-4911.616] -- 0:04:52
      123500 -- (-4914.430) (-4909.845) (-4906.673) [-4916.960] * [-4912.232] (-4912.861) (-4911.444) (-4916.661) -- 0:04:50
      124000 -- (-4916.130) [-4912.161] (-4906.369) (-4916.613) * (-4907.373) (-4909.235) [-4910.282] (-4917.083) -- 0:04:49
      124500 -- (-4914.019) (-4906.983) [-4912.001] (-4908.971) * (-4913.358) [-4910.589] (-4914.952) (-4912.652) -- 0:04:48
      125000 -- [-4915.126] (-4907.155) (-4907.909) (-4912.288) * (-4906.203) (-4915.526) [-4913.611] (-4907.935) -- 0:04:47

      Average standard deviation of split frequencies: 0.001871

      125500 -- (-4910.570) (-4913.778) [-4906.315] (-4911.660) * [-4910.054] (-4911.066) (-4914.768) (-4916.432) -- 0:04:52
      126000 -- (-4908.565) (-4916.433) (-4907.538) [-4914.022] * (-4910.175) [-4915.345] (-4915.190) (-4913.190) -- 0:04:51
      126500 -- (-4916.156) (-4911.822) (-4910.091) [-4909.109] * [-4909.875] (-4914.266) (-4911.195) (-4930.071) -- 0:04:50
      127000 -- (-4913.520) [-4907.863] (-4909.421) (-4915.912) * (-4909.450) [-4907.385] (-4907.650) (-4918.903) -- 0:04:48
      127500 -- [-4911.856] (-4910.270) (-4919.014) (-4911.264) * (-4910.093) [-4907.026] (-4907.921) (-4923.500) -- 0:04:47
      128000 -- (-4910.914) (-4913.224) (-4914.151) [-4911.526] * (-4911.058) (-4908.126) [-4913.825] (-4909.160) -- 0:04:46
      128500 -- (-4910.376) [-4915.617] (-4911.359) (-4917.285) * (-4910.967) (-4916.084) (-4913.500) [-4908.310] -- 0:04:51
      129000 -- [-4907.924] (-4916.637) (-4913.423) (-4916.292) * [-4910.604] (-4916.836) (-4916.741) (-4914.525) -- 0:04:50
      129500 -- (-4915.031) (-4908.966) [-4905.216] (-4910.200) * (-4912.105) (-4907.168) [-4913.839] (-4911.917) -- 0:04:49
      130000 -- (-4914.778) (-4915.646) [-4910.437] (-4911.781) * (-4912.635) (-4907.017) (-4909.551) [-4908.886] -- 0:04:47

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-4915.920) (-4919.702) [-4911.908] (-4914.177) * (-4912.407) (-4909.902) [-4909.085] (-4907.709) -- 0:04:46
      131000 -- [-4908.290] (-4907.966) (-4911.124) (-4914.707) * [-4914.955] (-4913.589) (-4911.338) (-4910.914) -- 0:04:45
      131500 -- (-4912.953) (-4915.725) (-4909.908) [-4911.064] * (-4907.548) (-4912.162) (-4914.987) [-4907.067] -- 0:04:50
      132000 -- (-4920.544) (-4910.783) [-4912.571] (-4907.078) * (-4904.964) (-4914.827) (-4914.800) [-4907.403] -- 0:04:49
      132500 -- (-4912.171) [-4912.665] (-4914.201) (-4914.128) * (-4909.618) (-4911.611) [-4907.665] (-4913.418) -- 0:04:48
      133000 -- (-4914.093) (-4914.207) [-4917.108] (-4911.197) * (-4919.962) [-4912.271] (-4915.838) (-4913.014) -- 0:04:46
      133500 -- (-4916.739) [-4911.868] (-4916.341) (-4911.201) * (-4919.936) (-4914.899) [-4907.265] (-4910.024) -- 0:04:45
      134000 -- (-4912.861) (-4912.157) (-4914.591) [-4909.429] * [-4913.627] (-4915.646) (-4909.571) (-4911.755) -- 0:04:44
      134500 -- (-4917.688) (-4913.162) [-4913.727] (-4907.047) * [-4910.659] (-4916.401) (-4910.291) (-4914.450) -- 0:04:49
      135000 -- (-4915.775) (-4917.580) [-4912.281] (-4906.618) * (-4909.478) (-4913.404) [-4910.699] (-4909.811) -- 0:04:48

      Average standard deviation of split frequencies: 0.003466

      135500 -- [-4916.130] (-4911.737) (-4907.483) (-4905.520) * (-4910.567) [-4910.525] (-4911.072) (-4910.824) -- 0:04:47
      136000 -- (-4908.893) (-4916.678) [-4909.172] (-4911.369) * (-4905.922) (-4910.720) (-4911.688) [-4906.161] -- 0:04:45
      136500 -- [-4907.423] (-4917.978) (-4909.975) (-4912.416) * (-4911.077) (-4912.339) (-4911.062) [-4906.971] -- 0:04:44
      137000 -- (-4910.085) (-4917.783) (-4913.472) [-4914.598] * [-4910.539] (-4912.789) (-4916.310) (-4912.267) -- 0:04:43
      137500 -- (-4906.587) [-4908.401] (-4910.513) (-4914.770) * (-4911.829) [-4908.297] (-4912.893) (-4908.258) -- 0:04:48
      138000 -- (-4909.658) (-4914.963) (-4911.436) [-4910.981] * [-4910.277] (-4911.884) (-4917.572) (-4906.648) -- 0:04:47
      138500 -- (-4913.010) (-4913.241) (-4911.884) [-4910.351] * (-4911.716) (-4910.424) [-4910.577] (-4911.696) -- 0:04:46
      139000 -- (-4913.759) [-4907.425] (-4907.567) (-4921.121) * (-4908.128) (-4910.935) [-4911.618] (-4911.850) -- 0:04:44
      139500 -- (-4924.869) (-4916.165) [-4908.793] (-4922.175) * (-4913.196) (-4917.506) [-4914.991] (-4920.138) -- 0:04:49
      140000 -- (-4919.635) (-4908.598) (-4906.779) [-4917.642] * (-4916.705) (-4918.390) [-4910.503] (-4916.197) -- 0:04:48

      Average standard deviation of split frequencies: 0.003351

      140500 -- [-4920.777] (-4906.087) (-4910.897) (-4917.406) * (-4913.999) [-4909.704] (-4919.345) (-4913.845) -- 0:04:47
      141000 -- (-4911.842) [-4912.048] (-4908.678) (-4912.157) * (-4908.089) (-4906.459) (-4911.121) [-4912.732] -- 0:04:46
      141500 -- (-4914.957) (-4913.448) (-4910.788) [-4913.091] * (-4915.707) [-4909.401] (-4911.570) (-4909.538) -- 0:04:51
      142000 -- [-4918.689] (-4911.638) (-4911.753) (-4914.149) * (-4914.580) (-4907.605) (-4912.813) [-4909.441] -- 0:04:50
      142500 -- [-4915.245] (-4912.586) (-4910.652) (-4915.651) * (-4923.430) (-4916.070) (-4906.643) [-4914.963] -- 0:04:48
      143000 -- (-4912.886) (-4920.685) (-4907.504) [-4911.405] * [-4914.966] (-4915.121) (-4905.112) (-4913.304) -- 0:04:47
      143500 -- [-4914.907] (-4911.865) (-4910.016) (-4911.740) * (-4912.541) (-4908.952) [-4915.283] (-4914.247) -- 0:04:46
      144000 -- (-4911.931) (-4911.996) [-4913.744] (-4910.256) * (-4911.416) (-4911.569) [-4909.667] (-4916.411) -- 0:04:45
      144500 -- [-4912.541] (-4911.099) (-4908.500) (-4912.367) * (-4919.796) [-4909.825] (-4907.296) (-4915.510) -- 0:04:50
      145000 -- (-4907.717) [-4909.088] (-4914.637) (-4910.147) * [-4911.085] (-4906.756) (-4913.887) (-4912.221) -- 0:04:48

      Average standard deviation of split frequencies: 0.001614

      145500 -- (-4915.541) [-4911.541] (-4913.484) (-4915.088) * (-4907.578) (-4915.131) [-4906.374] (-4914.326) -- 0:04:47
      146000 -- (-4916.724) (-4913.986) (-4912.358) [-4909.545] * (-4914.658) (-4914.952) [-4912.095] (-4922.708) -- 0:04:46
      146500 -- [-4916.422] (-4912.040) (-4909.108) (-4908.432) * (-4910.160) (-4913.321) (-4910.401) [-4909.460] -- 0:04:45
      147000 -- (-4919.623) (-4913.357) (-4915.341) [-4920.936] * (-4907.617) (-4917.119) [-4911.582] (-4915.871) -- 0:04:44
      147500 -- [-4907.808] (-4914.065) (-4910.278) (-4907.319) * (-4910.444) (-4913.472) [-4908.128] (-4914.239) -- 0:04:48
      148000 -- [-4911.670] (-4919.159) (-4910.083) (-4913.493) * (-4910.633) (-4921.262) (-4917.174) [-4916.521] -- 0:04:47
      148500 -- (-4911.232) (-4915.038) [-4912.021] (-4908.790) * (-4921.635) (-4914.633) [-4915.667] (-4916.447) -- 0:04:46
      149000 -- (-4908.091) (-4916.565) (-4918.223) [-4911.766] * (-4910.755) (-4914.512) [-4910.507] (-4912.524) -- 0:04:45
      149500 -- (-4914.016) (-4913.693) (-4911.365) [-4911.336] * (-4906.075) (-4908.289) (-4912.378) [-4913.247] -- 0:04:44
      150000 -- (-4913.669) [-4910.124] (-4910.560) (-4912.794) * (-4915.159) (-4909.884) (-4905.003) [-4909.939] -- 0:04:43

