--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 25 22:47:49 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/1/a6-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3204.57 -3216.25 2 -3204.41 -3214.11 -------------------------------------- TOTAL -3204.49 -3215.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.494469 0.002561 0.403878 0.600146 0.491270 1216.45 1315.94 1.000 r(A<->C){all} 0.083829 0.000354 0.048371 0.121392 0.082910 996.28 1047.77 1.001 r(A<->G){all} 0.231472 0.001178 0.162701 0.296255 0.229995 956.33 970.89 1.000 r(A<->T){all} 0.151369 0.001302 0.082303 0.221194 0.151080 732.33 767.44 1.000 r(C<->G){all} 0.042468 0.000107 0.024430 0.063947 0.041758 1152.53 1211.39 1.000 r(C<->T){all} 0.406973 0.001787 0.326939 0.488716 0.405765 806.64 879.70 1.000 r(G<->T){all} 0.083889 0.000510 0.040000 0.127269 0.082406 835.88 1032.41 1.001 pi(A){all} 0.203510 0.000107 0.183611 0.223294 0.203004 1051.92 1130.14 1.000 pi(C){all} 0.335351 0.000151 0.312895 0.360463 0.335100 1201.42 1243.91 1.000 pi(G){all} 0.305221 0.000143 0.282714 0.328476 0.304922 1245.76 1271.23 1.001 pi(T){all} 0.155918 0.000086 0.137952 0.174301 0.155922 1110.77 1145.84 1.000 alpha{1,2} 0.115273 0.002343 0.001491 0.190624 0.118266 1098.98 1151.26 1.000 alpha{3} 2.424566 0.674350 1.011004 4.030355 2.293460 1501.00 1501.00 1.000 pinvar{all} 0.094230 0.004881 0.000167 0.226638 0.080835 1256.74 1344.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2976.742037 Model 2: PositiveSelection -2976.726986 Model 0: one-ratio -2993.809564 Model 3: discrete -2976.726986 Model 7: beta -2977.367252 Model 8: beta&w>1 -2976.732429 Model 0 vs 1 34.13505400000031 Model 2 vs 1 0.03010199999971519 Model 8 vs 7 1.2696459999997387
>C1 MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALA SKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLI PAPGHRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNEQEPSSTARVR SQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGHPKPCRA STAASNGFATAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRI YELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPT PISLKLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAA AKLLKQQQPQLSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVALPL QLPRRRKLGoooooooooooo >C2 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQAALA SKTDRQLSHLQRRHVAATLQADVTIDLLSDDDETPSAGQSAAAGHNRLLI PAPGHRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSEQEPSSTARVR SQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGNPKPCRA STAATNGFATAEGGEGGNETGCFLEVDVGGGITARLPDETTVHTVIANRI YELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPALRAKVAPLVAPSPPT PISLKLSSDLSISLISDEDECESTGPHANGGVGTEPVHPVVVAAAEAHAA AKLLKQQQPQLSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVALPL QLPRRRKLGoooooooooooo >C3 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQAAFA SKTDRQLSQLQRRHVAATLQADVTIDLLSDDDDTPSAGQSTAAGHNRLLI PVPRHSLHRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNEQKPSSTL RVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTRVSGHAKP CRASTVASNGFVIAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIA NRIYELSLSKLREGLAFSGVPEYTHELMPEQLQKLSPALRAKVAPLVAPS PPTPISLKLSSDLSISLISDEDDCESTGTHANGGDGTEPVHPVVVAAAEA HAAAKLLKQQQPQLSVVQHLQYVGGGLATPVALALPVMAANPTSSASVVA LPLQLPRRRKLGooooooooo >C4 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQATLA SKTDRQLSHLQRRHAAATLQADVTIDLLSDDDDTPSAGQSTAAGHNRLLI PAPRHSLHRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNEQEPCSTA RVRSQLSMRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKLVSGHAKP CQASIAASNGIVTADGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIA NRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPALRAKVAPLVAPS PPTPISLKLSSDLSISLISDEDDCESTGPHANGGVGTEPVHPVVVAAAEA HAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVA LPLQLPRRRKLGooooooooo >C5 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQATVI ASKTDRLQRRHVAATLPADVTIDLLSDDDDDEREEAGPGPGPSTAASHNR LLIPAPFAVGQRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYNDQEGS SGAMARPQLSMRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTRLSGH LKPCRASTAASNGMVMAGGGGGDGGGGNDTSCFLEVDVGGGITATLPDET TVHTVIANRIYELSLSKLREGLAFSGAPEYTTDLLPEQLQKLSPALRAKV APLVAPSPPTPISLKLSSDLSISLISDDDDCESTGQHANGGGGGVGTELA HPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLASPVALALPVMAT ASSSASVVALPLQLPRRRKLG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=438 C1 MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQV-AL C2 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQA-AL C3 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQA-AF C4 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQA-TL C5 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQATVI ***:********************* ****** *:******:** *. .: C1 ASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDE------TPSAGQPAAA C2 ASKTDRQLSHLQRRHVAATLQADVTIDLLSDDDE------TPSAGQSAAA C3 ASKTDRQLSQLQRRHVAATLQADVTIDLLSDDDD------TPSAGQSTAA C4 ASKTDRQLSHLQRRHAAATLQADVTIDLLSDDDD------TPSAGQSTAA C5 ASKTDR----LQRRHVAATLPADVTIDLLSDDDDDEREEAGPGPGPSTAA ****** *****.*:** .***********: *..* .:** C1 GHNRLLIPAPG---HRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNE C2 GHNRLLIPAPG---HRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSE C3 GHNRLLIPVPRHSLHRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNE C4 GHNRLLIPAPRHSLHRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNE C5 SHNRLLIPAPFAVGQRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYND .*******.* :* *.****. :. ** :*:*********:.: C1 QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR C2 QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR C3 QKPSSTLRVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTR C4 QEPCSTARVRSQLSMRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKL C5 QEGSSGAMARPQLSMRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTR *: .* .*.************** ***:**********.****.* . C1 VSGHPKPCRASTAASNGFATAEGGEG----GNETGCFLEVDVGGGITATL C2 VSGNPKPCRASTAATNGFATAEGGEG----GNETGCFLEVDVGGGITARL C3 VSGHAKPCRASTVASNGFVIAEGGEG----GNETGCFLEVDVGGGITATL C4 VSGHAKPCQASIAASNGIVTADGGEG----GNETGCFLEVDVGGGITATL C5 LSGHLKPCRASTAASNGMVMAGGGGGDGGGGNDTSCFLEVDVGGGITATL :**: ***:** .*:**:. * ** * **:*.************* * C1 PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPAL C2 PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL C3 PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHELMPEQLQKLSPAL C4 PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL C5 PDETTVHTVIANRIYELSLSKLREGLAFSGAPEYTTDLLPEQLQKLSPAL ******************************.**** :*:*********** C1 RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGG---VG C2 RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDECESTGPHANGG---VG C3 RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGTHANGG---DG C4 RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHANGG---VG C5 RAKVAPLVAPSPPTPISLKLSSDLSISLISDDDDCESTGQHANGGGGGVG *******************************:*:***** *.*** * C1 TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP C2 TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP C3 TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLATPVALALP C4 TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP C5 TELAHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLASPVALALP ** .**************************************:******* C1 VMAANPTSSASVVALPLQLPRRRKLGoooooooooooo C2 VMAANPTSSASVVALPLQLPRRRKLGoooooooooooo C3 VMAANPTSSASVVALPLQLPRRRKLGooooooooo--- C4 VMAANPTSSASVVALPLQLPRRRKLGooooooooo--- C5 VMAT-ASSSASVVALPLQLPRRRKLG------------ ***: .:******************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 421 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 421 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10452] Library Relaxation: Multi_proc [72] Relaxation Summary: [10452]--->[9516] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/a6-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.318 Mb, Max= 30.744 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQV-AL ASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDE------TPSAGQPAAA GHNRLLIPAPG---HRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNE QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR VSGHPKPCRASTAASNGFATAEGGEG----GNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGG---VG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLGoooooooooooo >C2 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQA-AL ASKTDRQLSHLQRRHVAATLQADVTIDLLSDDDE------TPSAGQSAAA GHNRLLIPAPG---HRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSE QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR VSGNPKPCRASTAATNGFATAEGGEG----GNETGCFLEVDVGGGITARL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDECESTGPHANGG---VG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLGoooooooooooo >C3 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQA-AF ASKTDRQLSQLQRRHVAATLQADVTIDLLSDDDD------TPSAGQSTAA GHNRLLIPVPRHSLHRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNE QKPSSTLRVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTR VSGHAKPCRASTVASNGFVIAEGGEG----GNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHELMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGTHANGG---DG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLATPVALALP VMAANPTSSASVVALPLQLPRRRKLGooooooooo--- >C4 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQA-TL ASKTDRQLSHLQRRHAAATLQADVTIDLLSDDDD------TPSAGQSTAA GHNRLLIPAPRHSLHRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNE QEPCSTARVRSQLSMRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKL VSGHAKPCQASIAASNGIVTADGGEG----GNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHANGG---VG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLGooooooooo--- >C5 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQATVI ASKTDR----LQRRHVAATLPADVTIDLLSDDDDDEREEAGPGPGPSTAA SHNRLLIPAPFAVGQRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYND QEGSSGAMARPQLSMRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTR LSGHLKPCRASTAASNGMVMAGGGGGDGGGGNDTSCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGAPEYTTDLLPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDDDDCESTGQHANGGGGGVG TELAHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLASPVALALP VMAT-ASSSASVVALPLQLPRRRKLG------------ CLUSTAL W (1.83) multiple sequence alignment C1 MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALA C2 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQAALA C3 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQAAFA C4 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQATLA C5 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQAVIA ***:********************* ****** *:******:** *..:* C1 SKTDRLQRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLIPAPG C2 SKTDRLQRRHVAATLQADVTIDLLSDDDETPSAGQSAAAGHNRLLIPAPG C3 SKTDRLQRRHVAATLQADVTIDLLSDDDDTPSAGQSTAAGHNRLLIPVPR C4 SKTDRLQRRHAAATLQADVTIDLLSDDDDTPSAGQSTAAGHNRLLIPAPR C5 SKTDRLQRRHVAATLPADVTIDLLSDDDDGPGPGPSTAASHNRLLIPAPF **********.*:** .***********: *..* .:**.*******.* C1 HRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNEQEPSSTARVRSQLS C2 HRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSEQEPSSTARVRSQLS C3 HRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNEQKPSSTLRVRSQLS C4 HRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNEQEPCSTARVRSQLS C5 QRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYNDQEGSSGAMARPQLS :* *.****. :. ** :*:*********:.:*: .* .*.*** C1 MRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGHPKPCRASTAA C2 MRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGNPKPCRASTAA C3 MRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTRVSGHAKPCRASTVA C4 MRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKLVSGHAKPCQASIAA C5 MRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTRLSGHLKPCRASTAA *********** ***:**********.****.* . :**: ***:** .* C1 SNGFATAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELS C2 TNGFATAEGGEGGNETGCFLEVDVGGGITARLPDETTVHTVIANRIYELS C3 SNGFVIAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELS C4 SNGIVTADGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELS C5 SNGMVMAGGGGGGNDTSCFLEVDVGGGITATLPDETTVHTVIANRIYELS :**:. * ** ***:*.************* ******************* C1 LSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPTPISL C2 LSKLREGLAFSGVPEYTHDLMPEQLQKLSPALRAKVAPLVAPSPPTPISL C3 LSKLREGLAFSGVPEYTHELMPEQLQKLSPALRAKVAPLVAPSPPTPISL C4 LSKLREGLAFSGVPEYTHDLMPEQLQKLSPALRAKVAPLVAPSPPTPISL C5 LSKLREGLAFSGAPEYTTDLLPEQLQKLSPALRAKVAPLVAPSPPTPISL ************.**** :*:***************************** C1 KLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAAAKLL C2 KLSSDLSISLISDEDECESTGPHANGGVGTEPVHPVVVAAAEAHAAAKLL C3 KLSSDLSISLISDEDDCESTGTHANGGDGTEPVHPVVVAAAEAHAAAKLL C4 KLSSDLSISLISDEDDCESTGPHANGGVGTEPVHPVVVAAAEAHAAAKLL C5 KLSSDLSISLISDDDDCESTGQHANGGVGTELAHPVVVAAAEAHAAAKLL *************:*:***** *.*** *** .***************** C1 KQQQPQLSVVQHLQYVGGGLAAPVALALPVMAAPTSSASVVALPLQLPRR C2 KQQQPQLSVVQHLQYVGGGLAAPVALALPVMAAPTSSASVVALPLQLPRR C3 KQQQPQLSVVQHLQYVGGGLATPVALALPVMAAPTSSASVVALPLQLPRR C4 KQQQPQLSVVQHLQYVGGGLAAPVALALPVMAAPTSSASVVALPLQLPRR C5 KQQQPQLSVVQHLQYVGGGLASPVALALPVMATASSSASVVALPLQLPRR *********************:**********:.:*************** C1 RKLG C2 RKLG C3 RKLG C4 RKLG C5 RKLG **** >C1 MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALA SKTDRLQRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLIPAPG HRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNEQEPSSTARVRSQLS MRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGHPKPCRASTAA SNGFATAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELS LSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPTPISL KLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAAAKLL KQQQPQLSVVQHLQYVGGGLAAPVALALPVMAAPTSSASVVALPLQLPRR RKLG >C2 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQAALA SKTDRLQRRHVAATLQADVTIDLLSDDDETPSAGQSAAAGHNRLLIPAPG HRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSEQEPSSTARVRSQLS MRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGNPKPCRASTAA TNGFATAEGGEGGNETGCFLEVDVGGGITARLPDETTVHTVIANRIYELS LSKLREGLAFSGVPEYTHDLMPEQLQKLSPALRAKVAPLVAPSPPTPISL KLSSDLSISLISDEDECESTGPHANGGVGTEPVHPVVVAAAEAHAAAKLL KQQQPQLSVVQHLQYVGGGLAAPVALALPVMAAPTSSASVVALPLQLPRR RKLG >C3 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQAAFA SKTDRLQRRHVAATLQADVTIDLLSDDDDTPSAGQSTAAGHNRLLIPVPR HRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNEQKPSSTLRVRSQLS MRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTRVSGHAKPCRASTVA SNGFVIAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELS LSKLREGLAFSGVPEYTHELMPEQLQKLSPALRAKVAPLVAPSPPTPISL KLSSDLSISLISDEDDCESTGTHANGGDGTEPVHPVVVAAAEAHAAAKLL KQQQPQLSVVQHLQYVGGGLATPVALALPVMAAPTSSASVVALPLQLPRR RKLG >C4 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQATLA SKTDRLQRRHAAATLQADVTIDLLSDDDDTPSAGQSTAAGHNRLLIPAPR HRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNEQEPCSTARVRSQLS MRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKLVSGHAKPCQASIAA SNGIVTADGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELS LSKLREGLAFSGVPEYTHDLMPEQLQKLSPALRAKVAPLVAPSPPTPISL KLSSDLSISLISDEDDCESTGPHANGGVGTEPVHPVVVAAAEAHAAAKLL KQQQPQLSVVQHLQYVGGGLAAPVALALPVMAAPTSSASVVALPLQLPRR RKLG >C5 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQAVIA SKTDRLQRRHVAATLPADVTIDLLSDDDDGPGPGPSTAASHNRLLIPAPF QRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYNDQEGSSGAMARPQLS MRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTRLSGHLKPCRASTAA SNGMVMAGGGGGGNDTSCFLEVDVGGGITATLPDETTVHTVIANRIYELS LSKLREGLAFSGAPEYTTDLLPEQLQKLSPALRAKVAPLVAPSPPTPISL KLSSDLSISLISDDDDCESTGQHANGGVGTELAHPVVVAAAEAHAAAKLL KQQQPQLSVVQHLQYVGGGLASPVALALPVMATASSSASVVALPLQLPRR RKLG input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:438 S:97 BS:404 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 96.20 C1 C2 96.20 TOP 1 0 96.20 C2 C1 96.20 BOT 0 2 92.11 C1 C3 92.11 TOP 2 0 92.11 C3 C1 92.11 BOT 0 3 92.11 C1 C4 92.11 TOP 3 0 92.11 C4 C1 92.11 BOT 0 4 84.16 C1 C5 84.16 TOP 4 0 84.16 C5 C1 84.16 BOT 1 2 93.06 C2 C3 93.06 TOP 2 1 93.06 C3 C2 93.06 BOT 1 3 93.06 C2 C4 93.06 TOP 3 1 93.06 C4 C2 93.06 BOT 1 4 85.40 C2 C5 85.40 TOP 4 1 85.40 C5 C2 85.40 BOT 2 3 92.64 C3 C4 92.64 TOP 3 2 92.64 C4 C3 92.64 BOT 2 4 84.52 C3 C5 84.52 TOP 4 2 84.52 C5 C3 84.52 BOT 3 4 84.28 C4 C5 84.28 TOP 4 3 84.28 C5 C4 84.28 AVG 0 C1 * 91.14 AVG 1 C2 * 91.93 AVG 2 C3 * 90.58 AVG 3 C4 * 90.52 AVG 4 C5 * 84.59 TOT TOT * 89.75 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAACCAGAAACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA C2 ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA C3 ATGAACCAGAGACATTCCGAACCATTCTACATATCACCCCGGCTGTTCGA C4 ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA C5 ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCGCGGTTGTTCGA **********.************************.** *** ******* C1 CAACCGTCGTCTCAAGCGGCGCCGCTGTCGGTGGATGGAACGCCTGCTTG C2 CAACCGTCGTCTCAAGCGGCGCCGCTGTCGTTGGATGGAACGCCTGCTTG C3 CAACCGGCGTCTTAAGCGGCGTCGCGGTCGGTGGATGGAACGCCTGCTTG C4 CAACCGGCGTCTTAAGCGGCGTCGCGGTCGGTGGATGGAACGCCTGCTCG C5 CAACAGGCGGCTCAAGCGGCGCCGCTGCCGGTGGATGGAACGCCTGCGGG ****.* ** ** ******** *** * ** **************** * C1 AGCACCAGCGGATCTGCATGGCCCGGATGCGCGACCAAGTG---GCTCTC C2 AGCACCAGCGGATCTGCATGGCCCGGATGCGCGCCCAAGCG---GCCCTC C3 AGCACCAGCGTATCTGCATGGCACGGATGCGCGCCCAAGCG---GCTTTC C4 AGCACCAGCGGATCTGCATGGCACGGATGCGTGTCCAAGCG---ACTCTC C5 AGCGCCAGCGGATTTGCATGGCCCAGATGCGCGCACAGGCAACAGTGATC ***.****** ** ********.*.****** * .**.