      Average standard deviation of split frequencies: 0.003129

      150500 -- (-4910.932) (-4915.614) (-4913.478) [-4919.555] * [-4909.158] (-4909.880) (-4909.133) (-4906.262) -- 0:04:47
      151000 -- (-4915.839) (-4915.246) (-4909.976) [-4916.900] * [-4905.520] (-4913.973) (-4912.049) (-4906.471) -- 0:04:46
      151500 -- (-4914.964) (-4905.477) (-4914.107) [-4919.553] * (-4908.830) (-4929.686) [-4908.494] (-4914.442) -- 0:04:45
      152000 -- (-4912.559) (-4915.620) [-4911.588] (-4911.958) * (-4911.213) (-4912.578) [-4911.679] (-4905.341) -- 0:04:44
      152500 -- [-4906.148] (-4908.428) (-4906.193) (-4908.675) * (-4910.916) (-4915.730) [-4912.652] (-4913.433) -- 0:04:43
      153000 -- [-4906.351] (-4906.043) (-4912.590) (-4911.700) * (-4912.217) [-4911.677] (-4916.471) (-4910.846) -- 0:04:47
      153500 -- (-4905.350) (-4903.559) (-4918.643) [-4914.587] * (-4910.564) [-4911.390] (-4909.755) (-4909.984) -- 0:04:46
      154000 -- (-4906.766) (-4905.355) [-4917.086] (-4923.017) * (-4917.600) [-4914.476] (-4912.332) (-4908.390) -- 0:04:45
      154500 -- (-4909.245) (-4907.237) [-4912.234] (-4913.274) * [-4911.958] (-4919.729) (-4911.746) (-4909.982) -- 0:04:44
      155000 -- [-4903.839] (-4913.030) (-4909.297) (-4916.901) * (-4908.538) [-4908.568] (-4915.417) (-4914.668) -- 0:04:43

      Average standard deviation of split frequencies: 0.003022

      155500 -- (-4918.364) [-4912.244] (-4917.487) (-4911.886) * [-4912.676] (-4907.345) (-4918.006) (-4910.696) -- 0:04:42
      156000 -- (-4913.878) (-4916.042) [-4908.404] (-4916.989) * (-4915.398) [-4903.844] (-4911.744) (-4919.612) -- 0:04:46
      156500 -- (-4907.696) [-4913.640] (-4916.821) (-4910.905) * (-4917.333) (-4908.160) (-4914.862) [-4913.190] -- 0:04:45
      157000 -- [-4911.648] (-4911.971) (-4913.816) (-4913.782) * (-4909.127) [-4908.910] (-4915.518) (-4915.084) -- 0:04:44
      157500 -- (-4922.719) [-4911.999] (-4912.289) (-4916.489) * (-4912.583) (-4914.432) [-4914.807] (-4917.474) -- 0:04:43
      158000 -- (-4912.701) [-4916.330] (-4910.496) (-4913.283) * [-4910.870] (-4907.188) (-4906.015) (-4918.147) -- 0:04:42
      158500 -- (-4912.935) (-4914.019) [-4913.178] (-4904.631) * (-4914.739) (-4907.029) [-4905.694] (-4910.602) -- 0:04:41
      159000 -- (-4912.138) (-4912.915) [-4908.379] (-4909.797) * [-4910.508] (-4909.792) (-4912.645) (-4911.285) -- 0:04:45
      159500 -- (-4910.390) [-4912.777] (-4913.332) (-4912.722) * (-4916.857) [-4908.731] (-4907.751) (-4919.490) -- 0:04:44
      160000 -- [-4911.506] (-4920.532) (-4918.112) (-4910.249) * (-4913.032) (-4917.359) [-4907.683] (-4911.974) -- 0:04:43

      Average standard deviation of split frequencies: 0.002934

      160500 -- (-4909.045) (-4916.282) (-4910.232) [-4909.734] * (-4914.331) (-4912.464) (-4909.269) [-4911.455] -- 0:04:42
      161000 -- [-4913.186] (-4913.687) (-4908.675) (-4911.897) * (-4912.311) [-4908.799] (-4914.108) (-4915.294) -- 0:04:41
      161500 -- (-4915.843) [-4907.980] (-4912.856) (-4912.326) * (-4911.023) (-4909.003) [-4914.693] (-4914.388) -- 0:04:40
      162000 -- [-4909.950] (-4912.627) (-4917.411) (-4910.619) * (-4913.992) (-4922.653) [-4911.586] (-4911.878) -- 0:04:44
      162500 -- (-4906.962) [-4909.728] (-4913.687) (-4909.443) * (-4908.507) (-4909.825) (-4911.576) [-4911.707] -- 0:04:43
      163000 -- [-4912.838] (-4913.450) (-4908.679) (-4914.558) * (-4908.472) (-4916.941) (-4916.594) [-4916.048] -- 0:04:42
      163500 -- (-4910.892) (-4909.325) (-4911.586) [-4910.665] * (-4916.107) (-4917.299) (-4915.648) [-4907.252] -- 0:04:41
      164000 -- (-4910.922) (-4910.930) (-4914.634) [-4912.303] * [-4911.817] (-4914.963) (-4914.840) (-4911.284) -- 0:04:40
      164500 -- (-4911.734) (-4910.325) [-4911.449] (-4908.701) * [-4915.740] (-4919.775) (-4915.388) (-4911.698) -- 0:04:39
      165000 -- (-4908.363) (-4907.637) (-4912.002) [-4915.637] * (-4910.114) (-4912.936) [-4911.559] (-4911.436) -- 0:04:43

      Average standard deviation of split frequencies: 0.002840

      165500 -- (-4912.049) (-4914.819) (-4913.122) [-4908.261] * (-4915.196) (-4918.764) [-4910.995] (-4913.093) -- 0:04:42
      166000 -- (-4909.121) (-4910.144) [-4908.411] (-4913.498) * (-4914.439) [-4909.582] (-4909.838) (-4913.945) -- 0:04:41
      166500 -- (-4910.818) [-4906.080] (-4911.383) (-4915.099) * [-4910.790] (-4908.076) (-4909.619) (-4922.814) -- 0:04:40
      167000 -- (-4912.295) (-4906.130) (-4908.664) [-4905.571] * (-4910.194) (-4906.763) (-4917.221) [-4915.639] -- 0:04:39
      167500 -- (-4906.220) (-4912.354) [-4913.247] (-4909.737) * (-4911.549) (-4909.242) (-4909.549) [-4911.302] -- 0:04:38
      168000 -- (-4906.667) [-4911.295] (-4908.613) (-4909.691) * (-4908.193) (-4910.867) (-4909.431) [-4910.734] -- 0:04:42
      168500 -- (-4915.683) (-4916.723) [-4914.162] (-4916.187) * (-4922.677) (-4907.967) [-4911.222] (-4910.096) -- 0:04:41
      169000 -- [-4914.421] (-4913.988) (-4920.711) (-4910.257) * [-4916.651] (-4913.681) (-4914.470) (-4914.455) -- 0:04:40
      169500 -- (-4911.063) [-4913.851] (-4911.664) (-4912.198) * (-4914.884) (-4905.718) [-4917.307] (-4912.400) -- 0:04:39
      170000 -- (-4910.013) (-4912.011) [-4912.354] (-4907.531) * (-4908.508) [-4907.534] (-4906.957) (-4909.393) -- 0:04:38

      Average standard deviation of split frequencies: 0.002762

      170500 -- (-4909.808) (-4914.978) [-4911.625] (-4910.750) * [-4915.283] (-4910.689) (-4915.035) (-4911.385) -- 0:04:37
      171000 -- (-4911.680) (-4922.033) (-4912.416) [-4910.664] * (-4916.689) [-4908.253] (-4913.451) (-4910.234) -- 0:04:41
      171500 -- (-4909.252) (-4913.936) [-4908.890] (-4908.763) * (-4912.365) (-4906.261) [-4919.945] (-4914.912) -- 0:04:40
      172000 -- (-4917.355) [-4908.331] (-4907.695) (-4911.826) * (-4918.735) (-4919.318) [-4912.968] (-4912.889) -- 0:04:39
      172500 -- (-4909.889) (-4907.581) (-4912.330) [-4907.214] * (-4912.224) (-4910.077) [-4913.253] (-4908.760) -- 0:04:38
      173000 -- [-4908.522] (-4917.023) (-4906.905) (-4910.742) * [-4910.712] (-4911.366) (-4910.913) (-4906.985) -- 0:04:37
      173500 -- (-4916.782) (-4914.140) (-4914.244) [-4910.668] * (-4909.315) (-4911.681) [-4912.063] (-4911.111) -- 0:04:36
      174000 -- (-4913.249) (-4913.820) [-4914.563] (-4916.742) * (-4907.474) [-4915.854] (-4912.332) (-4907.179) -- 0:04:40
      174500 -- [-4909.792] (-4916.776) (-4907.264) (-4914.159) * (-4916.640) (-4911.503) (-4912.020) [-4909.839] -- 0:04:39
      175000 -- (-4916.140) (-4915.253) [-4914.922] (-4916.347) * (-4915.700) (-4910.593) (-4910.244) [-4911.324] -- 0:04:38