* . . ** C1 GCCTCCAAGACTGACCGGCAGCTGTCCCATCTGCAGCGGCGCCATGTCGC C2 GCCTCCAAGACTGACCGGCAGCTATCCCATCTGCAGCGGCGCCATGTGGC C3 GCCTCCAAGACTGACCGGCAGCTGTCCCAACTGCAGCGGCGCCATGTGGC C4 GCCTCCAAGACTGACCGGCAGCTGTCCCATCTGCAGCGACGCCATGCGGC C5 GCCTCCAAGACTGACCGG------------TTGCAGCGGCGCCATGTGGC ****************** *******.******* ** C1 CTCCACTTTGCAGCCGGACGTGACCATCGACCTGCTGTCGGATGACGATG C2 CGCCACTTTGCAGGCCGACGTGACTATCGACTTGCTGTCGGACGACGATG C3 TGCCACTTTGCAGGCGGACGTGACCATCGACCTGCTGTCGGACGACGATG C4 TGCCACTCTGCAGGCGGACGTGACCATCGACCTGCTGTCGGACGACGATG C5 GGCCACCCTGCCGGCGGACGTGACCATTGACCTGCTGTCGGACGACGATG **** ***.* * ******** ** *** ********** ******* C1 AG------------------ACCCCATCGGCCGGACAGCCCGCTGCAGCT C2 AG------------------ACCCCATCGGCCGGACAGTCCGCTGCAGCT C3 AC------------------ACTCCATCGGCTGGACAGTCCACGGCAGCT C4 AC------------------ACCCCATCGGCCGGACAGTCCACTGCAGCT C5 ACGACGAGCGGGAGGAGGCTGGACCTGGACCTGGACCATCCACTGCCGCT * . **: . * ****.. **.* **.*** C1 GGCCACAATCGCCTCCTGATTCCTGCCCCAGGG---------CACCGAGC C2 GGCCACAATCGCCTCCTGATACCTGCCCCAGGG---------CACCGAGC C3 GGCCACAATCGCCTCCTGATTCCTGTCCCTAGGCACAGCTTGCACCGAGC C4 GGCCACAATCGCCTCCTGATTCCTGCCCCTAGGCACAGCTTGCACCGAGC C5 AGCCACAATCGCCTTCTGATACCCGCCCCCTTCGCTGTCGGCCAGCGACG .************* *****:** * *** ** *** C1 ACATAGAACGGGCAGAAGGCAGGCGCCGCGCAGAGCTGCCACCCACTCAT C2 ACCTAGAGTGGGCAGAAGGCAGGCGCCGCGCAGAGTTGCCACCCACTCAT C3 ACCCAGAGTGGGCAGAAGACAGGCGCCGCGCAAAGCTGTCATCCACTCAT C4 ACCCAGAGTGGGCAGAAGGCAGGCGCCGCGCAGAACTGCCCCACACTCAC C5 TCCTAGAGTGGGCAGAAGGCAGGGTCGAGGCAGAGTCGGCACCCACTCGC :*. ***. *********.**** * . ***.*. * *. .*****. C1 ACCCAGTGACCGACAGCATCCTGATAACCAGCGATGACGAGCACAACGAG C2 ACCCCGTGACCGACAGCATCCTGATAACCAGCGACGACGAGCACAGCGAG C3 ACCCCGTGACCGAGAGCATCCTGATAACCAGCGACGACGAGCACAACGAG C4 TCGCCGTGACCGAGAGCATCCTGATAACCAGCGACGACGAGCACAACGAG C5 ATCTCTTAACCGAGAGCATCCTGATAACCAGCGACGACGAGTACAACGAC : . *.***** ******************** ****** ***.*** C1 CAGGAACCCAGCAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC C2 CAGGAACCCAGTAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC C3 CAGAAACCCAGCAGCACGCTAAGAGTGCGCTCCCAGCTCTCCATGCGTTC C4 CAGGAACCCTGCAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC C5 CAGGAAGGCAGCAGCGGGGCCATGGCGCGCCCTCAGCTTTCCATGCGCTC ***.** *:* ***. * .* .* **** * ***** ******** ** C1 ACCGCCACCGCTCGCACCGCTCACACAGTCGGAGACCATCGAAGAGGTAA C2 ACCGCCACCGCTCGCACCGCTCACACAGTCGGAGACCATCGAAGAGGTAA C3 GCCGCCACCACTTGCACCGCTCACACAATCGGAGACCATCGAAGAGGTAA C4 GCCGCCACCACTCGCACCGCTTACACCGTCGGAGACCGTCGAAGAGGTAA C5 GCCACCGCCCCTTGCACCGCTCACCCTGTCGGAGACCATCGAAGAGGTAA .**.**.** ** ******** **.* .*********.************ C1 CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAACTGCCTGACGCGG C2 CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAATTGCCTGACGCGA C3 CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAGCTGCCAGACGCGA C4 CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAACTGCCACAAGCTA C5 CCGTTTCGCTGGTGCCGCGCAACTCCACCACTGCCAACTGCCAGACGCGA * ****** ************.**************. ****: *.** . C1 GTGTCAGGTCACCCCAAGCCGTGTCGAGCGTCGACGGCGGCCAGCAATGG C2 GTGTCAGGCAACCCCAAGCCGTGTCGAGCGTCCACGGCGGCCACCAATGG C3 GTGTCAGGCCACGCCAAACCCTGTCGAGCATCCACGGTGGCCAGCAATGG C4 GTGTCAGGCCACGCCAAGCCCTGTCAAGCGTCCATAGCGGCCAGCAATGG C5 TTGTCCGGCCATCTCAAGCCCTGTCGAGCGTCCACGGCGGCCAGCAACGG ****.** .* ***.** ****.***.** * .* ***** *** ** C1 ATTCGCCACCGCCGAAGGCGGAGAGGGC------------GGCAATGAAA C2 ATTCGCCACCGCCGAAGGCGGAGAGGGC------------GGCAATGAAA C3 GTTCGTCATCGCCGAAGGCGGGGAGGGT------------GGCAATGAAA C4 GATCGTCACCGCCGATGGAGGAGAGGGC------------GGCAATGAAA C5 GATGGTCATGGCCGGCGGAGGAGGAGGAGACGGTGGCGGTGGCAACGATA .:* * ** ****. **.**.*..** ***** **:* C1 CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGAGGCATCACAGCCACGCTG C2 CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGAGGCATCACAGCCAGGCTG C3 CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGGGGCATCACAGCCACTTTG C4 CGGGCTGTTTTCTGGAGGTGGACGTTGGCGGCGGCATCACAGCCACGCTG C5 CGAGCTGCTTCCTGGAGGTGGACGTAGGCGGTGGCATCACAGCCACGCTG **.**** ** ************** ***** ************* ** C1 CCGGACGAGACGACCGTTCACACGGTCATCGCAAACCGTATTTACGAACT C2 CCGGACGAGACGACTGTTCACACGGTCATCGCCAACCGTATTTACGAACT C3 CCGGACGAGACGACCGTTCACACGGTCATCGCCAACCGTATTTATGAACT C4 CCGGACGAGACGACCGTACACACGGTCATAGCCAACCGTATTTACGAACT C5 CCGGACGAGACCACCGTGCACACGGTCATCGCCAATCGCATTTACGAGCT *********** ** ** ***********.**.** ** ***** **.** C1 CTCGCTGAGCAAACTACGCGAAGGCCTGGCTTTTAGTGGAGTGCCGGAAT C2 CTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCGGAAT C3 TTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCAGAAT C4 CTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCGGAAT C5 CTCGCTGAGCAAACTGCGCGAAGGACTGGCCTTCAGTGGAGCCCCGGAAT **************.********.***** ** ******* **.**** C1 ACACGAACGACCTGATGCCGGAGCAGCTGCAGAAACTGTCACCGGCATTG C2 ACACGCACGACCTGATGCCGGAGCAGCTGCAGAAACTGTCGCCGGCATTG C3 ACACGCACGAACTGATGCCGGAACAGCTGCAGAAACTGTCGCCGGCATTG C4 ACACGCACGACCTGATGCCGGAACAGCTGCAGAAGCTGTCGCCGGCATTG C5 ACACGACCGACCTGCTGCCGGAACAGCTGCAGAAACTGTCGCCGGCACTG *****..***.***.*******.***********.*****.****** ** C1 CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC C2 CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC C3 CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCTATCTC C4 CGAGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC C5 CGGGCCAAGGTGGCACCGCTGGTGGCCCCCTCGCCGCCCACGCCCATCTC ** *****.*****.** ******* ***************** ***** C1 CCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG C2 CCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG C3 CCTGAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG C4 GCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG C5 CTTGAAACTGTCTAGCGACCTCAGCATATCACTGATCTCAGACGACGACG *.******** ********************************.**** C1 ATTGCGAAAGCACCGGTCCACATGTCAACGGAGGA---------GTCGGC C2 AATGCGAAAGCACCGGTCCACATGCCAACGGAGGA---------GTCGGC C3 ACTGCGAAAGCACCGGTACACATGCCAACGGAGGA---------GACGGC C4 ACTGCGAAAGCACCGGTCCACATGCCAACGGAGGA---------GTCGGC C5 ACTGCGAGAGCACCGGCCAACATGCCAACGGAGGAGGAGGAGGAGTCGGT * *****.******** ..***** ********** *:*** C1 ACCGAACCGGTGCACCCCGTCGTGGTGGCTGCGGCGGAGGCACACGCTGC C2 ACCGAGCCAGTACACCCCGTCGTGGTGGCTGCGGCGGAGGCACACGCTGC C3 ACCGAACCAGTACACCCTGTCGTGGTCGCTGCAGCGGAGGCGCACGCTGC C4 ACCGAGCCAGTGCACCCTGTTGTGGTGGCTGCGGCGGAGGCGCACGCTGC C5 ACCGAGCTGGCGCATCCAGTCGTGGTGGCGGCGGCGGAGGCGCACGCTGC *****.* .* .** ** ** ***** ** **.********.******** C1 CGCCAAGCTGCTCAAGCAGCAGCAGCCACAGCTCTCGGTGGTGCAGCATC C2 CGCTAAGCTGCTCAAGCAGCAGCAGCCACAGCTCTCGGTGGTGCAGCATC C3 CGCCAAGCTGCTCAAGCAGCAGCAGCCACAACTCTCGGTGGTGCAACATC C4 CGCCAAGCTGCTTAAGCAACAGCAGCCACAGCTGTCGGTGGTGCAGCATC C5 CGCCAAGCTGCTAAAGCAACAGCAGCCGCAGCTCTCGGTGGTGCAGCACC *** ******** *****.********.**.** ***********.** * C1 TGCAGTACGTCGGCGGCGGACTCGCAGCTCCAGTGGCTCTTGCCCTTCCG C2 TGCAGTACGTGGGCGGCGGACTCGCAGCTCCAGTGGCTCTGGCCCTTCCG C3 TGCAGTATGTGGGCGGCGGACTCGCAACACCAGTGGCTCTGGCCCTTCCG C4 TGCAGTACGTGGGCGGCGGACTCGCAGCTCCAGTGGCTCTGGCCCTTCCG C5 TGCAGTACGTGGGCGGAGGACTAGCTTCACCCGTGGCCCTGGCCCTTCCG ******* ** *****.*****.**: *:**.***** ** ********* C1 GTGATGGCAGCAAATCCGACCTCGTCTGCTTCCGTTGTTGCCTTGCCGCT C2 GTGATGGCAGCGAATCCGACCTCGTCTGCTTCCGTCGTTGCCTTGCCGCT C3 GTGATGGCAGCGAATCCGACCTCGTCCGCTTCCGTCGTTGCCTTGCCGCT C4 GTGATGGCAGCGAATCCGACCTCGTCCGCTTCCGTCGTTGCCTTGCCGCT C5 GTGATGGCGACT---GCGTCCTCGTCCGCTTCCGTTGTGGCTCTGCCGCT ********..* **:******* ******** ** ** ******* C1 GCAGCTGCCGCGGCGCCGAAAACTGGGA---------------------- C2 GCAGCTGCCGCGACGCCGAAAGCTGGGA---------------------- C3 GCAGCTGCCGCGACGCCGGAAGCTGGGA---------------------- C4 GCAGCTGCCGCGACGCCGAAAGCTGGGA---------------------- C5 GCAGCTGCCGCGACGCCGGAAGTTGGGA---------------------- ************.*****.