      Average standard deviation of split frequencies: 0.002678

      175500 -- (-4912.792) (-4915.125) (-4912.324) [-4913.724] * (-4914.848) [-4911.680] (-4910.875) (-4913.535) -- 0:04:37
      176000 -- (-4913.407) [-4918.183] (-4911.908) (-4912.044) * (-4913.863) (-4914.632) [-4912.704] (-4910.560) -- 0:04:36
      176500 -- [-4908.413] (-4909.449) (-4912.703) (-4915.545) * (-4919.453) (-4913.859) [-4905.375] (-4908.343) -- 0:04:35
      177000 -- (-4909.862) (-4909.056) (-4909.373) [-4912.683] * (-4916.805) (-4912.037) (-4912.952) [-4912.152] -- 0:04:38
      177500 -- [-4910.252] (-4909.605) (-4913.251) (-4913.903) * (-4909.805) (-4910.399) (-4912.975) [-4915.254] -- 0:04:38
      178000 -- (-4909.292) (-4913.242) (-4918.669) [-4911.966] * [-4913.887] (-4912.449) (-4906.265) (-4913.367) -- 0:04:37
      178500 -- (-4909.378) [-4915.862] (-4912.173) (-4911.965) * (-4914.069) (-4915.431) [-4909.997] (-4910.130) -- 0:04:36
      179000 -- (-4916.551) (-4909.084) [-4910.131] (-4914.898) * (-4914.096) [-4908.300] (-4909.187) (-4910.249) -- 0:04:35
      179500 -- (-4907.121) (-4906.741) [-4906.870] (-4924.071) * (-4913.065) (-4918.537) (-4908.940) [-4918.737] -- 0:04:34
      180000 -- (-4907.197) (-4912.103) [-4913.717] (-4926.497) * [-4908.641] (-4913.971) (-4912.544) (-4912.494) -- 0:04:37

      Average standard deviation of split frequencies: 0.001305

      180500 -- [-4912.787] (-4909.656) (-4907.998) (-4916.455) * [-4907.990] (-4916.231) (-4909.409) (-4917.451) -- 0:04:36
      181000 -- (-4909.322) [-4913.405] (-4911.103) (-4916.082) * (-4911.730) (-4912.708) [-4912.325] (-4910.569) -- 0:04:36
      181500 -- [-4910.370] (-4911.260) (-4914.780) (-4913.623) * [-4910.985] (-4911.863) (-4920.122) (-4906.690) -- 0:04:35
      182000 -- (-4910.558) (-4909.591) (-4906.108) [-4906.408] * (-4909.262) (-4908.175) (-4915.511) [-4910.582] -- 0:04:34
      182500 -- (-4910.131) [-4909.165] (-4910.503) (-4905.588) * (-4914.894) (-4910.880) (-4912.840) [-4910.264] -- 0:04:33
      183000 -- (-4907.875) [-4908.722] (-4913.219) (-4915.078) * [-4909.210] (-4913.038) (-4917.872) (-4910.437) -- 0:04:36
      183500 -- (-4912.051) (-4914.590) [-4915.329] (-4913.351) * (-4907.963) (-4913.994) (-4910.532) [-4912.492] -- 0:04:35
      184000 -- (-4914.205) [-4917.273] (-4914.133) (-4910.573) * (-4912.776) (-4906.358) [-4906.558] (-4913.634) -- 0:04:34
      184500 -- [-4909.611] (-4909.441) (-4909.400) (-4909.904) * (-4911.304) [-4902.932] (-4907.141) (-4912.392) -- 0:04:34
      185000 -- (-4913.109) (-4915.339) (-4911.763) [-4908.862] * (-4903.753) (-4913.337) [-4910.107] (-4910.851) -- 0:04:33

      Average standard deviation of split frequencies: 0.001267

      185500 -- (-4917.978) [-4911.985] (-4913.202) (-4923.455) * (-4905.567) (-4910.299) [-4910.872] (-4921.418) -- 0:04:32
      186000 -- (-4923.600) (-4916.088) [-4904.482] (-4917.921) * (-4906.992) [-4921.521] (-4920.615) (-4908.657) -- 0:04:35
      186500 -- [-4912.910] (-4917.016) (-4908.028) (-4914.894) * (-4913.069) (-4917.999) (-4921.829) [-4905.850] -- 0:04:34
      187000 -- (-4916.145) (-4918.730) (-4907.197) [-4908.985] * [-4912.712] (-4916.791) (-4915.802) (-4913.906) -- 0:04:33
      187500 -- [-4909.733] (-4913.293) (-4913.087) (-4912.674) * (-4915.078) (-4917.864) [-4911.916] (-4916.771) -- 0:04:33
      188000 -- [-4903.157] (-4921.307) (-4913.449) (-4912.943) * (-4915.357) (-4919.318) [-4908.078] (-4909.964) -- 0:04:32
      188500 -- [-4913.118] (-4910.367) (-4909.778) (-4908.564) * [-4908.836] (-4920.882) (-4911.947) (-4908.373) -- 0:04:31
      189000 -- (-4911.618) (-4920.124) (-4908.690) [-4914.169] * (-4907.478) [-4905.893] (-4915.570) (-4917.970) -- 0:04:34
      189500 -- [-4908.943] (-4914.090) (-4911.050) (-4914.062) * (-4908.859) [-4908.421] (-4914.329) (-4910.502) -- 0:04:33
      190000 -- (-4907.601) (-4919.291) (-4906.700) [-4912.862] * (-4912.097) [-4914.418] (-4913.463) (-4918.335) -- 0:04:32

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-4913.584) (-4910.623) (-4911.973) [-4906.886] * (-4916.690) (-4914.245) [-4910.889] (-4912.764) -- 0:04:31
      191000 -- (-4910.241) [-4908.620] (-4927.739) (-4913.661) * (-4912.711) (-4911.260) (-4915.819) [-4906.895] -- 0:04:31
      191500 -- (-4910.853) (-4912.168) (-4916.925) [-4913.741] * (-4916.487) [-4907.219] (-4910.262) (-4912.240) -- 0:04:30
      192000 -- [-4912.889] (-4914.799) (-4908.991) (-4913.568) * (-4912.906) (-4917.432) (-4907.271) [-4909.446] -- 0:04:33
      192500 -- (-4916.438) [-4911.983] (-4917.686) (-4916.291) * (-4911.339) (-4917.239) (-4913.603) [-4913.040] -- 0:04:32
      193000 -- (-4912.926) (-4915.996) [-4908.094] (-4910.106) * (-4911.730) (-4907.972) (-4914.907) [-4909.529] -- 0:04:31
      193500 -- (-4904.915) (-4915.015) [-4916.549] (-4907.716) * [-4911.118] (-4912.682) (-4917.235) (-4912.919) -- 0:04:30
      194000 -- (-4913.004) (-4908.547) [-4909.309] (-4912.607) * (-4913.756) [-4907.243] (-4909.891) (-4906.021) -- 0:04:30
      194500 -- (-4910.268) (-4905.903) [-4912.071] (-4914.841) * (-4907.985) (-4907.102) [-4908.106] (-4913.062) -- 0:04:33
      195000 -- [-4907.319] (-4911.536) (-4910.332) (-4912.734) * (-4916.857) [-4909.144] (-4910.638) (-4918.028) -- 0:04:32

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-4914.149) (-4913.380) [-4908.500] (-4911.541) * (-4918.879) [-4910.444] (-4908.356) (-4918.443) -- 0:04:31
      196000 -- (-4917.100) [-4915.622] (-4910.997) (-4913.229) * [-4919.895] (-4908.366) (-4913.011) (-4919.065) -- 0:04:30
      196500 -- [-4915.180] (-4913.123) (-4914.892) (-4915.275) * (-4910.911) (-4915.811) [-4906.739] (-4910.818) -- 0:04:29
      197000 -- (-4913.289) [-4907.361] (-4908.821) (-4910.129) * (-4910.252) (-4909.041) [-4910.611] (-4909.859) -- 0:04:29
      197500 -- (-4912.969) [-4913.366] (-4909.673) (-4915.666) * [-4909.492] (-4909.491) (-4909.796) (-4913.659) -- 0:04:32
      198000 -- [-4912.315] (-4914.453) (-4914.562) (-4912.708) * (-4907.359) [-4912.576] (-4910.474) (-4910.978) -- 0:04:31
      198500 -- (-4915.944) (-4906.946) (-4908.130) [-4906.465] * [-4911.124] (-4914.409) (-4920.735) (-4915.189) -- 0:04:30
      199000 -- (-4910.595) (-4907.899) (-4914.582) [-4907.893] * (-4915.233) (-4907.882) [-4914.087] (-4916.114) -- 0:04:29
      199500 -- (-4907.086) (-4910.656) [-4910.525] (-4907.148) * (-4911.214) [-4907.289] (-4907.894) (-4913.087) -- 0:04:28
      200000 -- (-4919.804) (-4913.028) [-4912.278] (-4906.785) * (-4910.673) [-4909.868] (-4906.599) (-4913.410) -- 0:04:28

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-4915.469) (-4906.912) (-4914.860) [-4911.243] * [-4909.995] (-4904.879) (-4912.330) (-4910.644) -- 0:04:31
      201000 -- (-4909.749) (-4911.013) [-4913.676] (-4909.422) * (-4915.299) (-4910.327) [-4910.266] (-4915.909) -- 0:04:30
      201500 -- (-4907.709) [-4910.636] (-4914.147) (-4913.937) * (-4913.262) [-4911.327] (-4909.470) (-4920.130) -- 0:04:29
      202000 -- [-4910.330] (-4910.564) (-4915.480) (-4910.660) * [-4914.108] (-4909.980) (-4914.782) (-4921.457) -- 0:04:28
      202500 -- (-4911.790) (-4914.437) (-4915.392) [-4907.476] * (-4915.136) [-4909.428] (-4912.104) (-4912.505) -- 0:04:27
      203000 -- (-4912.945) (-4910.424) [-4910.382] (-4908.974) * (-4911.377) (-4909.544) (-4908.582) [-4915.785] -- 0:04:26
      203500 -- (-4911.207) (-4912.090) [-4910.078] (-4912.224) * [-4915.766] (-4910.568) (-4911.548) (-4920.611) -- 0:04:30
      204000 -- (-4912.726) [-4906.109] (-4922.490) (-4910.990) * (-4914.786) (-4915.039) (-4909.890) [-4915.172] -- 0:04:29
      204500 -- (-4910.087) (-4909.256) [-4917.125] (-4912.707) * (-4915.481) (-4915.684) [-4913.364] (-4909.594) -- 0:04:28
      205000 -- (-4911.659) (-4909.351) (-4918.389) [-4913.489] * [-4912.011] (-4917.170) (-4917.481) (-4913.722) -- 0:04:27