**. ***** C1 -------------- C2 -------------- C3 -------------- C4 -------------- C5 -------------- >C1 ATGAACCAGAAACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA CAACCGTCGTCTCAAGCGGCGCCGCTGTCGGTGGATGGAACGCCTGCTTG AGCACCAGCGGATCTGCATGGCCCGGATGCGCGACCAAGTG---GCTCTC GCCTCCAAGACTGACCGGCAGCTGTCCCATCTGCAGCGGCGCCATGTCGC CTCCACTTTGCAGCCGGACGTGACCATCGACCTGCTGTCGGATGACGATG AG------------------ACCCCATCGGCCGGACAGCCCGCTGCAGCT GGCCACAATCGCCTCCTGATTCCTGCCCCAGGG---------CACCGAGC ACATAGAACGGGCAGAAGGCAGGCGCCGCGCAGAGCTGCCACCCACTCAT ACCCAGTGACCGACAGCATCCTGATAACCAGCGATGACGAGCACAACGAG CAGGAACCCAGCAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC ACCGCCACCGCTCGCACCGCTCACACAGTCGGAGACCATCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAACTGCCTGACGCGG GTGTCAGGTCACCCCAAGCCGTGTCGAGCGTCGACGGCGGCCAGCAATGG ATTCGCCACCGCCGAAGGCGGAGAGGGC------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGAGGCATCACAGCCACGCTG CCGGACGAGACGACCGTTCACACGGTCATCGCAAACCGTATTTACGAACT CTCGCTGAGCAAACTACGCGAAGGCCTGGCTTTTAGTGGAGTGCCGGAAT ACACGAACGACCTGATGCCGGAGCAGCTGCAGAAACTGTCACCGGCATTG CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC CCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG ATTGCGAAAGCACCGGTCCACATGTCAACGGAGGA---------GTCGGC ACCGAACCGGTGCACCCCGTCGTGGTGGCTGCGGCGGAGGCACACGCTGC CGCCAAGCTGCTCAAGCAGCAGCAGCCACAGCTCTCGGTGGTGCAGCATC TGCAGTACGTCGGCGGCGGACTCGCAGCTCCAGTGGCTCTTGCCCTTCCG GTGATGGCAGCAAATCCGACCTCGTCTGCTTCCGTTGTTGCCTTGCCGCT GCAGCTGCCGCGGCGCCGAAAACTGGGA---------------------- -------------- >C2 ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA CAACCGTCGTCTCAAGCGGCGCCGCTGTCGTTGGATGGAACGCCTGCTTG AGCACCAGCGGATCTGCATGGCCCGGATGCGCGCCCAAGCG---GCCCTC GCCTCCAAGACTGACCGGCAGCTATCCCATCTGCAGCGGCGCCATGTGGC CGCCACTTTGCAGGCCGACGTGACTATCGACTTGCTGTCGGACGACGATG AG------------------ACCCCATCGGCCGGACAGTCCGCTGCAGCT GGCCACAATCGCCTCCTGATACCTGCCCCAGGG---------CACCGAGC ACCTAGAGTGGGCAGAAGGCAGGCGCCGCGCAGAGTTGCCACCCACTCAT ACCCCGTGACCGACAGCATCCTGATAACCAGCGACGACGAGCACAGCGAG CAGGAACCCAGTAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC ACCGCCACCGCTCGCACCGCTCACACAGTCGGAGACCATCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAATTGCCTGACGCGA GTGTCAGGCAACCCCAAGCCGTGTCGAGCGTCCACGGCGGCCACCAATGG ATTCGCCACCGCCGAAGGCGGAGAGGGC------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGAGGCATCACAGCCAGGCTG CCGGACGAGACGACTGTTCACACGGTCATCGCCAACCGTATTTACGAACT CTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCGGAAT ACACGCACGACCTGATGCCGGAGCAGCTGCAGAAACTGTCGCCGGCATTG CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC CCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG AATGCGAAAGCACCGGTCCACATGCCAACGGAGGA---------GTCGGC ACCGAGCCAGTACACCCCGTCGTGGTGGCTGCGGCGGAGGCACACGCTGC CGCTAAGCTGCTCAAGCAGCAGCAGCCACAGCTCTCGGTGGTGCAGCATC TGCAGTACGTGGGCGGCGGACTCGCAGCTCCAGTGGCTCTGGCCCTTCCG GTGATGGCAGCGAATCCGACCTCGTCTGCTTCCGTCGTTGCCTTGCCGCT GCAGCTGCCGCGACGCCGAAAGCTGGGA---------------------- -------------- >C3 ATGAACCAGAGACATTCCGAACCATTCTACATATCACCCCGGCTGTTCGA CAACCGGCGTCTTAAGCGGCGTCGCGGTCGGTGGATGGAACGCCTGCTTG AGCACCAGCGTATCTGCATGGCACGGATGCGCGCCCAAGCG---GCTTTC GCCTCCAAGACTGACCGGCAGCTGTCCCAACTGCAGCGGCGCCATGTGGC TGCCACTTTGCAGGCGGACGTGACCATCGACCTGCTGTCGGACGACGATG AC------------------ACTCCATCGGCTGGACAGTCCACGGCAGCT GGCCACAATCGCCTCCTGATTCCTGTCCCTAGGCACAGCTTGCACCGAGC ACCCAGAGTGGGCAGAAGACAGGCGCCGCGCAAAGCTGTCATCCACTCAT ACCCCGTGACCGAGAGCATCCTGATAACCAGCGACGACGAGCACAACGAG CAGAAACCCAGCAGCACGCTAAGAGTGCGCTCCCAGCTCTCCATGCGTTC GCCGCCACCACTTGCACCGCTCACACAATCGGAGACCATCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAGCTGCCAGACGCGA GTGTCAGGCCACGCCAAACCCTGTCGAGCATCCACGGTGGCCAGCAATGG GTTCGTCATCGCCGAAGGCGGGGAGGGT------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGGGGCATCACAGCCACTTTG CCGGACGAGACGACCGTTCACACGGTCATCGCCAACCGTATTTATGAACT TTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCAGAAT ACACGCACGAACTGATGCCGGAACAGCTGCAGAAACTGTCGCCGGCATTG CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCTATCTC CCTGAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG ACTGCGAAAGCACCGGTACACATGCCAACGGAGGA---------GACGGC ACCGAACCAGTACACCCTGTCGTGGTCGCTGCAGCGGAGGCGCACGCTGC CGCCAAGCTGCTCAAGCAGCAGCAGCCACAACTCTCGGTGGTGCAACATC TGCAGTATGTGGGCGGCGGACTCGCAACACCAGTGGCTCTGGCCCTTCCG GTGATGGCAGCGAATCCGACCTCGTCCGCTTCCGTCGTTGCCTTGCCGCT GCAGCTGCCGCGACGCCGGAAGCTGGGA---------------------- -------------- >C4 ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA CAACCGGCGTCTTAAGCGGCGTCGCGGTCGGTGGATGGAACGCCTGCTCG AGCACCAGCGGATCTGCATGGCACGGATGCGTGTCCAAGCG---ACTCTC GCCTCCAAGACTGACCGGCAGCTGTCCCATCTGCAGCGACGCCATGCGGC TGCCACTCTGCAGGCGGACGTGACCATCGACCTGCTGTCGGACGACGATG AC------------------ACCCCATCGGCCGGACAGTCCACTGCAGCT GGCCACAATCGCCTCCTGATTCCTGCCCCTAGGCACAGCTTGCACCGAGC ACCCAGAGTGGGCAGAAGGCAGGCGCCGCGCAGAACTGCCCCACACTCAC TCGCCGTGACCGAGAGCATCCTGATAACCAGCGACGACGAGCACAACGAG CAGGAACCCTGCAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC GCCGCCACCACTCGCACCGCTTACACCGTCGGAGACCGTCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAACTGCCACAAGCTA GTGTCAGGCCACGCCAAGCCCTGTCAAGCGTCCATAGCGGCCAGCAATGG GATCGTCACCGCCGATGGAGGAGAGGGC------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTTGGCGGCGGCATCACAGCCACGCTG CCGGACGAGACGACCGTACACACGGTCATAGCCAACCGTATTTACGAACT CTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCGGAAT ACACGCACGACCTGATGCCGGAACAGCTGCAGAAGCTGTCGCCGGCATTG CGAGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC GCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG ACTGCGAAAGCACCGGTCCACATGCCAACGGAGGA---------GTCGGC ACCGAGCCAGTGCACCCTGTTGTGGTGGCTGCGGCGGAGGCGCACGCTGC CGCCAAGCTGCTTAAGCAACAGCAGCCACAGCTGTCGGTGGTGCAGCATC TGCAGTACGTGGGCGGCGGACTCGCAGCTCCAGTGGCTCTGGCCCTTCCG GTGATGGCAGCGAATCCGACCTCGTCCGCTTCCGTCGTTGCCTTGCCGCT GCAGCTGCCGCGACGCCGAAAGCTGGGA---------------------- -------------- >C5 ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCGCGGTTGTTCGA CAACAGGCGGCTCAAGCGGCGCCGCTGCCGGTGGATGGAACGCCTGCGGG AGCGCCAGCGGATTTGCATGGCCCAGATGCGCGCACAGGCAACAGTGATC GCCTCCAAGACTGACCGG------------TTGCAGCGGCGCCATGTGGC GGCCACCCTGCCGGCGGACGTGACCATTGACCTGCTGTCGGACGACGATG ACGACGAGCGGGAGGAGGCTGGACCTGGACCTGGACCATCCACTGCCGCT AGCCACAATCGCCTTCTGATACCCGCCCCCTTCGCTGTCGGCCAGCGACG TCCTAGAGTGGGCAGAAGGCAGGGTCGAGGCAGAGTCGGCACCCACTCGC ATCTCTTAACCGAGAGCATCCTGATAACCAGCGACGACGAGTACAACGAC CAGGAAGGCAGCAGCGGGGCCATGGCGCGCCCTCAGCTTTCCATGCGCTC GCCACCGCCCCTTGCACCGCTCACCCTGTCGGAGACCATCGAAGAGGTAA CCGTTTCGCTGGTGCCGCGCAACTCCACCACTGCCAACTGCCAGACGCGA TTGTCCGGCCATCTCAAGCCCTGTCGAGCGTCCACGGCGGCCAGCAACGG GATGGTCATGGCCGGCGGAGGAGGAGGAGACGGTGGCGGTGGCAACGATA CGAGCTGCTTCCTGGAGGTGGACGTAGGCGGTGGCATCACAGCCACGCTG CCGGACGAGACCACCGTGCACACGGTCATCGCCAATCGCATTTACGAGCT CTCGCTGAGCAAACTGCGCGAAGGACTGGCCTTCAGTGGAGCCCCGGAAT ACACGACCGACCTGCTGCCGGAACAGCTGCAGAAACTGTCGCCGGCACTG CGGGCCAAGGTGGCACCGCTGGTGGCCCCCTCGCCGCCCACGCCCATCTC CTTGAAACTGTCTAGCGACCTCAGCATATCACTGATCTCAGACGACGACG ACTGCGAGAGCACCGGCCAACATGCCAACGGAGGAGGAGGAGGAGTCGGT ACCGAGCTGGCGCATCCAGTCGTGGTGGCGGCGGCGGAGGCGCACGCTGC CGCCAAGCTGCTAAAGCAACAGCAGCCGCAGCTCTCGGTGGTGCAGCACC TGCAGTACGTGGGCGGAGGACTAGCTTCACCCGTGGCCCTGGCCCTTCCG GTGATGGCGACT---GCGTCCTCGTCCGCTTCCGTTGTGGCTCTGCCGCT GCAGCTGCCGCGACGCCGGAAGTTGGGA---------------------- -------------- >C1 MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVoAL ASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDEooooooTPSAGQPAAA GHNRLLIPAPGoooHRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNE QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR VSGHPKPCRASTAASNGFATAEGGEGooooGNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGGoooVG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLG >C2 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQAoAL ASKTDRQLSHLQRRHVAATLQADVTIDLLSDDDEooooooTPSAGQSAAA GHNRLLIPAPGoooHRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSE QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR VSGNPKPCRASTAATNGFATAEGGEGooooGNETGCFLEVDVGGGITARL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDECESTGPHANGGoooVG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLG >C3 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQAoAF ASKTDRQLSQLQRRHVAATLQADVTIDLLSDDDDooooooTPSAGQSTAA GHNRLLIPVPRHSLHRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNE QKPSSTLRVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTR VSGHAKPCRASTVASNGFVIAEGGEGooooGNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHELMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGTHANGGoooDG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLATPVALALP VMAANPTSSASVVALPLQLPRRRKLG >C4 MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQAoTL ASKTDRQLSHLQRRHAAATLQADVTIDLLSDDDDooooooTPSAGQSTAA GHNRLLIPAPRHSLHRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNE QEPCSTARVRSQLSMRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKL VSGHAKPCQASIAASNGIVTADGGEGooooGNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHANGGoooVG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLG >C5 MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQATVI ASKTDRooooLQRRHVAATLPADVTIDLLSDDDDDEREEAGPGPGPSTAA SHNRLLIPAPFAVGQRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYND QEGSSGAMARPQLSMRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTR LSGHLKPCRASTAASNGMVMAGGGGGDGGGGNDTSCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGAPEYTTDLLPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDDDDCESTGQHANGGGGGVG TELAHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLASPVALALP VMAToASSSASVVALPLQLPRRRKLG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1314 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480113651 Setting output file names to "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 199100364 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9812866637 Seed = 714590507 Swapseed = 1480113651 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 49 unique site patterns Division 2 has 47 unique site patterns Division 3 has 85 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3651.520029 -- -25.624409 Chain 2 -- -3733.042153 -- -25.624409 Chain 3 -- -3721.160477 -- -25.624409 Chain 4 -- -3708.828075 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3720.198520 -- -25.624409 Chain 2 -- -3718.574412 -- -25.624409 Chain 3 -- -3686.172966 -- -25.624409 Chain 4 -- -3708.828075 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3651.520] (-3733.042) (-3721.160) (-3708.828) * [-3720.199] (-3718.574) (-3686.173) (-3708.828) 500 -- (-3281.412) (-3274.404) [-3277.810] (-3297.731) * (-3293.175) (-3297.351) (-3271.374) [-3271.925] -- 0:00:00 1000 -- (-3247.437) (-3262.901) [-3243.638] (-3258.018) * (-3265.924) (-3263.227) [-3252.635] (-3257.524) -- 0:00:00 1500 -- (-3239.309) (-3247.314) [-3226.761] (-3247.168) * (-3247.026) [-3240.808] (-3243.338) (-3229.547) -- 0:00:00 2000 -- (-3213.208) (-3225.002) [-3214.302] (-3212.363) * (-3223.903) (-3226.003) (-3229.491) [-3217.336] -- 0:08:19 2500 -- (-3218.736) (-3212.240) [-3218.735] (-3213.610) * (-3228.126) (-3208.772) [-3214.723] (-3213.822) -- 0:06:39 3000 -- (-3224.994) (-3203.318) [-3205.664] (-3209.624) * (-3207.720) [-3207.980] (-3216.961) (-3209.646) -- 0:05:32 3500 -- (-3217.336) (-3206.257) (-3205.457) [-3212.309] * (-3204.395) (-3205.689) (-3207.742) [-3219.147] -- 0:04:44 4000 -- (-3209.951) [-3202.868] (-3211.696) (-3210.833) * [-3204.552] (-3206.452) (-3212.034) (-3211.863) -- 0:04:09 4500 -- (-3210.569) (-3204.679) (-3209.376) [-3209.942] * [-3205.821] (-3216.751) (-3217.081) (-3207.918) -- 0:03:41 5000 -- (-3214.394) (-3207.369) (-3209.394) [-3205.660] * [-3202.676] (-3213.843) (-3208.802) (-3211.419) -- 0:03:19 Average standard deviation of split frequencies: 0.078567 5500 -- (-3206.812) (-3206.436) (-3208.551) [-3207.251] * (-3202.591) [-3205.077] (-3215.778) (-3211.752) -- 0:06:01 6000 -- (-3211.855) (-3208.538) [-3211.422] (-3208.007) * (-3207.906) [-3206.618] (-3208.862) (-3207.233) -- 0:05:31 6500 -- (-3202.740) (-3208.154) (-3208.563) [-3206.130] * (-3206.834) (-3206.283) [-3209.275] (-3209.521) -- 0:05:05 7000 -- [-3205.304] (-3206.673) (-3206.248) (-3205.193) * (-3210.863) (-3207.666) (-3207.899) [-3205.791] -- 0:04:43 7500 -- (-3204.855) (-3206.984) (-3209.079) [-3209.376] * (-3214.053) (-3208.164) [-3201.964] (-3211.396) -- 0:04:24 8000 -- (-3208.893) (-3205.390) [-3205.729] (-3215.167) * (-3214.291) (-3210.600) [-3213.178] (-3211.026) -- 0:04:08 8500 -- [-3205.517] (-3209.239) (-3207.655) (-3205.830) * (-3210.467) [-3210.677] (-3205.143) (-3209.519) -- 0:05:49 9000 -- (-3208.881) (-3204.468) [-3210.963] (-3205.753) * (-3207.868) (-3205.697) (-3203.296) [-3211.807] -- 0:05:30 9500 -- (-3205.359) [-3205.166] (-3210.598) (-3204.279) * (-3208.737) (-3206.775) (-3207.356) [-3215.647] -- 0:05:12 10000 -- (-3211.021) (-3211.666) (-3205.413) [-3202.150] * (-3204.009) (-3210.562) [-3209.393] (-3205.850) -- 0:04:57 Average standard deviation of split frequencies: 0.088388 10500 -- (-3208.007) [-3206.015] (-3201.607) (-3208.029) * (-3206.597) [-3204.458] (-3207.641) (-3214.463) -- 0:04:42 11000 -- (-3206.649) (-3211.809) [-3207.371] (-3215.332) * (-3213.322) [-3203.298] (-3219.145) (-3205.991) -- 0:04:29 11500 -- (-3210.130) (-3206.897) [-3208.042] (-3216.839) * (-3214.898) [-3205.146] (-3207.976) (-3206.783) -- 0:04:17 12000 -- (-3205.723) [-3201.201] (-3214.833) (-3220.116) * (-3206.739) (-3205.831) [-3202.236] (-3205.449) -- 0:05:29 12500 -- (-3211.040) [-3204.459] (-3214.376) (-3217.891) * (-3206.500) [-3205.539] (-3203.744) (-3213.207) -- 0:05:16 13000 -- (-3215.533) [-3208.283] (-3217.993) (-3214.504) * (-3207.131) (-3205.030) (-3209.543) [-3202.655] -- 0:05:03 13500 -- (-3219.719) [-3207.552] (-3218.182) (-3213.618) * (-3204.545) [-3209.179] (-3203.110) (-3207.421) -- 0:04:52 14000 -- (-3216.424) [-3211.692] (-3210.859) (-3213.924) * (-3207.709) [-3205.221] (-3205.953) (-3203.621) -- 0:04:41 14500 -- [-3209.448] (-3211.443) (-3211.303) (-3207.445) * (-3206.817) (-3218.806) [-3208.169] (-3204.398) -- 0:04:31 15000 -- (-3212.638) [-3205.012] (-3213.178) (-3208.854) * (-3208.452) (-3214.232) [-3202.514] (-3212.375) -- 0:05:28 Average standard deviation of split frequencies: 0.058926 15500 -- [-3212.343] (-3207.156) (-3212.776) (-3207.420) * (-3204.507) (-3212.363) (-3208.962) [-3210.444] -- 0:05:17 16000 -- (-3214.984) (-3205.206) (-3206.577) [-3204.653] * (-3206.588) (-3209.608) (-3204.157) [-3210.583] -- 0:05:07 16500 -- (-3213.565) [-3204.848] (-3205.673) (-3205.073) * (-3205.365) (-3208.192) (-3207.228) [-3206.502] -- 0:04:58 17000 -- (-3205.427) (-3207.406) [-3208.259] (-3205.309) * (-3205.104) (-3205.137) [-3209.626] (-3213.295) -- 0:04:49 17500 -- (-3207.827) [-3209.558] (-3204.774) (-3205.643) * (-3206.663) [-3205.390] (-3206.366) (-3211.817) -- 0:04:40 18000 -- (-3209.378) (-3215.518) (-3209.248) [-3213.261] * (-3207.380) (-3207.840) (-3206.829) [-3207.531] -- 0:05:27 18500 -- [-3207.699] (-3204.216) (-3208.415) (-3213.836) * (-3205.439) (-3204.175) (-3205.716) [-3202.293] -- 0:05:18 19000 -- (-3203.515) (-3203.633) [-3205.521] (-3215.644) * (-3208.253) (-3215.484) [-3204.722] (-3205.675) -- 0:05:09 19500 -- (-3208.502) [-3204.690] (-3207.805) (-3217.169) * (-3207.684) [-3210.172] (-3208.463) (-3211.032) -- 0:05:01 20000 -- (-3210.418) (-3203.919) (-3206.594) [-3212.375] * [-3208.507] (-3209.788) (-3206.731) (-3208.437) -- 0:04:54 Average standard deviation of split frequencies: 0.045620 20500 -- [-3202.941] (-3210.224) (-3206.831) (-3207.060) * (-3210.944) (-3209.104) [-3203.358] (-3213.302) -- 0:04:46 21000 -- (-3204.604) (-3214.575) [-3211.083] (-3208.444) * (-3206.258) (-3206.864) (-3206.405) [-3211.342] -- 0:05:26 21500 -- (-3205.707) (-3207.497) [-3205.780] (-3218.174) * (-3208.731) (-3210.009) [-3201.631] (-3210.252) -- 0:05:18 22000 -- [-3201.813] (-3203.427) (-3209.524) (-3209.553) * [-3217.001] (-3207.314) (-3210.027) (-3210.715) -- 0:05:11 22500 -- (-3210.185) [-3206.981] (-3207.188) (-3207.338) * [-3208.700] (-3215.651) (-3204.594) (-3208.472) -- 0:05:04 23000 -- (-3205.648) [-3207.085] (-3206.514) (-3209.015) * [-3203.802] (-3214.323) (-3209.276) (-3211.859) -- 0:04:57 23500 -- [-3209.419] (-3210.869) (-3206.396) (-3207.923) * (-3204.797) (-3205.584) [-3206.265] (-3209.699) -- 0:04:50 24000 -- (-3211.332) (-3213.418) (-3208.630) [-3205.429] * (-3209.941) (-3204.781) [-3203.689] (-3209.529) -- 0:05:25 24500 -- (-3210.515) [-3212.941] (-3207.611) (-3208.348) * (-3203.962) (-3209.078) [-3204.104] (-3208.463) -- 0:05:18 25000 -- (-3207.323) (-3207.491) (-3212.671) [-3203.569] * (-3206.284) (-3213.745) (-3204.804) [-3212.865] -- 0:05:12 Average standard deviation of split frequencies: 0.027196 25500 -- [-3210.889] (-3205.557) (-3207.776) (-3211.681) * (-3208.285) (-3211.391) (-3204.427) [-3213.652] -- 0:05:05 26000 -- [-3207.105] (-3207.107) (-3213.915) (-3206.595) * [-3202.633] (-3211.745) (-3205.954) (-3206.887) -- 0:04:59 26500 -- (-3205.590) (-3214.285) [-3210.112] (-3209.867) * (-3210.608) [-3208.900] (-3208.716) (-3211.840) -- 0:04:53 27000 -- (-3209.592) (-3214.115) [-3207.166] (-3208.150) * (-3209.904) (-3204.640) [-3208.782] (-3209.387) -- 0:04:48 27500 -- (-3212.204) (-3209.331) (-3207.043) [-3202.912] * [-3205.201] (-3208.978) (-3212.933) (-3209.150) -- 0:05:18 28000 -- (-3210.766) (-3209.096) [-3202.546] (-3203.875) * (-3208.644) (-3209.537) (-3210.029) [-3212.150] -- 0:05:12 28500 -- [-3202.715] (-3213.383) (-3205.710) (-3212.191) * (-3208.611) (-3211.865) (-3209.126) [-3208.884] -- 0:05:06 29000 -- (-3205.307) (-3202.277) (-3203.773) [-3210.206] * (-3219.008) (-3211.829) [-3207.395] (-3214.183) -- 0:05:01 29500 -- [-3207.811] (-3207.458) (-3204.055) (-3202.779) * (-3215.318) [-3219.167] (-3214.001) (-3213.869) -- 0:04:56 30000 -- (-3209.242) (-3208.324) (-3205.492) [-3204.937] * [-3212.576] (-3213.382) (-3210.096) (-3211.961) -- 0:04:51 Average standard deviation of split frequencies: 0.023058 30500 -- (-3209.715) (-3208.036) [-3207.623] (-3204.980) * (-3204.067) [-3205.704] (-3208.947) (-3206.216) -- 0:05:17 31000 -- (-3206.826) (-3207.712) (-3205.983) [-3202.322] * (-3210.514) (-3214.624) [-3207.408] (-3202.764) -- 0:05:12 31500 -- (-3222.734) (-3216.963) (-3205.795) [-3203.480] * (-3209.475) [-3211.642] (-3208.460) (-3208.548) -- 0:05:07 32000 -- (-3211.477) [-3210.791] (-3204.405) (-3202.066) * (-3204.962) [-3214.454] (-3208.813) (-3203.917) -- 0:05:02 32500 -- (-3209.734) (-3200.638) (-3204.392) [-3206.187] * (-3210.481) (-3212.525) [-3205.189] (-3203.914) -- 0:04:57 33000 -- (-3205.841) (-3203.967) (-3201.993) [-3209.108] * (-3209.998) [-3209.381] (-3204.974) (-3214.358) -- 0:04:53 33500 -- (-3211.581) [-3206.264] (-3210.042) (-3211.642) * (-3216.838) (-3212.500) [-3206.477] (-3206.883) -- 0:04:48 34000 -- [-3204.286] (-3204.837) (-3209.213) (-3209.783) * (-3210.951) (-3210.265) [-3204.882] (-3207.580) -- 