      Average standard deviation of split frequencies: 0.000000

      205500 -- [-4909.035] (-4909.657) (-4913.835) (-4917.003) * (-4910.847) (-4912.111) [-4919.712] (-4914.724) -- 0:04:26
      206000 -- (-4912.009) (-4914.788) [-4910.252] (-4917.596) * (-4917.190) (-4908.705) [-4914.224] (-4909.075) -- 0:04:25
      206500 -- [-4908.702] (-4912.432) (-4923.199) (-4908.080) * [-4906.050] (-4906.910) (-4917.645) (-4905.315) -- 0:04:28
      207000 -- (-4912.988) (-4908.301) (-4911.956) [-4915.125] * (-4906.174) (-4913.269) [-4909.895] (-4912.019) -- 0:04:28
      207500 -- (-4915.930) [-4912.705] (-4911.739) (-4922.862) * (-4911.382) (-4906.110) [-4908.795] (-4918.337) -- 0:04:27
      208000 -- (-4909.654) [-4913.928] (-4910.473) (-4917.430) * (-4910.792) [-4911.582] (-4909.407) (-4919.131) -- 0:04:26
      208500 -- (-4913.640) [-4908.777] (-4912.018) (-4924.895) * (-4910.166) (-4915.755) [-4909.254] (-4909.963) -- 0:04:25
      209000 -- (-4915.765) (-4915.889) (-4914.055) [-4919.581] * (-4904.115) (-4911.770) (-4910.908) [-4908.100] -- 0:04:24
      209500 -- (-4913.199) [-4912.568] (-4910.357) (-4913.215) * (-4909.140) (-4910.183) (-4915.816) [-4918.736] -- 0:04:24
      210000 -- (-4910.501) (-4913.935) [-4911.020] (-4918.134) * (-4909.072) (-4912.495) (-4916.460) [-4908.511] -- 0:04:27

      Average standard deviation of split frequencies: 0.000000

      210500 -- [-4909.177] (-4909.192) (-4915.421) (-4913.360) * (-4910.498) [-4909.326] (-4906.208) (-4909.304) -- 0:04:26
      211000 -- (-4915.232) (-4915.422) [-4909.019] (-4916.598) * (-4907.707) (-4915.191) (-4913.275) [-4910.902] -- 0:04:25
      211500 -- (-4913.644) [-4909.456] (-4906.809) (-4908.978) * (-4906.070) (-4912.731) (-4918.377) [-4909.118] -- 0:04:24
      212000 -- [-4912.143] (-4909.730) (-4909.424) (-4913.278) * (-4918.611) [-4911.138] (-4910.960) (-4917.100) -- 0:04:23
      212500 -- [-4910.320] (-4913.092) (-4915.783) (-4909.992) * (-4921.182) (-4910.395) (-4918.655) [-4918.810] -- 0:04:23
      213000 -- (-4906.595) (-4925.493) (-4909.462) [-4910.286] * (-4910.328) (-4919.012) (-4910.878) [-4912.718] -- 0:04:26
      213500 -- (-4909.026) (-4916.995) (-4909.412) [-4915.849] * (-4914.169) (-4907.742) [-4914.170] (-4917.825) -- 0:04:25
      214000 -- (-4907.487) (-4916.426) [-4913.859] (-4908.454) * (-4915.844) (-4911.972) [-4913.524] (-4911.551) -- 0:04:24
      214500 -- (-4908.953) (-4916.304) (-4912.515) [-4912.621] * (-4915.910) (-4909.463) (-4917.985) [-4909.808] -- 0:04:23
      215000 -- (-4916.703) (-4914.285) [-4914.960] (-4905.945) * (-4911.490) [-4914.241] (-4916.457) (-4923.994) -- 0:04:22

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-4912.402) (-4917.795) [-4910.114] (-4914.459) * (-4919.827) (-4913.899) (-4910.596) [-4913.640] -- 0:04:22
      216000 -- (-4913.602) [-4906.015] (-4917.770) (-4912.354) * (-4913.851) (-4910.197) (-4908.715) [-4909.301] -- 0:04:24
      216500 -- [-4907.690] (-4921.028) (-4913.655) (-4913.199) * (-4916.571) (-4905.908) [-4908.430] (-4911.987) -- 0:04:24
      217000 -- (-4902.073) [-4913.799] (-4908.360) (-4918.069) * [-4910.960] (-4911.339) (-4911.364) (-4912.403) -- 0:04:23
      217500 -- [-4905.098] (-4913.464) (-4919.762) (-4905.858) * (-4909.563) (-4912.384) (-4910.558) [-4911.942] -- 0:04:22
      218000 -- (-4906.515) (-4917.196) [-4906.348] (-4916.662) * (-4909.293) [-4912.152] (-4908.288) (-4910.813) -- 0:04:21
      218500 -- [-4911.224] (-4910.640) (-4906.939) (-4909.025) * (-4919.594) (-4908.412) [-4903.811] (-4915.576) -- 0:04:21
      219000 -- (-4908.584) (-4909.371) (-4909.758) [-4912.318] * (-4911.558) [-4905.209] (-4910.596) (-4912.459) -- 0:04:23
      219500 -- [-4910.388] (-4908.734) (-4913.463) (-4915.322) * (-4918.631) [-4918.725] (-4907.712) (-4911.879) -- 0:04:23
      220000 -- (-4917.127) (-4908.282) [-4911.664] (-4917.319) * [-4910.851] (-4913.886) (-4907.680) (-4914.030) -- 0:04:22

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-4915.020) [-4912.353] (-4910.086) (-4911.780) * (-4913.317) [-4913.273] (-4910.193) (-4912.529) -- 0:04:21
      221000 -- [-4911.886] (-4909.533) (-4906.153) (-4920.047) * (-4906.309) [-4909.414] (-4921.227) (-4916.156) -- 0:04:20
      221500 -- (-4907.854) [-4908.454] (-4917.232) (-4924.888) * (-4911.210) (-4909.581) [-4915.553] (-4914.395) -- 0:04:20
      222000 -- [-4911.503] (-4911.746) (-4917.440) (-4916.748) * (-4907.035) [-4911.041] (-4912.437) (-4915.589) -- 0:04:22
      222500 -- (-4918.149) (-4917.596) (-4915.562) [-4908.313] * (-4911.888) (-4912.576) [-4913.474] (-4912.547) -- 0:04:22
      223000 -- [-4908.906] (-4912.518) (-4916.684) (-4914.431) * (-4905.792) (-4907.804) (-4910.973) [-4914.613] -- 0:04:21
      223500 -- (-4907.205) (-4911.672) [-4915.575] (-4912.847) * (-4909.307) (-4911.245) (-4910.313) [-4914.724] -- 0:04:20
      224000 -- [-4910.279] (-4911.012) (-4924.224) (-4921.152) * (-4911.136) (-4906.598) (-4909.799) [-4912.389] -- 0:04:19
      224500 -- (-4906.510) [-4912.673] (-4923.422) (-4920.008) * (-4921.735) [-4906.846] (-4919.294) (-4908.747) -- 0:04:19
      225000 -- [-4913.917] (-4908.465) (-4916.025) (-4918.064) * (-4911.676) (-4911.762) [-4911.500] (-4909.870) -- 0:04:21

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-4908.608) (-4917.158) (-4919.568) [-4910.784] * (-4910.527) (-4911.193) (-4911.044) [-4911.592] -- 0:04:21
      226000 -- [-4912.618] (-4910.679) (-4918.673) (-4912.902) * (-4914.315) [-4911.927] (-4911.978) (-4918.704) -- 0:04:20
      226500 -- (-4911.908) [-4916.394] (-4915.113) (-4912.844) * (-4911.429) (-4905.651) (-4908.765) [-4912.440] -- 0:04:19
      227000 -- (-4911.478) [-4920.624] (-4917.300) (-4912.076) * (-4906.974) [-4908.434] (-4906.305) (-4914.790) -- 0:04:18
      227500 -- (-4911.476) (-4913.832) [-4915.668] (-4908.741) * (-4908.819) [-4914.564] (-4919.127) (-4915.523) -- 0:04:18
      228000 -- (-4910.390) (-4912.240) [-4915.875] (-4910.774) * (-4918.308) (-4917.661) [-4910.912] (-4912.554) -- 0:04:20
      228500 -- (-4908.901) (-4915.557) [-4913.504] (-4911.996) * (-4909.827) (-4913.778) (-4909.040) [-4914.212] -- 0:04:19
      229000 -- [-4915.185] (-4915.214) (-4909.612) (-4913.385) * (-4914.181) [-4904.848] (-4907.665) (-4919.332) -- 0:04:19
      229500 -- (-4921.626) (-4913.718) [-4907.074] (-4920.135) * [-4913.827] (-4910.990) (-4912.459) (-4914.506) -- 0:04:18
      230000 -- (-4919.855) (-4924.204) (-4912.597) [-4908.987] * [-4907.811] (-4914.784) (-4918.505) (-4909.738) -- 0:04:17

      Average standard deviation of split frequencies: 0.000000

      230500 -- [-4909.990] (-4912.068) (-4906.221) (-4909.684) * [-4907.893] (-4913.647) (-4915.143) (-4906.129) -- 0:04:17
      231000 -- [-4907.786] (-4913.665) (-4912.646) (-4909.688) * (-4912.001) (-4915.746) (-4909.407) [-4910.532] -- 0:04:19
      231500 -- (-4917.669) (-4909.627) [-4911.699] (-4910.516) * [-4906.560] (-4914.087) (-4907.059) (-4915.053) -- 0:04:18
      232000 -- (-4921.553) (-4911.734) (-4920.145) [-4912.762] * (-4916.750) [-4911.584] (-4910.639) (-4909.388) -- 0:04:18
      232500 -- [-4915.373] (-4907.610) (-4922.552) (-4915.866) * (-4909.663) (-4916.758) [-4911.646] (-4914.752) -- 0:04:17
      233000 -- (-4911.860) [-4913.759] (-4914.986) (-4909.494) * [-4912.737] (-4911.813) (-4908.555) (-4911.218) -- 0:04:16
      233500 -- [-4915.521] (-4917.634) (-4911.782) (-4904.795) * (-4918.257) (-4912.357) [-4911.517] (-4910.616) -- 0:04:16
      234000 -- (-4917.521) [-4913.628] (-4911.423) (-4909.969) * (-4908.595) (-4909.111) [-4911.466] (-4912.161) -- 0:04:18
      234500 -- (-4904.721) (-4919.756) [-4910.237] (-4917.890) * (-4909.642) [-4911.478] (-4918.371) (-4910.004) -- 0:04:17
      235000 -- [-4909.042] (-4915.077) (-4912.369) (-4917.109) * (-4908.615) [-4909.654] (-4917.050) (-4907.940) -- 0:04:17

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-4912.577) [-4914.129] (-4906.724) (-4915.919) * (-4913.613) (-4913.926) (-4912.654) [-4907.975] -- 0:04:16
      236000 -- [-4909.688] (-4917.358) (-4910.023) (-4917.737) * (-4912.633) [-4912.056] (-4909.811) (-4912.486) -- 0:04:15
      236500 -- [-4910.463] (-4912.800) (-4910.224) (-4909.327) * (-4910.104) [-4911.210] (-4917.774) (-4913.506) -- 0:04:15
      237000 -- (-4906.050) [-4910.740] (-4914.273) (-4909.906) * (-4911.304) (-4915.122) [-4912.758] (-4905.770) -- 0:04:14
      237500 -- (-4910.528) [-4912.751] (-4911.101) (-4908.196) * [-4905.731] (-4918.348) (-4907.811) (-4909.770) -- 0:04:16
      238000 -- [-4913.831] (-4913.225) (-4911.624) (-4914.240) * [-4915.058] (-4914.469) (-4910.895) (-4913.425) -- 0:04:16
      238500 -- (-4908.987) [-4910.135] (-4917.658) (-4908.031) * (-4915.849) (-4928.638) [-4909.819] (-4919.016) -- 0:04:15
      239000 -- [-4907.963] (-4911.642) (-4913.697) (-4905.151) * (-4915.106) [-4907.840] (-4911.564) (-4916.799) -- 0:04:14
      239500 -- (-4909.659) (-4912.473) [-4909.293] (-4913.441) * (-4909.059) (-4910.761) (-4911.054) [-4905.670] -- 0:04:14
      240000 -- (-4908.804) [-4911.264] (-4911.218) (-4914.175) * (-4904.713) (-4914.766) [-4908.010] (-4909.353) -- 0:04:13

      Average standard deviation of split frequencies: 0.000979

      240500 -- (-4910.792) (-4909.970) [-4917.212] (-4910.645) * (-4917.849) [-4912.076] (-4908.070) (-4910.137) -- 0:04:15
      241000 -- [-4907.248] (-4907.401) (-4904.662) (-4914.312) * (-4907.937) (-4913.730) (-4917.464) [-4915.602] -- 0:04:15
      241500 -- (-4908.807) [-4907.038] (-4908.874) (-4907.390) * (-4914.574) [-4910.621] (-4909.855) (-4913.173) -- 0:04:14
      242000 -- (-4916.866) (-4909.370) (-4910.941) [-4908.605] * (-4906.691) (-4915.006) [-4908.141] (-4922.094) -- 0:04:13
      242500 -- [-4912.297] (-4915.153) (-4915.351) (-4908.219) * (-4913.297) (-4916.316) [-4912.445] (-4910.387) -- 0:04:13
      243000 -- (-4914.793) (-4911.565) (-4911.185) [-4912.078] * (-4910.850) (-4911.027) [-4909.948] (-4912.890) -- 0:04:12
      243500 -- [-4911.250] (-4913.972) (-4905.803) (-4909.032) * (-4911.779) [-4906.528] (-4912.518) (-4913.851) -- 0:04:14
      244000 -- (-4915.374) (-4907.393) [-4915.978] (-4915.257) * (-4916.913) [-4912.334] (-4912.498) (-4919.354) -- 0:04:14
      244500 -- (-4913.966) (-4911.791) [-4912.092] (-4908.325) * (-4915.775) (-4909.681) [-4913.444] (-4909.422) -- 0:04:13
      245000 -- [-4915.791] (-4911.369) (-4915.350) (-4918.582) * (-4921.363) (-4910.025) [-4915.766] (-4917.731) -- 0:04:12

      Average standard deviation of split frequencies: 0.000958

      245500 -- [-4907.682] (-4911.594) (-4912.943) (-4912.610) * (-4920.925) (-4907.049) (-4911.492) [-4909.219] -- 0:04:12
      246000 -- (-4906.477) [-4907.518] (-4915.347) (-4920.184) * (-4911.352) [-4906.620] (-4919.928) (-4906.846) -- 0:04:11
      246500 -- (-4911.803) (-4912.779) (-4917.656) [-4911.719] * (-4909.538) [-4909.954] (-4913.136) (-4910.614) -- 0:04:13
      247000 -- (-4911.753) [-4914.369] (-4911.529) (-4918.657) * (-4915.820) (-4909.705) (-4908.353) [-4912.589] -- 0:04:13
      247500 -- (-4909.913) [-4915.182] (-4911.987) (-4914.772) * (-4914.414) (-4910.177) [-4913.006] (-4911.482) -- 0:04:12
      248000 -- [-4911.418] (-4916.701) (-4915.872) (-4911.546) * [-4912.490] (-4907.334) (-4911.152) (-4908.809) -- 0:04:11
      248500 -- [-4912.061] (-4916.282) (-4912.583) (-4908.079) * [-4908.786] (-4911.993) (-4911.694) (-4912.367) -- 0:04:11
      249000 -- (-4912.110) [-4911.155] (-4915.140) (-4912.475) * [-4906.057] (-4908.762) (-4908.006) (-4909.780) -- 0:04:10
      249500 -- [-4913.736] (-4910.030) (-4909.408) (-4909.128) * (-4908.653) (-4910.091) [-4909.279] (-4910.488) -- 0:04:12
      250000 -- (-4912.693) (-4912.153) (-4907.458) [-4910.295] * (-4919.387) (-4912.935) (-4910.448) [-4905.739] -- 0:04:12

      Average standard deviation of split frequencies: 0.000940

      250500 -- (-4914.631) (-4911.234) (-4906.464) [-4908.080] * (-4919.078) (-4913.237) (-4915.111) [-4909.491] -- 0:04:11
      251000 -- (-4910.712) (-4907.678) [-4913.068] (-4907.726) * (-4919.636) (-4911.049) (-4906.788) [-4910.870] -- 0:04:10
      251500 -- (-4905.728) (-4912.124) (-4914.881) [-4908.673] * [-4909.460] (-4906.874) (-4908.195) (-4908.502) -- 0:04:09
      252000 -- (-4912.402) [-4909.358] (-4910.297) (-4916.664) * (-4910.486) (-4915.003) [-4914.438] (-4914.817) -- 0:04:09
      252500 -- (-4914.823) (-4909.237) (-4911.801) [-4911.492] * (-4911.989) (-4911.801) [-4911.669] (-4912.749) -- 0:04:11
      253000 -- (-4910.865) (-4913.358) (-4910.963) [-4905.056] * (-4910.713) [-4909.213] (-4913.346) (-4913.239) -- 0:04:10
      253500 -- [-4913.493] (-4914.701) (-4910.593) (-4910.766) * [-4910.465] (-4907.642) (-4920.064) (-4909.862) -- 0:04:10
      254000 -- (-4910.740) (-4911.649) (-4906.075) [-4908.587] * (-4912.863) [-4911.873] (-4926.323) (-4911.943) -- 0:04:09
      254500 -- [-4907.002] (-4907.852) (-4904.812) (-4914.284) * [-4908.655] (-4913.503) (-4913.336) (-4906.016) -- 0:04:08
      255000 -- (-4915.829) [-4907.926] (-4911.085) (-4912.470) * (-4921.488) (-4915.040) [-4911.548] (-4907.212) -- 0:04:08

      Average standard deviation of split frequencies: 0.000921

      255500 -- [-4914.512] (-4910.749) (-4906.811) (-4913.416) * [-4913.740] (-4909.080) (-4916.686) (-4911.638) -- 0:04:10
      256000 -- (-4917.257) (-4912.046) (-4913.288) [-4905.624] * (-4914.497) (-4917.628) [-4908.387] (-4910.101) -- 0:04:09
      256500 -- [-4914.412] (-4907.426) (-4909.644) (-4910.827) * [-4912.003] (-4920.649) (-4917.882) (-4908.786) -- 0:04:09
      257000 -- (-4912.199) (-4921.408) [-4906.934] (-4911.298) * (-4910.692) (-4910.552) (-4918.861) [-4909.529] -- 0:04:08
      257500 -- [-4912.752] (-4913.885) (-4907.564) (-4910.559) * (-4907.926) [-4905.430] (-4929.704) (-4913.398) -- 0:04:07
      258000 -- (-4911.548) (-4911.172) (-4914.261) [-4913.716] * (-4909.183) [-4908.238] (-4921.270) (-4907.871) -- 0:04:07
      258500 -- (-4910.296) [-4908.675] (-4908.862) (-4910.040) * (-4913.362) (-4908.050) (-4915.700) [-4910.577] -- 0:04:09
      259000 -- (-4912.428) [-4908.321] (-4911.263) (-4922.888) * (-4914.045) (-4909.831) (-4912.424) [-4911.788] -- 0:04:08
      259500 -- (-4913.588) (-4909.406) [-4904.886] (-4913.159) * (-4906.991) (-4910.207) [-4912.867] (-4907.911) -- 0:04:08
      260000 -- (-4916.497) (-4912.719) (-4913.455) [-4914.702] * [-4908.404] (-4914.457) (-4915.442) (-4915.502) -- 0:04:07