0:05:12 34500 -- (-3208.234) (-3210.763) [-3203.486] (-3212.983) * (-3216.886) [-3211.611] (-3209.905) (-3211.625) -- 0:05:07 35000 -- (-3209.834) (-3210.002) (-3205.769) [-3206.221] * (-3210.956) (-3212.457) (-3205.936) [-3209.041] -- 0:05:03 Average standard deviation of split frequencies: 0.039284 35500 -- (-3207.931) (-3216.806) [-3211.143] (-3205.446) * (-3211.651) (-3207.644) [-3207.243] (-3208.125) -- 0:04:58 36000 -- [-3204.033] (-3204.842) (-3203.561) (-3210.822) * (-3217.568) [-3205.783] (-3205.429) (-3210.766) -- 0:04:54 36500 -- [-3208.830] (-3209.340) (-3208.154) (-3210.466) * (-3208.921) [-3210.716] (-3204.346) (-3216.961) -- 0:04:50 37000 -- (-3210.219) [-3207.015] (-3206.935) (-3206.959) * [-3205.676] (-3207.854) (-3209.934) (-3220.311) -- 0:05:12 37500 -- (-3204.603) [-3205.384] (-3207.639) (-3205.758) * (-3202.984) [-3210.718] (-3207.031) (-3210.647) -- 0:05:08 38000 -- (-3205.764) (-3208.100) (-3217.110) [-3207.538] * (-3216.249) (-3208.299) (-3204.296) [-3216.007] -- 0:05:03 38500 -- (-3204.266) [-3207.573] (-3208.527) (-3210.281) * (-3212.101) [-3205.562] (-3208.409) (-3210.558) -- 0:04:59 39000 -- [-3207.731] (-3205.239) (-3218.109) (-3210.402) * [-3202.957] (-3207.012) (-3206.619) (-3210.100) -- 0:04:55 39500 -- (-3213.182) (-3211.160) [-3210.022] (-3211.044) * (-3205.282) (-3205.602) (-3206.193) [-3209.123] -- 0:04:51 40000 -- (-3207.134) (-3208.086) (-3208.572) [-3210.237] * [-3207.639] (-3208.142) (-3204.986) (-3210.259) -- 0:04:48 Average standard deviation of split frequencies: 0.040572 40500 -- (-3207.558) [-3206.419] (-3207.802) (-3212.209) * (-3220.008) [-3206.935] (-3207.328) (-3211.117) -- 0:05:07 41000 -- [-3203.714] (-3218.780) (-3204.591) (-3213.026) * [-3208.256] (-3205.731) (-3204.883) (-3207.273) -- 0:05:04 41500 -- (-3206.311) (-3210.193) (-3208.123) [-3208.567] * [-3207.147] (-3211.222) (-3202.803) (-3205.360) -- 0:05:00 42000 -- [-3204.839] (-3212.048) (-3205.033) (-3210.777) * (-3215.672) [-3204.997] (-3205.211) (-3209.667) -- 0:04:56 42500 -- [-3207.408] (-3210.001) (-3208.042) (-3209.849) * (-3209.831) [-3205.711] (-3208.108) (-3211.650) -- 0:04:52 43000 -- (-3208.514) (-3212.526) (-3205.953) [-3208.539] * (-3213.369) (-3208.586) (-3204.533) [-3205.500] -- 0:04:49 43500 -- [-3205.648] (-3211.924) (-3210.644) (-3209.302) * [-3209.131] (-3208.561) (-3208.887) (-3210.075) -- 0:05:07 44000 -- [-3203.815] (-3209.018) (-3214.456) (-3207.049) * [-3208.981] (-3207.313) (-3211.069) (-3215.008) -- 0:05:04 44500 -- (-3210.433) (-3211.830) [-3211.479] (-3213.610) * (-3207.030) [-3209.575] (-3205.942) (-3215.518) -- 0:05:00 45000 -- (-3210.912) [-3215.477] (-3212.420) (-3209.480) * [-3213.551] (-3211.751) (-3210.152) (-3206.910) -- 0:04:57 Average standard deviation of split frequencies: 0.035868 45500 -- (-3207.381) (-3210.306) (-3216.645) [-3214.408] * (-3208.583) (-3212.174) [-3209.746] (-3203.195) -- 0:04:53 46000 -- (-3207.929) [-3209.046] (-3219.494) (-3210.248) * [-3210.686] (-3206.934) (-3204.922) (-3216.466) -- 0:04:50 46500 -- [-3206.783] (-3206.151) (-3214.379) (-3213.028) * (-3203.552) [-3207.717] (-3208.028) (-3212.672) -- 0:05:07 47000 -- [-3211.927] (-3208.803) (-3212.999) (-3205.359) * (-3206.235) (-3215.386) [-3206.173] (-3210.357) -- 0:05:04 47500 -- (-3206.994) (-3207.090) (-3209.166) [-3207.268] * (-3210.605) (-3210.371) (-3208.334) [-3205.114] -- 0:05:00 48000 -- (-3204.637) (-3210.558) (-3208.957) [-3208.053] * [-3204.270] (-3207.693) (-3215.041) (-3202.342) -- 0:04:57 48500 -- (-3208.362) (-3209.034) [-3212.289] (-3205.473) * [-3206.510] (-3210.314) (-3215.959) (-3205.046) -- 0:04:54 49000 -- (-3210.044) (-3206.650) (-3211.015) [-3204.025] * (-3204.828) (-3207.528) (-3211.744) [-3210.653] -- 0:04:51 49500 -- (-3211.252) [-3205.945] (-3207.877) (-3211.451) * (-3210.166) [-3209.924] (-3214.940) (-3213.711) -- 0:05:07 50000 -- (-3210.481) (-3210.254) [-3206.378] (-3206.169) * (-3210.432) [-3215.418] (-3214.306) (-3208.738) -- 0:05:04 Average standard deviation of split frequencies: 0.037216 50500 -- (-3205.567) (-3207.355) (-3209.154) [-3204.245] * [-3203.933] (-3206.898) (-3212.923) (-3210.410) -- 0:05:00 51000 -- [-3207.892] (-3206.351) (-3208.214) (-3209.261) * [-3203.732] (-3210.909) (-3205.860) (-3216.503) -- 0:04:57 51500 -- (-3208.233) [-3201.092] (-3210.338) (-3207.360) * (-3205.635) (-3203.096) [-3202.778] (-3214.182) -- 0:04:54 52000 -- (-3209.826) [-3203.467] (-3214.109) (-3213.554) * (-3211.911) (-3213.479) [-3209.973] (-3211.837) -- 0:04:51 52500 -- [-3204.324] (-3202.213) (-3211.086) (-3205.887) * [-3206.916] (-3213.084) (-3208.781) (-3216.106) -- 0:04:48 53000 -- (-3210.123) (-3207.676) [-3204.250] (-3208.205) * (-3205.137) (-3210.809) (-3208.680) [-3207.848] -- 0:05:03 53500 -- (-3212.282) (-3211.180) (-3203.994) [-3207.381] * [-3207.344] (-3209.700) (-3206.629) (-3206.854) -- 0:05:00 54000 -- [-3206.226] (-3209.184) (-3217.759) (-3206.842) * (-3207.314) (-3210.324) (-3212.299) [-3211.071] -- 0:04:57 54500 -- (-3204.540) (-3211.382) (-3210.100) [-3207.864] * (-3210.723) (-3214.795) (-3204.983) [-3209.532] -- 0:04:54 55000 -- (-3200.278) (-3212.045) (-3210.059) [-3209.224] * (-3208.776) [-3208.693] (-3215.704) (-3207.030) -- 0:04:52 Average standard deviation of split frequencies: 0.037881 55500 -- (-3211.516) (-3212.607) [-3204.955] (-3202.983) * [-3205.189] (-3201.797) (-3214.331) (-3211.362) -- 0:04:49 56000 -- [-3208.808] (-3209.911) (-3211.629) (-3207.706) * [-3210.428] (-3211.240) (-3209.108) (-3211.540) -- 0:05:03 56500 -- (-3209.064) [-3206.739] (-3204.077) (-3216.469) * (-3210.182) [-3204.330] (-3209.197) (-3209.619) -- 0:05:00 57000 -- (-3213.320) (-3207.545) (-3205.730) [-3208.293] * (-3206.016) [-3205.503] (-3208.360) (-3210.495) -- 0:04:57 57500 -- (-3213.772) (-3218.910) [-3205.478] (-3208.137) * (-3210.556) [-3206.295] (-3210.711) (-3207.845) -- 0:04:55 58000 -- (-3211.195) (-3212.816) [-3205.682] (-3208.697) * [-3205.994] (-3204.192) (-3209.899) (-3208.694) -- 0:04:52 58500 -- (-3212.534) (-3224.407) [-3205.231] (-3207.509) * (-3203.749) [-3206.854] (-3204.219) (-3210.055) -- 0:04:49 59000 -- (-3208.595) (-3208.946) (-3208.620) [-3213.850] * (-3211.935) (-3210.539) (-3210.080) [-3213.521] -- 0:05:03 59500 -- (-3204.615) [-3211.391] (-3208.263) (-3206.514) * (-3213.992) (-3209.400) (-3213.072) [-3210.588] -- 0:05:00 60000 -- (-3206.980) [-3218.866] (-3210.774) (-3207.064) * [-3209.542] (-3209.060) (-3213.265) (-3219.239) -- 0:04:57 Average standard deviation of split frequencies: 0.042737 60500 -- (-3209.732) (-3212.977) (-3206.692) [-3205.374] * (-3209.289) [-3205.946] (-3209.157) (-3208.482) -- 0:04:55 61000 -- [-3209.011] (-3210.315) (-3204.291) (-3205.711) * (-3207.600) (-3211.230) [-3210.097] (-3211.766) -- 0:04:52 61500 -- (-3205.919) (-3206.829) [-3207.065] (-3209.482) * [-3204.713] (-3207.869) (-3215.040) (-3206.032) -- 0:04:49 62000 -- [-3205.791] (-3215.335) (-3213.545) (-3211.479) * (-3203.661) (-3212.831) (-3213.693) [-3206.102] -- 0:04:47 62500 -- (-3209.646) (-3208.575) (-3210.554) [-3204.837] * (-3207.242) (-3211.393) (-3207.861) [-3207.585] -- 0:05:00 63000 -- (-3208.070) (-3208.332) (-3208.041) [-3210.219] * (-3210.019) (-3209.598) [-3204.552] (-3211.976) -- 0:04:57 63500 -- (-3206.705) (-3202.326) [-3205.681] (-3211.609) * (-3210.425) (-3207.011) (-3204.316) [-3205.299] -- 0:04:54 64000 -- [-3200.267] (-3206.330) (-3209.246) (-3207.025) * [-3207.376] (-3208.072) (-3209.905) (-3206.271) -- 0:04:52 64500 -- (-3202.295) (-3208.163) [-3204.856] (-3206.940) * (-3209.586) (-3205.533) (-3223.843) [-3209.559] -- 0:04:50 65000 -- (-3209.006) [-3205.660] (-3208.889) (-3209.869) * (-3203.616) [-3203.170] (-3207.714) (-3211.796) -- 0:04:47 Average standard deviation of split frequencies: 0.028570 65500 -- (-3205.605) [-3212.203] (-3220.839) (-3208.261) * [-3207.944] (-3205.057) (-3203.269) (-3209.421) -- 0:04:59 66000 -- (-3208.031) (-3214.053) (-3212.195) [-3205.437] * (-3205.881) [-3206.739] (-3208.695) (-3209.527) -- 0:04:57 66500 -- (-3203.510) [-3208.359] (-3213.251) (-3206.764) * (-3208.154) (-3210.447) (-3211.295) [-3206.856] -- 0:04:54 67000 -- (-3208.323) [-3206.007] (-3213.386) (-3209.203) * (-3215.900) [-3210.234] (-3208.892) (-3203.142) -- 0:04:52 67500 -- (-3208.300) [-3209.618] (-3209.968) (-3218.135) * (-3208.885) (-3205.063) [-3209.736] (-3208.627) -- 0:04:50 68000 -- [-3206.628] (-3211.844) (-3209.079) (-3211.744) * (-3209.604) (-3206.415) [-3207.426] (-3206.742) -- 0:04:47 68500 -- [-3205.019] (-3207.312) (-3208.384) (-3216.873) * (-3211.127) (-3210.772) [-3206.441] (-3204.580) -- 0:04:59 69000 -- (-3211.492) (-3208.262) [-3205.005] (-3213.127) * (-3215.685) (-3204.939) [-3208.912] (-3206.189) -- 0:04:56 