      Average standard deviation of split frequencies: 0.000904

      260500 -- (-4912.723) (-4907.518) [-4916.561] (-4918.386) * (-4907.370) (-4921.636) (-4908.650) [-4906.080] -- 0:04:06
      261000 -- (-4915.603) [-4909.143] (-4909.180) (-4913.485) * (-4912.264) (-4919.366) (-4912.609) [-4910.168] -- 0:04:06
      261500 -- [-4911.257] (-4909.988) (-4914.037) (-4915.712) * (-4919.841) (-4911.245) (-4911.450) [-4911.953] -- 0:04:05
      262000 -- (-4920.509) [-4908.239] (-4909.175) (-4917.294) * (-4913.678) (-4913.115) (-4919.185) [-4908.030] -- 0:04:07
      262500 -- [-4906.522] (-4910.370) (-4916.803) (-4908.738) * (-4911.949) (-4910.745) [-4913.547] (-4919.373) -- 0:04:07
      263000 -- (-4905.450) [-4906.362] (-4916.903) (-4913.433) * (-4911.097) (-4913.153) (-4915.246) [-4920.866] -- 0:04:06
      263500 -- (-4918.635) (-4917.308) (-4910.387) [-4919.108] * (-4915.476) [-4911.002] (-4914.839) (-4908.887) -- 0:04:05
      264000 -- (-4908.573) (-4912.008) (-4911.577) [-4916.047] * (-4907.798) [-4910.531] (-4915.083) (-4913.163) -- 0:04:05
      264500 -- [-4906.585] (-4914.051) (-4914.691) (-4913.311) * (-4911.191) (-4915.236) [-4920.009] (-4913.967) -- 0:04:04
      265000 -- (-4910.466) [-4908.378] (-4910.812) (-4915.582) * (-4916.033) (-4910.655) [-4908.837] (-4915.364) -- 0:04:06

      Average standard deviation of split frequencies: 0.000886

      265500 -- (-4906.400) (-4910.935) [-4910.949] (-4908.612) * (-4912.890) (-4911.701) [-4906.122] (-4921.316) -- 0:04:06
      266000 -- (-4915.359) (-4910.041) (-4908.024) [-4910.403] * (-4909.289) [-4915.748] (-4908.672) (-4907.625) -- 0:04:05
      266500 -- (-4915.874) [-4908.799] (-4914.548) (-4910.965) * [-4909.587] (-4915.001) (-4912.434) (-4913.397) -- 0:04:04
      267000 -- (-4911.518) (-4908.770) [-4911.682] (-4910.311) * [-4914.614] (-4912.035) (-4907.092) (-4910.007) -- 0:04:04
      267500 -- (-4912.498) (-4908.770) (-4908.773) [-4910.811] * (-4916.304) (-4908.903) (-4913.015) [-4910.977] -- 0:04:03
      268000 -- (-4907.486) (-4918.555) (-4917.118) [-4908.922] * (-4919.712) [-4910.896] (-4912.128) (-4916.116) -- 0:04:05
      268500 -- [-4910.611] (-4916.441) (-4921.314) (-4915.456) * [-4916.811] (-4911.174) (-4924.779) (-4916.110) -- 0:04:05
      269000 -- (-4912.324) (-4914.069) [-4912.133] (-4912.049) * (-4913.928) (-4915.156) (-4914.839) [-4914.228] -- 0:04:04
      269500 -- [-4912.240] (-4914.436) (-4920.639) (-4910.239) * (-4913.144) [-4913.057] (-4909.972) (-4908.984) -- 0:04:03
      270000 -- (-4911.668) (-4909.554) (-4912.728) [-4914.632] * (-4913.539) (-4911.452) (-4907.685) [-4908.727] -- 0:04:03

      Average standard deviation of split frequencies: 0.000871

      270500 -- (-4911.503) (-4909.052) (-4911.994) [-4915.489] * [-4912.831] (-4918.741) (-4909.887) (-4913.566) -- 0:04:02
      271000 -- (-4909.834) [-4912.515] (-4907.327) (-4908.538) * (-4912.599) [-4911.065] (-4912.786) (-4914.165) -- 0:04:04
      271500 -- [-4909.289] (-4909.109) (-4909.970) (-4915.078) * [-4911.493] (-4913.009) (-4915.855) (-4915.201) -- 0:04:04
      272000 -- (-4905.044) (-4911.389) [-4909.390] (-4905.297) * [-4909.806] (-4913.830) (-4920.113) (-4918.455) -- 0:04:03
      272500 -- (-4912.228) (-4910.488) (-4905.219) [-4918.639] * (-4911.764) [-4910.308] (-4914.506) (-4909.165) -- 0:04:02
      273000 -- (-4907.064) [-4906.160] (-4909.481) (-4913.207) * [-4919.580] (-4918.679) (-4913.487) (-4914.023) -- 0:04:02
      273500 -- (-4906.839) (-4915.915) [-4910.704] (-4916.669) * (-4913.958) (-4915.407) [-4906.254] (-4908.243) -- 0:04:01
      274000 -- [-4907.483] (-4912.421) (-4908.605) (-4907.196) * [-4915.290] (-4911.848) (-4907.649) (-4915.873) -- 0:04:03
      274500 -- (-4907.541) (-4915.587) (-4911.337) [-4910.343] * (-4915.156) (-4910.589) [-4910.495] (-4913.732) -- 0:04:03
      275000 -- (-4910.818) [-4918.953] (-4908.932) (-4917.794) * (-4912.327) (-4917.446) [-4908.991] (-4903.417) -- 0:04:02

      Average standard deviation of split frequencies: 0.000854

      275500 -- [-4912.219] (-4908.579) (-4911.333) (-4912.690) * (-4914.725) (-4911.200) (-4911.189) [-4906.600] -- 0:04:01
      276000 -- [-4910.856] (-4913.312) (-4913.885) (-4912.007) * (-4908.920) [-4910.500] (-4910.574) (-4918.272) -- 0:04:01
      276500 -- (-4917.583) (-4915.062) (-4918.551) [-4906.989] * (-4916.858) [-4908.882] (-4913.833) (-4912.116) -- 0:04:00
      277000 -- [-4908.026] (-4913.260) (-4914.455) (-4915.633) * (-4912.983) [-4914.146] (-4909.950) (-4916.039) -- 0:04:02
      277500 -- (-4916.213) [-4911.222] (-4910.241) (-4917.976) * (-4912.857) (-4915.302) (-4906.855) [-4907.147] -- 0:04:02
      278000 -- (-4912.047) (-4911.885) [-4911.052] (-4907.793) * (-4913.711) [-4908.001] (-4912.630) (-4914.607) -- 0:04:01
      278500 -- (-4913.852) (-4909.106) (-4907.710) [-4916.141] * (-4912.668) [-4909.818] (-4914.789) (-4910.240) -- 0:04:00
      279000 -- (-4919.661) (-4910.115) [-4913.808] (-4911.098) * (-4916.072) (-4909.933) [-4907.392] (-4907.632) -- 0:04:00
      279500 -- (-4912.322) (-4911.269) (-4910.385) [-4908.632] * (-4917.076) (-4908.256) (-4912.953) [-4913.293] -- 0:03:59
      280000 -- [-4909.056] (-4913.378) (-4924.626) (-4907.208) * [-4906.053] (-4910.750) (-4911.383) (-4908.664) -- 0:04:01

      Average standard deviation of split frequencies: 0.000840

      280500 -- (-4908.793) (-4915.735) [-4915.450] (-4910.678) * [-4909.792] (-4908.854) (-4907.777) (-4912.338) -- 0:04:01
      281000 -- (-4908.474) (-4910.263) [-4911.729] (-4914.982) * (-4918.217) (-4906.806) [-4909.053] (-4909.570) -- 0:04:00
      281500 -- (-4909.423) (-4911.174) (-4912.249) [-4915.071] * (-4914.957) [-4912.720] (-4907.818) (-4908.183) -- 0:03:59
      282000 -- [-4915.337] (-4909.200) (-4907.436) (-4907.739) * (-4912.279) [-4911.864] (-4910.277) (-4908.675) -- 0:03:59
      282500 -- (-4924.898) (-4912.710) (-4912.519) [-4909.237] * (-4908.558) (-4913.250) [-4907.170] (-4910.307) -- 0:03:58
      283000 -- (-4916.775) (-4911.790) [-4908.735] (-4910.513) * (-4909.558) (-4907.615) (-4916.701) [-4912.324] -- 0:04:00
      283500 -- (-4918.909) (-4915.684) (-4911.510) [-4915.138] * (-4909.280) [-4905.613] (-4914.696) (-4916.233) -- 0:04:00
      284000 -- (-4916.975) [-4910.224] (-4909.660) (-4909.625) * (-4910.252) (-4909.709) (-4910.041) [-4908.582] -- 0:03:59
      284500 -- [-4910.941] (-4917.689) (-4909.875) (-4910.286) * (-4914.429) [-4917.345] (-4910.719) (-4913.637) -- 0:03:58
      285000 -- [-4906.497] (-4912.506) (-4914.065) (-4915.313) * (-4910.936) (-4919.924) [-4906.490] (-4912.259) -- 0:03:58

      Average standard deviation of split frequencies: 0.000824

      285500 -- (-4914.001) (-4914.126) (-4911.329) [-4913.320] * (-4905.362) [-4913.023] (-4909.867) (-4915.222) -- 0:03:57
      286000 -- [-4914.584] (-4914.211) (-4911.970) (-4912.454) * (-4911.312) (-4911.787) (-4919.726) [-4909.875] -- 0:03:59
      286500 -- (-4912.794) (-4908.953) [-4918.150] (-4911.107) * (-4911.428) (-4913.976) (-4917.661) [-4907.283] -- 0:03:59
      287000 -- [-4908.622] (-4912.252) (-4914.212) (-4914.857) * (-4912.211) [-4907.239] (-4918.173) (-4911.742) -- 0:03:58
      287500 -- (-4909.852) (-4910.524) [-4920.280] (-4919.844) * (-4910.728) (-4914.701) [-4914.625] (-4909.831) -- 0:03:57
      288000 -- (-4910.793) [-4910.561] (-4913.869) (-4915.021) * (-4904.330) [-4915.020] (-4907.560) (-4912.948) -- 0:03:57
      288500 -- (-4911.524) (-4909.303) [-4913.921] (-4918.750) * (-4917.798) (-4911.344) [-4909.533] (-4913.886) -- 0:03:56
      289000 -- [-4906.942] (-4909.629) (-4913.720) (-4914.352) * (-4903.372) [-4908.645] (-4910.470) (-4909.983) -- 0:03:58
      289500 -- (-4907.160) [-4909.211] (-4910.942) (-4922.824) * (-4916.720) (-4915.449) [-4910.380] (-4909.435) -- 0:03:58
      290000 -- (-4908.695) (-4913.794) (-4912.214) [-4917.329] * (-4916.041) [-4909.985] (-4915.801) (-4909.743) -- 0:03:57

      Average standard deviation of split frequencies: 0.000811

      290500 -- (-4911.846) (-4911.503) [-4915.420] (-4910.931) * (-4911.835) [-4911.861] (-4915.100) (-4915.730) -- 0:03:56
      291000 -- (-4909.726) (-4916.055) [-4908.895] (-4906.434) * [-4906.559] (-4914.587) (-4911.248) (-4915.938) -- 0:03:56
      291500 -- (-4919.982) [-4908.675] (-4912.350) (-4907.893) * (-4906.511) (-4910.742) (-4907.623) [-4916.795] -- 0:03:55
      292000 -- (-4913.608) (-4907.701) (-4914.214) [-4908.754] * [-4909.445] (-4913.447) (-4911.352) (-4917.570) -- 0:03:57
      292500 -- [-4915.042] (-4908.743) (-4911.074) (-4911.189) * (-4918.816) [-4906.658] (-4917.279) (-4922.536) -- 0:03:57
      293000 -- (-4913.314) [-4910.863] (-4918.197) (-4917.567) * (-4919.347) [-4910.609] (-4912.124) (-4908.922) -- 0:03:56
      293500 -- (-4911.040) (-4909.764) [-4909.632] (-4909.583) * (-4916.643) (-4916.323) [-4913.341] (-4906.976) -- 0:03:55
      294000 -- (-4919.743) (-4913.540) (-4908.629) [-4909.703] * (-4916.721) (-4913.460) [-4915.583] (-4911.065) -- 0:03:55
      294500 -- (-4913.394) [-4908.206] (-4916.935) (-4920.201) * (-4915.716) [-4912.700] (-4918.239) (-4909.767) -- 0:03:54
      295000 -- (-4906.180) (-4914.768) (-4907.668) [-4910.961] * (-4912.552) (-4916.235) [-4909.138] (-4908.163) -- 0:03:54

      Average standard deviation of split frequencies: 0.000796

      295500 -- (-4913.877) (-4909.996) (-4911.119) [-4918.367] * (-4916.977) (-4919.034) (-4919.138) [-4907.205] -- 0:03:56
      296000 -- (-4919.650) (-4910.932) [-4911.180] (-4909.034) * [-4909.046] (-4919.833) (-4913.369) (-4910.810) -- 0:03:55
      296500 -- [-4911.222] (-4913.079) (-4915.029) (-4911.529) * (-4920.813) (-4911.590) (-4906.762) [-4908.892] -- 0:03:54
      297000 -- (-4919.093) (-4913.823) (-4914.151) [-4908.954] * (-4914.013) (-4919.137) [-4913.305] (-4913.791) -- 0:03:54
      297500 -- (-4913.891) [-4908.595] (-4915.149) (-4911.142) * [-4908.850] (-4914.528) (-4911.344) (-4916.967) -- 0:03:53
      298000 -- (-4916.197) (-4918.444) (-4911.088) [-4907.489] * (-4915.875) (-4918.235) [-4907.943] (-4914.651) -- 0:03:53
      298500 -- (-4915.180) (-4921.249) (-4910.808) [-4907.340] * (-4914.046) (-4918.183) (-4915.306) [-4913.926] -- 0:03:55
      299000 -- (-4915.563) (-4916.169) [-4907.772] (-4913.774) * (-4911.082) (-4915.153) (-4908.659) [-4913.394] -- 0:03:54
      299500 -- (-4921.611) (-4918.818) [-4908.049] (-4920.001) * (-4908.902) [-4907.811] (-4910.955) (-4918.219) -- 0:03:53
      300000 -- (-4911.437) (-4912.459) (-4917.060) [-4916.167] * (-4906.396) (-4911.966) (-4910.797) [-4917.743] -- 0:03:53

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-4910.224) [-4917.345] (-4909.386) (-4916.345) * (-4907.539) (-4907.061) [-4908.262] (-4914.623) -- 0:03:52
      301000 -- (-4918.629) (-4909.006) (-4907.262) [-4910.429] * (-4912.041) [-4906.737] (-4913.362) (-4910.313) -- 0:03:52
      301500 -- (-4914.778) (-4907.210) [-4910.614] (-4908.671) * (-4914.351) (-4918.800) [-4908.290] (-4914.426) -- 0:03:53
      302000 -- (-4910.526) (-4914.719) [-4914.525] (-4914.341) * (-4913.213) [-4910.401] (-4910.900) (-4919.416) -- 0:03:53
      302500 -- (-4915.549) (-4909.789) (-4920.306) [-4911.339] * (-4917.105) [-4909.149] (-4911.942) (-4919.899) -- 0:03:52
      303000 -- (-4909.608) (-4909.980) (-4919.395) [-4907.377] * (-4914.205) (-4909.540) [-4909.243] (-4918.422) -- 0:03:52
      303500 -- (-4909.781) [-4918.460] (-4922.241) (-4911.997) * (-4912.914) (-4910.097) (-4909.546) [-4908.738] -- 0:03:51
      304000 -- (-4908.652) (-4907.184) (-4913.561) [-4914.294] * (-4917.820) (-4917.372) (-4916.064) [-4918.211] -- 0:03:51
      304500 -- (-4913.107) [-4914.126] (-4914.955) (-4916.151) * (-4910.955) [-4910.028] (-4909.626) (-4912.098) -- 0:03:52
      305000 -- [-4911.017] (-4911.180) (-4916.414) (-4910.035) * [-4909.972] (-4910.852) (-4911.759) (-4913.982) -- 0:03:52

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-4914.649) [-4909.288] (-4911.370) (-4908.390) * (-4910.033) (-4907.577) [-4915.913] (-4908.621) -- 0:03:51
      306000 -- [-4911.378] (-4913.443) (-4909.801) (-4916.702) * [-4909.788] (-4916.253) (-4919.534) (-4913.465) -- 0:03:51
      306500 -- [-4909.742] (-4913.798) (-4915.260) (-4909.746) * [-4911.171] (-4906.510) (-4908.855) (-4912.603) -- 0:03:50
      307000 -- (-4909.380) [-4910.581] (-4909.360) (-4914.444) * (-4910.797) (-4913.106) (-4911.002) [-4908.228] -- 0:03:50
      307500 -- [-4913.703] (-4911.841) (-4910.068) (-4908.107) * [-4907.557] (-4912.188) (-4915.640) (-4910.233) -- 0:03:51
      308000 -- [-4909.533] (-4913.903) (-4907.707) (-4919.613) * [-4910.185] (-4911.195) (-4925.550) (-4912.051) -- 0:03:51
      308500 -- (-4916.399) (-4908.748) (-4913.107) [-4909.968] * (-4914.153) (-4913.993) [-4909.716] (-4909.812) -- 0:03:50
      309000 -- (-4915.102) [-4911.411] (-4911.239) (-4910.783) * (-4917.659) (-4914.066) (-4907.523) [-4910.209] -- 0:03:50
      309500 -- (-4913.215) (-4911.760) (-4916.210) [-4910.371] * [-4913.557] (-4912.015) (-4915.444) (-4909.664) -- 0:03:49
      310000 -- [-4910.527] (-4910.906) (-4913.411) (-4914.241) * (-4915.917) (-4909.625) [-4905.597] (-4914.506) -- 0:03:49

      Average standard deviation of split frequencies: 0.000000

      310500 -- [-4916.765] (-4914.075) (-4908.347) (-4909.798) * (-4911.169) (-4918.392) (-4912.605) [-4912.636] -- 0:03:50
      311000 -- (-4907.119) [-4908.577] (-4914.523) (-4914.515) * (-4916.192) (-4913.972) [-4913.703] (-4916.131) -- 0:03:50
      311500 -- (-4908.816) [-4911.920] (-4909.942) (-4916.446) * (-4910.014) (-4907.975) [-4906.794] (-4909.761) -- 0:03:49
      312000 -- (-4909.407) (-4914.249) (-4913.139) [-4910.777] * (-4910.336) [-4913.957] (-4910.465) (-4912.409) -- 0:03:49
      312500 -- (-4908.706) (-4914.240) [-4910.279] (-4912.569) * (-4907.180) (-4920.521) [-4906.753] (-4914.669) -- 0:03:48
      313000 -- (-4913.655) [-4911.552] (-4912.646) (-4911.253) * [-4910.135] (-4913.118) (-4908.972) (-4918.146) -- 0:03:48
      313500 -- (-4919.396) (-4912.746) [-4909.172] (-4907.605) * (-4912.277) (-4911.536) [-4913.725] (-4910.648) -- 0:03:49
      314000 -- (-4912.369) [-4910.851] (-4908.485) (-4917.212) * (-4917.986) (-4911.626) (-4913.032) [-4909.131] -- 0:03:49
      314500 -- (-4917.446) [-4907.195] (-4914.105) (-4913.359) * [-4914.225] (-4914.350) (-4911.800) (-4913.987) -- 0:03:48
      315000 -- (-4908.913) (-4907.760) (-4908.369) [-4915.190] * (-4913.648) (-4916.476) [-4910.676] (-4912.916) -- 0:03:48

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-4921.420) (-4910.480) [-4905.690] (-4913.631) * [-4915.419] (-4923.021) (-4909.122) (-4908.576) -- 0:03:47
      316000 -- (-4916.456) [-4908.471] (-4911.382) (-4915.906) * (-4913.557) (-4908.573) (-4921.286) [-4912.312] -- 0:03:47
      316500 -- (-4914.084) [-4908.732] (-4912.834) (-4914.270) * (-4912.935) [-4912.434] (-4912.559) (-4918.970) -- 0:03:48
      317000 -- (-4918.118) (-4912.338) (-4914.997) [-4912.580] * [-4909.904] (-4913.186) (-4921.180) (-4915.514) -- 0:03:48
      317500 -- [-4910.055] (-4917.915) (-4916.698) (-4906.334) * (-4909.530) (-4912.938) [-4918.869] (-4909.467) -- 0:03:47
      318000 -- (-4910.033) (-4916.568) (-4919.593) [-4906.288] * [-4913.848] (-4912.146) (-4917.436) (-4909.661) -- 0:03:47
      318500 -- (-4913.880) (-4910.147) [-4914.085] (-4912.028) * [-4910.793] (-4911.671) (-4909.673) (-4927.597) -- 0:03:46
      319000 -- (-4911.832) [-4910.387] (-4920.657) (-4907.122) * (-4923.182) (-4912.707) [-4907.801] (-4907.760) -- 0:03:46
      319500 -- (-4908.530) [-4915.937] (-4913.567) (-4908.279) * (-4916.522) (-4912.191) [-4914.107] (-4910.300) -- 0:03:47
      320000 -- (-4908.893) (-4922.084) [-4908.156] (-4911.197) * (-4914.278) (-4915.732) (-4917.269) [-4915.878] -- 0:03:47

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-4913.674) [-4914.289] (-4907.843) (-4914.724) * (-4914.593) (-4912.827) (-4913.014) [-4911.587] -- 0:03:46
      321000 -- (-4915.012) [-4914.252] (-4912.269) (-4910.236) * (-4908.667) (-4910.836) (-4913.137) [-4910.653] -- 0:03:46
      321500 -- [-4914.656] (-4916.185) (-4909.967) (-4918.894) * (-4910.507) [-4911.404] (-4918.241) (-4906.516) -- 0:03:45
      322000 -- [-4913.437] (-4914.220) (-4912.888) (-4921.639) * [-4913.063] (-4918.880) (-4907.787) (-4915.245) -- 0:03:45
      322500 -- (-4914.576) (-4914.417) [-4909.804] (-4910.666) * [-4909.449] (-4919.252) (-4911.909) (-4907.317) -- 0:03:46
      323000 -- (-4913.328) [-4910.158] (-4909.350) (-4907.486) * (-4913.326) (-4920.352) (-4910.382) [-4912.450] -- 0:03:46
      323500 -- (-4907.719) (-4919.918) [-4907.880] (-4914.819) * [-4907.067] (-4920.488) (-4917.201) (-4915.728) -- 0:03:45
      324000 -- (-4909.178) [-4915.708] (-4911.028) (-4912.151) * [-4905.143] (-4917.590) (-4923.080) (-4916.171) -- 0:03:45
      324500 -- [-4910.430] (-4916.375) (-4920.318) (-4912.460) * (-4909.662) (-4919.193) (-4921.865) [-4910.669] -- 0:03:44
      325000 -- (-4914.281) (-4914.912) [-4908.285] (-4912.983) * (-4911.577) (-4921.669) [-4909.910] (-4914.054) -- 0:03:44

      Average standard deviation of split frequencies: 0.000000

      325500 -- [-4905.492] (-4908.793) (-4914.183) (-4917.696) * [-4908.019] (-4927.391) (-4909.482) (-4913.953) -- 0:03:45
      326000 -- [-4910.738] (-4908.179) (-4908.931) (-4910.248) * [-4913.017] (-4925.417) (-4913.410) (-4912.848) -- 0:03:45
      326500 -- (-4918.670) (-4912.621) (-4911.365) [-4910.148] * [-4910.701] (-4934.378) (-4910.082) (-4908.331) -- 0:03:44
      327000 -- [-4910.095] (-4910.603) (-4914.569) (-4914.387) * (-4911.474) [-4920.258] (-4915.665) (-4912.219) -- 0:03:44
      327500 -- (-4912.245) [-4910.987] (-4909.493) (-4916.583) * (-4913.802) (-4917.535) (-4911.616) [-4915.272] -- 0:03:43
      328000 -- [-4915.424] (-4919.857) (-4908.916) (-4920.115) * (-4909.195) [-4910.491] (-4910.218) (-4905.902) -- 0:03:43
      328500 -- [-4915.141] (-4910.678) (-4917.573) (-4911.014) * [-4909.991] (-4909.009) (-4910.176) (-4911.739) -- 0:03:44
      329000 -- (-4915.179) (-4910.230) (-4921.793) [-4909.469] * (-4907.312) (-4914.552) (-4912.154) [-4908.616] -- 0:03:44
      329500 -- (-4918.783) (-4913.653) (-4910.870) [-4908.950] * (-4905.894) [-4908.158] (-4908.527) (-4910.798) -- 0:03:43
      330000 -- (-4913.080) (-4910.722) (-4914.815) [-4910.422] * (-4912.431) (-4911.703) (-4911.426) [-4908.976] -- 0:03:43

      Average standard deviation of split frequencies: 0.000000

      330500 -- [-4907.857] (-4908.225) (-4916.367) (-4915.997) * (-4912.998) (-4917.417) [-4910.959] (-4910.397) -- 0:03:42
      331000 -- (-4911.553) [-4909.108] (-4910.433) (-4916.279) * (-4911.795) (-4917.013) (-4917.620) [-4910.775] -- 0:03:42
      331500 -- [-4909.580] (-4918.966) (-4910.077) (-4913.083) * [-4911.833] (-4915.101) (-4917.692) (-4913.599) -- 0:03:43
      332000 -- (-4910.479) (-4905.758) (-4912.098) [-4909.686] * (-4908.307) [-4906.904] (-4918.602) (-4915.651) -- 0:03:43
      332500 -- (-4914.490) [-4907.859] (-4912.353) (-4912.905) * (-4909.567) (-4911.547) (-4913.626) [-4911.562] -- 0:03:42
      333000 -- (-4916.839) [-4915.930] (-4918.247) (-4912.716) * (-4921.738) [-4910.410] (-4913.181) (-4907.022) -- 0:03:42
      333500 -- (-4913.054) (-4914.272) (-4920.068) [-4909.561] * [-4913.870] (-4915.604) (-4923.166) (-4917.091) -- 0:03:41
      334000 -- (-4914.479) (-4912.045) [-4913.508] (-4909.927) * [-4908.970] (-4908.171) (-4916.886) (-4909.134) -- 0:03:41
      334500 -- (-4914.201) (-4908.469) (-4910.029) [-4910.891] * (-4909.204) (-4920.935) [-4915.992] (-4914.224) -- 0:03:42
      335000 -- (-4911.240) [-4909.108] (-4912.827) (-4909.110) * (-4910.273) (-4910.809) [-4909.893] (-4914.344) -- 0:03:42

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-4911.939) [-4904.812] (-4915.265) (-4907.587) * (-4913.090) (-4909.405) (-4914.047) [-4914.056] -- 0:03:41
      336000 -- (-4914.047) (-4908.553) (-4907.296) [-4906.948] * (-4908.930) (-4917.555) [-4915.795] (-4918.994) -- 0:03:41
      336500 -- (-4909.421) (-4907.582) (-4915.823) [-4913.722] * (-4906.611) (-4911.162) [-4912.973] (-4911.123) -- 0:03:40
      337000 -- (-4910.615) (-4907.449) (-4908.281) [-4912.423] * [-4909.195] (-4911.346) (-4914.285) (-4910.466) -- 0:03:40
      337500 -- [-4910.872] (-4911.148) (-4914.406) (-4908.475) * [-4908.796] (-4908.997) (-4911.089) (-4908.096) -- 0:03:39
      338000 -- [-4907.132] (-4907.507) (-4906.827) (-4907.652) * (-4908.686) (-4916.074) [-4906.073] (-4920.913) -- 0:03:41
      338500 -- [-4906.387] (-4913.933) (-4910.156) (-4911.185) * (-4911.805) [-4909.750] (-4909.847) (-4911.956) -- 0:03:40
      339000 -- (-4912.156) (-4925.732) (-4913.190) [-4910.983] * [-4908.430] (-4914.348) (-4912.445) (-4913.151) -- 0:03:40
      339500 -- (-4911.254) [-4913.294] (-4911.614) (-4913.788) * (-4917.957) (-4908.635) [-4906.933] (-4913.985) -- 0:03:39
      340000 -- (-4908.974) (-4914.374) [-4905.282] (-4906.536) * [-4910.468] (-4914.338) (-4917.353) (-4914.753) -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      340500 -- (-4914.492) (-4909.701) [-4903.849] (-4912.077) * (-4918.575) (-4910.017) (-4915.388) [-4912.265] -- 0:03:38
      341000 -- (-4916.511) [-4916.046] (-4907.916) (-4911.293) * (-4914.283) [-4912.176] (-4918.901) (-4912.823) -- 0:03:40
      341500 -- (-4911.998) (-4914.131) (-4911.810) [-4906.778] * (-4912.506) [-4907.533] (-4912.121) (-4913.576) -- 0:03:39
      342000 -- [-4909.392] (-4909.736) (-4907.664) (-4918.749) * (-4915.073) (-4908.838) [-4912.648] (-4913.869) -- 0:03:39
      342500 -- (-4907.920) [-4910.086] (-4911.358) (-4923.974) * (-4911.688) (-4924.381) (-4916.278) [-4910.611] -- 0:03:38
      343000 -- (-4908.503) [-4911.756] (-4915.488) (-4910.189) * (-4912