69500 -- [-3207.107] (-3206.105) (-3217.269) (-3207.026) * (-3213.255) [-3202.764] (-3207.991) (-3206.472) -- 0:04:54 70000 -- (-3210.040) [-3207.676] (-3206.161) (-3213.912) * (-3204.038) [-3210.137] (-3206.257) (-3204.194) -- 0:04:52 Average standard deviation of split frequencies: 0.023348 70500 -- [-3207.028] (-3208.809) (-3208.771) (-3208.850) * (-3205.913) [-3207.123] (-3212.675) (-3207.210) -- 0:04:50 71000 -- [-3210.599] (-3215.934) (-3208.891) (-3209.747) * (-3205.957) (-3214.391) [-3214.103] (-3207.649) -- 0:04:47 71500 -- [-3208.779] (-3201.873) (-3205.671) (-3211.095) * (-3208.923) (-3208.591) [-3214.180] (-3206.760) -- 0:04:45 72000 -- [-3206.003] (-3211.923) (-3212.723) (-3206.908) * (-3213.369) [-3207.603] (-3209.124) (-3207.988) -- 0:04:56 72500 -- [-3206.901] (-3209.264) (-3209.114) (-3206.719) * (-3210.626) (-3204.924) [-3204.447] (-3207.529) -- 0:04:54 73000 -- (-3202.552) (-3209.078) (-3205.421) [-3208.826] * [-3206.817] (-3209.218) (-3207.783) (-3205.330) -- 0:04:52 73500 -- (-3210.771) (-3209.596) [-3206.756] (-3208.971) * (-3210.933) [-3208.204] (-3204.890) (-3209.262) -- 0:04:49 74000 -- (-3210.535) (-3206.408) (-3207.392) [-3211.360] * (-3211.340) (-3208.970) (-3207.576) [-3205.011] -- 0:04:47 74500 -- (-3212.712) [-3211.059] (-3209.730) (-3220.918) * (-3205.179) (-3209.714) (-3207.269) [-3207.899] -- 0:04:45 75000 -- (-3206.172) (-3209.229) (-3206.031) [-3205.739] * (-3209.582) (-3210.951) [-3202.055] (-3207.980) -- 0:04:56 Average standard deviation of split frequencies: 0.027912 75500 -- (-3212.553) (-3211.567) (-3204.530) [-3208.228] * (-3213.139) [-3206.962] (-3216.115) (-3210.801) -- 0:04:53 76000 -- (-3206.300) (-3210.691) [-3204.166] (-3211.736) * [-3211.375] (-3209.265) (-3215.024) (-3216.747) -- 0:04:51 76500 -- (-3210.352) (-3208.355) [-3210.473] (-3216.570) * (-3213.750) [-3207.953] (-3210.989) (-3210.881) -- 0:04:49 77000 -- [-3207.151] (-3208.407) (-3211.849) (-3209.716) * (-3213.145) [-3206.576] (-3206.393) (-3207.476) -- 0:04:47 77500 -- (-3209.830) (-3216.192) [-3211.911] (-3212.608) * (-3206.679) (-3209.705) [-3206.168] (-3204.789) -- 0:04:45 78000 -- (-3207.930) [-3205.826] (-3210.007) (-3206.157) * [-3206.103] (-3212.782) (-3209.986) (-3216.448) -- 0:04:43 78500 -- (-3207.225) (-3213.733) [-3206.663] (-3206.702) * (-3211.833) (-3208.753) [-3212.189] (-3210.273) -- 0:04:53 79000 -- (-3208.081) (-3209.442) (-3207.101) [-3208.911] * (-3210.044) [-3213.740] (-3208.515) (-3204.222) -- 0:04:51 79500 -- (-3207.914) [-3207.078] (-3211.963) (-3210.462) * (-3201.722) (-3216.993) (-3209.860) [-3207.477] -- 0:04:49 80000 -- (-3204.979) (-3205.200) (-3209.968) [-3203.285] * [-3206.995] (-3209.901) (-3206.885) (-3208.541) -- 0:04:47 Average standard deviation of split frequencies: 0.029219 80500 -- [-3212.246] (-3207.153) (-3212.213) (-3211.388) * [-3208.270] (-3213.000) (-3215.276) (-3209.955) -- 0:04:45 81000 -- [-3203.008] (-3203.433) (-3206.407) (-3208.243) * (-3212.487) (-3213.750) (-3204.388) [-3214.114] -- 0:04:43 81500 -- (-3207.266) (-3205.691) [-3205.177] (-3209.018) * (-3213.217) (-3226.838) [-3206.828] (-3215.938) -- 0:04:53 82000 -- [-3202.816] (-3208.661) (-3205.563) (-3207.999) * (-3214.160) (-3224.781) [-3203.937] (-3211.158) -- 0:04:51 82500 -- (-3207.656) [-3204.313] (-3211.979) (-3208.988) * (-3216.619) (-3223.701) [-3206.669] (-3207.963) -- 0:04:49 83000 -- (-3208.673) (-3203.299) (-3211.568) [-3211.282] * (-3212.052) (-3218.784) [-3209.816] (-3208.939) -- 0:04:47 83500 -- (-3209.468) (-3204.770) (-3215.342) [-3206.944] * (-3215.487) [-3208.567] (-3209.013) (-3208.611) -- 0:04:45 84000 -- (-3208.527) (-3214.092) [-3210.607] (-3217.029) * (-3213.527) [-3209.950] (-3212.905) (-3207.346) -- 0:04:43 84500 -- (-3215.428) (-3205.128) (-3213.085) [-3207.018] * (-3220.597) (-3211.222) (-3207.599) [-3208.045] -- 0:04:52 85000 -- [-3218.367] (-3206.674) (-3203.728) (-3209.058) * [-3207.679] (-3210.534) (-3209.745) (-3211.433) -- 0:04:50 Average standard deviation of split frequencies: 0.021926 85500 -- (-3212.378) [-3208.058] (-3209.372) (-3205.362) * (-3209.336) (-3214.635) (-3207.727) [-3204.460] -- 0:04:48 86000 -- (-3204.250) [-3204.873] (-3215.675) (-3208.771) * (-3211.793) (-3214.810) (-3205.189) [-3206.601] -- 0:04:46 86500 -- (-3203.463) [-3204.751] (-3216.973) (-3215.798) * (-3233.067) (-3206.102) (-3204.883) [-3204.524] -- 0:04:45 87000 -- [-3208.423] (-3205.581) (-3204.689) (-3206.135) * (-3214.264) (-3205.814) [-3210.736] (-3208.538) -- 0:04:43 87500 -- (-3209.037) (-3206.117) (-3212.762) [-3209.213] * (-3215.642) (-3204.918) [-3212.035] (-3211.823) -- 0:04:41 88000 -- [-3210.958] (-3210.585) (-3213.405) (-3205.633) * (-3215.031) [-3208.026] (-3202.886) (-3211.715) -- 0:04:50 88500 -- (-3205.032) [-3205.136] (-3209.004) (-3204.774) * (-3217.010) (-3205.810) [-3210.326] (-3215.166) -- 0:04:48 89000 -- (-3211.777) [-3209.198] (-3204.681) (-3206.206) * (-3212.930) [-3206.361] (-3209.640) (-3208.922) -- 0:04:46 89500 -- (-3214.800) [-3215.431] (-3204.135) (-3211.461) * (-3206.426) (-3206.935) (-3219.544) [-3209.441] -- 0:04:44 90000 -- (-3211.919) [-3209.837] (-3206.504) (-3209.674) * (-3211.535) (-3203.766) (-3213.780) [-3205.767] -- 0:04:43 Average standard deviation of split frequencies: 0.018198 90500 -- (-3211.607) [-3210.876] (-3203.238) (-3216.455) * (-3213.222) [-3204.258] (-3209.890) (-3206.371) -- 0:04:41 91000 -- [-3202.310] (-3207.723) (-3206.718) (-3206.959) * [-3212.645] (-3207.762) (-3210.391) (-3208.508) -- 0:04:49 91500 -- [-3203.179] (-3210.022) (-3209.139) (-3204.650) * [-3204.532] (-3209.271) (-3211.723) (-3215.841) -- 0:04:47 92000 -- (-3210.541) (-3208.798) (-3210.974) [-3207.946] * (-3208.168) (-3206.758) (-3212.297) [-3205.942] -- 0:04:46 92500 -- (-3204.365) [-3203.040] (-3204.872) (-3203.676) * [-3210.959] (-3220.758) (-3209.613) (-3207.330) -- 0:04:44 93000 -- (-3202.475) (-3207.853) (-3208.520) [-3210.348] * (-3209.377) [-3214.966] (-3215.576) (-3208.989) -- 0:04:42 93500 -- [-3206.332] (-3210.574) (-3213.250) (-3209.233) * (-3208.942) (-3203.661) (-3215.620) [-3208.003] -- 0:04:41 94000 -- (-3207.765) (-3205.786) [-3205.734] (-3206.165) * (-3208.841) (-3204.937) (-3214.642) [-3207.074] -- 0:04:39 94500 -- (-3206.369) (-3218.981) (-3207.154) [-3207.340] * [-3205.947] (-3212.247) (-3215.639) (-3203.876) -- 0:04:47 95000 -- [-3203.955] (-3210.442) (-3204.710) (-3210.672) * [-3203.299] (-3211.039) (-3214.805) (-3206.741) -- 0:04:45 Average standard deviation of split frequencies: 0.022097 95500 -- (-3215.606) (-3204.407) [-3203.490] (-3202.168) * (-3205.190) (-3210.263) [-3212.762] (-3204.698) -- 0:04:44 96000 -- [-3207.322] (-3205.963) (-3204.292) (-3213.528) * (-3209.668) (-3210.540) [-3201.907] (-3206.843) -- 0:04:42 96500 -- (-3208.210) [-3207.860] (-3203.950) (-3208.736) * (-3211.957) [-3211.432] (-3204.238) (-3207.668) -- 0:04:40 97000 -- [-3211.803] (-3211.545) (-3210.431) (-3208.515) * (-3208.655) (-3208.962) (-3210.279) [-3206.271] -- 0:04:39 97500 -- (-3212.125) [-3211.757] (-3210.769) (-3209.353) * (-3206.911) (-3212.886) (-3208.038) [-3208.772] -- 0:04:46 98000 -- (-3214.464) [-3208.452] (-3204.335) (-3208.572) * (-3210.804) [-3208.170] (-3205.830) (-3207.719) -- 0:04:45 98500 -- (-3209.279) (-3208.166) (-3204.480) [-3206.090] * (-3211.239) (-3202.802) [-3209.425] (-3208.948) -- 0:04:43 99000 -- (-3214.525) (-3208.374) (-3202.902) [-3208.317] * (-3206.091) (-3206.180) [-3211.276] (-3203.094) -- 0:04:42 99500 -- [-3212.157] (-3205.621) (-3214.794) (-3211.473) * [-3212.349] (-3210.703) (-3208.242) (-3211.194) -- 0:04:40 100000 -- (-3212.219) (-3208.204) [-3206.962] (-3207.822) * (-3212.921) (-3209.655) (-3205.984) [-3211.886] -- 0:04:39 Average standard deviation of split frequencies: 0.011707 100500 -- (-3211.169) (-3209.881) (-3204.577) [-3209.655] * (-3216.072) (-3211.659) (-3205.920) [-3215.792] -- 0:04:37 101000 -- (-3206.105) (-3206.935) (-3205.036) [-3207.158] * (-3212.039) (-3206.981) (-3209.063) [-3205.618] -- 0:04:44 101500 -- (-3206.258) (-3206.872) [-3210.807] (-3212.048) * (-3208.795) (-3209.890) (-3202.260) [-3205.499] -- 0:04:43 102000 -- (-3203.775) [-3209.099] (-3204.183) (-3206.286) * (-3208.513) [-3208.218] (-3209.415) (-3206.749) -- 0:04:41 102500 -- (-3209.884) [-3211.934] (-3205.824) (-3212.750) * [-3209.726] (-3207.817) (-3209.445) (-3208.403) -- 0:04:40 103000 -- [-3209.737] (-3205.207) (-3205.282) (-3207.174) * [-3206.170] (-3209.590) (-3209.156) (-3211.319) -- 0:04:38 103500 -- (-3206.931) (-3206.292) [-3208.750] (-3205.327) * [-3205.176] (-3207.110) (-3214.206) (-3212.711) -- 0:04:37 104000 -- (-3206.852) (-3210.992) [-3204.192] (-3208.885) * (-3209.425) [-3209.402] (-3206.200) (-3214.796) -- 0:04:44 104500 -- (-3212.468) [-3208.052] (-3210.490) (-3216.913) * [-3203.062] (-3206.165) (-3206.634) (-3208.594) -- 0:04:42 105000 -- [-3211.826] (-3201.927) (-3208.572) (-3206.488) * (-3206.877) (-3210.968) (-3203.414) [-3207.861] -- 0:04:41 Average standard deviation of split frequencies: 0.004447 105500 -- [-3209.159] (-3212.105) (-3207.201) (-3206.516) * (-3212.899) (-3207.902) (-3209.472) [-3207.828] -- 0:04:39 106000 -- (-3209.927) [-3207.428] (-3205.659) (-3211.714) * (-3206.080) [-3212.671] (-3214.350) (-3207.276) -- 0:04:38 106500 -- (-3207.419) (-3207.263) (-3211.780) [-3210.890] * [-3208.172] (-3211.998) (-3205.364) (-3207.801) -- 0:04:36 107000 -- (-3206.940) (-3209.592) [-3202.428] (-3219.026) * (-3207.538) (-3214.398) [-3207.194] (-3208.267) -- 0:04:35 107500 -- (-3213.393) (-3207.852) [-3206.816] (-3211.979) * (-3203.375) (-3210.775) (-3207.104) [-3206.740] -- 0:04:42 108000 -- (-3210.973) (-3208.364) [-3210.225] (-3204.311) * [-3206.840] (-3211.470) (-3209.942) (-3209.525) -- 0:04:40 108500 -- [-3206.082] (-3209.212) (-3215.033) (-3210.235) * (-3208.428) [-3206.625] (-3210.235) (-3215.448) -- 0:04:39 109000 -- (-3214.070) (-3215.814) [-3203.188] (-3213.482) * (-3206.067) (-3208.721) (-3210.210) [-3209.043] -- 0:04:37 109500 -- (-3215.257) (-3211.351) [-3210.995] (-3210.080) * (-3210.269) [-3203.716] (-3208.944) (-3214.520) -- 0:04:36 110000 -- (-3207.857) (-3216.699) (-3209.841) [-3211.229] * (-3204.896) [-3205.359] (-3207.655) (-3211.314) -- 0:04:35 Average standard deviation of split frequencies: 0.004260 110500 -- (-3209.821) [-3208.879] (-3212.014) (-3216.812) * (-3204.234) (-3206.140) [-3211.008] (-3207.644) -- 0:04:41 111000 -- [-3203.834] (-3209.469) (-3213.797) (-3206.108) * [-3206.733] (-3205.728) (-3205.057) (-3208.748) -- 0:04:40 111500 -- (-3208.481) (-3213.144) (-3212.861) [-3205.225] * (-3215.413) [-3206.497] (-3205.372) (-3212.008) -- 0:04:38 112000 -- (-3206.918) [-3213.418] (-3208.921) (-3203.181) * (-3209.780) [-3213.921] (-3213.377) (-3208.666) -- 0:04:37 112500 -- [-3207.592] (-3214.498) (-3210.998) (-3219.722) * (-3209.884) (-3208.345) (-3217.488) [-3207.782] -- 0:04:36 113000 -- (-3208.756) (-3213.482) [-3208.006] (-3207.841) * (-3211.370) (-3209.829) [-3210.963] (-3208.458) -- 0:04:34 113500 -- (-3208.802) (-3209.514) [-3211.490] (-3208.809) * (-3208.849) (-3210.975) (-3210.615) [-3209.602] -- 0:04:33 114000 -- (-3210.224) (-3210.856) (-3208.290) [-3204.857] * (-3205.154) (-3205.657) [-3209.962] (-3216.702) -- 0:04:39 114500 -- (-3210.669) (-3212.247) (-3211.302) [-3209.917] * (-3216.458) (-3208.212) (-3214.819) [-3205.232] -- 0:04:38 115000 -- (-3219.450) (-3207.083) [-3212.765] (-3211.526) * (-3218.667) (-3218.776) [-3205.001] (-3208.703) -- 0:04:37 Average standard deviation of split frequencies: 0.010160 115500 -- [-3203.600] (-3206.569) (-3211.951) (-3211.086) * (-3213.894) (-3209.809) (-3205.042) [-3211.932] -- 0:04:35 116000 -- (-3205.476) (-3208.303) [-3208.714] (-3215.852) * [-3209.105] (-3202.846) (-3213.868) (-3205.242) -- 0:04:34 116500 -- (-3209.347) (-3209.028) (-3209.284) [-3205.936] * [-3205.197] (-3209.315) (-3204.757) (-3205.566) -- 0:04:33 117000 -- (-3207.157) [-3204.741] (-3209.179) (-3208.117) * [-3202.272] (-3211.258) (-3206.532) (-3207.454) -- 0:04:39 117500 -- (-3213.001) (-3210.258) [-3210.307] (-3201.861) * (-3213.192) [-3210.758] (-3203.314) (-3210.108) -- 0:04:37 118000 -- (-3206.742) [-3207.273] (-3209.973) (-3217.463) * [-3202.466] (-3205.360) (-3207.058) (-3207.815) -- 0:04:36 118500 -- [-3203.596] (-3213.623) (-3203.584) (-3214.245) * [-3206.321] (-3207.399) (-3206.028) (-3210.112) -- 0:04:35 119000 -- [-3203.812] (-3209.505) (-3211.096) (-3207.614) * (-3206.996) (-3212.484) [-3211.431] (-3205.455) -- 0:04:33 119500 -- [-3206.575] (-3221.335) (-3212.403) (-3206.049) * (-3209.096) (-3217.087) [-3205.096] (-3204.891) -- 0:04:32 120000 -- (-3210.369) (-3215.708) [-3214.308] (-3205.721) * [-3204.980] (-3216.431) (-3211.484) (-3207.781) -- 0:04:38 Average standard deviation of split frequencies: 0.007813 120500 -- (-3206.141) (-3211.935) (-3205.894) [-3206.593] * (-3207.288) (-3207.451) [-3211.105] (-3208.772) -- 0:04:37 121000 -- (-3206.923) [-3211.058] (-3208.857) (-3211.968) * (-3208.129) [-3206.033] (-3216.290) (-3204.877) -- 0:04:36 121500 -- (-3209.787) [-3214.909] (-3218.391) (-3208.365) * (-3204.068) (-3214.607) [-3211.331] (-3204.544) -- 0:04:34 122000 -- (-3209.177) (-3208.940) (-3208.486) [-3209.596] * (-3210.039) (-3207.909) (-3210.268) [-3205.195] -- 0:04:33 122500 -- (-3219.431) (-3214.310) [-3206.608] (-3212.264) * [-3212.269] (-3207.435) (-3204.240) (-3203.566) -- 0:04:32 123000 -- (-3210.193) [-3208.511] (-3208.409) (-3209.607) * (-3212.196) (-3206.534) (-3209.578) [-3207.745] -- 0:04:30 123500 -- (-3217.710) (-3214.288) (-3208.466) [-3207.740] * (-3217.466) (-3210.117) [-3206.422] (-3205.304) -- 0:04:36 124000 -- (-3207.999) (-3211.040) (-3210.043) [-3204.494] * (-3212.762) (-3202.916) (-3204.499) [-3208.437] -- 0:04:35 124500 -- (-3210.921) (-3206.547) (-3206.598) [-3207.295] * (-3219.170) (-3205.338) (-3211.244) [-3210.871] -- 0:04:34 125000 -- [-3209.703] (-3209.383) (-3204.589) (-3203.946) * (-3208.733) [-3203.538] (-3204.541) (-3209.335) -- 0:04:33 Average standard deviation of split frequencies: 0.005612 125500 -- (-3212.590) (-3205.256) (-3214.294) [-3208.573] * (-3210.774) (-3206.387) (-3200.669) [-3207.094] -- 0:04:31 126000 -- [-3207.834] (-3206.667) (-3218.516) (-3208.210) * [-3221.601] (-3209.479) (-3209.439) (-3203.698) -- 0:04:30 126500 -- (-3205.776) [-3204.368] (-3210.058) (-3208.746) * (-3213.555) (-3217.658) [-3207.313] (-3210.382) -- 0:04:36 127000 -- (-3206.958) [-3203.237] (-3206.572) (-3209.838) * (-3210.864) (-3210.448) [-3212.353] (-3211.562) -- 0:04:34 127500 -- (-3205.432) (-3205.851) (-3206.201) [-3212.800] * (-3209.429) [-3208.901] (-3215.589) (-3214.538) -- 0:04:33 128000 -- (-3210.222) [-3206.120] (-3209.755) (-3210.709) * (-3214.460) (-3211.648) (-3209.966) [-3210.458] -- 0:04:32 128500 -- (-3206.226) (-3207.203) [-3209.146] (-3208.601) * (-3213.032) (-3209.709) (-3216.274) [-3207.316] -- 0:04:31 129000 -- [-3209.094] (-3209.884) (-3210.543) (-3214.754) * [-3206.380] (-3209.777) (-3212.301) (-3206.058) -- 0:04:30 129500 -- [-3204.411] (-3214.533) (-3205.448) (-3210.922) * (-3211.343) (-3205.997) [-3206.313] (-3209.106) -- 0:04:35 130000 -- [-3201.504] (-3207.883) (-3211.612) (-3210.266) * [-3202.894] (-3223.765) (-3209.011) (-3212.723) -- 0:04:34 Average standard deviation of split frequencies: 0.007215 130500 -- (-3204.767) [-3209.480] (-3214.353) (-3207.930) * (-3205.624) (-3209.940) (-3211.503) [-3206.744] -- 0:04:33 131000 -- [-3208.461] (-3216.106) (-3209.466) (-3212.303) * (-3207.564) (-3207.502) (-3210.294) [-3214.660] -- 0:04:31 131500 -- [-3204.946] (-3211.068) (-3204.699) (-3216.529) * (-3213.321) (-3213.498) (-3208.342) [-3212.719] -- 0:04:30 132000 -- (-3207.894) [-3209.623] (-3208.675) (-3204.775) * (-3214.045) (-3209.631) (-3210.915) [-3206.237] -- 0:04:29 132500 -- (-3215.804) [-3203.808] (-3209.740) (-3208.951) * (-3212.404) (-3211.184) (-3205.405) [-3203.368] -- 0:04:28 133000 -- (-3217.787) (-3216.228) [-3209.505] (-3210.346) * (-3210.106) (-3213.063) [-3206.444] (-3206.559) -- 0:04:33 133500 -- (-3208.671) (-3206.697) (-3202.585) [-3207.769] * [-3203.623] (-3209.529) (-3209.145) (-3211.170) -- 0:04:32 134000 -- (-3213.214) (-3203.275) [-3208.752] (-3216.716) * (-3206.728) (-3209.081) [-3208.712] (-3215.496) -- 0:04:31 134500 -- (-3204.971) [-3202.548] (-3212.989) (-3207.747) * [-3204.797] (-3218.110) (-3209.696) (-3215.195) -- 0:04:30 135000 -- (-3206.728) (-3204.612) (-3215.866) [-3212.603] * (-3206.679) (-3212.133) [-3209.776] (-3211.746) -- 0:04:29 Average standard deviation of split frequencies: 0.010399 135500 -- (-3207.093) [-3209.959] (-3210.452) (-3212.628) * [-3205.525] (-3221.633) (-3208.277) (-3210.631) -- 0:04:27 136000 -- (-3214.371) (-3203.054) [-3207.904] (-3213.335) * [-3204.356] (-3206.325) (-3208.387) (-3209.892) -- 0:04:33 136500 -- (-3206.817) (-3207.137) (-3214.391) [-3205.230] * (-3205.064) (-3206.219) (-3206.650) [-3207.766] -- 0:04:32 137000 -- (-3205.863) (-3205.282) (-3210.159) [-3207.425] * (-3210.579) [-3202.466] (-3208.167) (-3204.794) -- 0:04:30 137500 -- [-3206.280] (-3205.544) (-3205.642) (-3207.957) * (-3212.103) (-3206.590) (-3208.685) [-3201.990] -- 0:04:29 138000 -- [-3207.071] (-3212.256) (-3206.538) (-3206.574) * (-3212.081) (-3216.121) (-3210.351) [-3204.223] -- 0:04:28 138500 -- (-3201.824) (-3207.912) (-3208.852) [-3208.304] * (-3210.409) (-3214.655) [-3203.979] (-3208.491) -- 0:04:27 139000 -- [-3205.025] (-3212.890) (-3204.818) (-3204.812) * (-3208.351) (-3209.171) [-3209.483] (-3206.832) -- 0:04:26 139500 -- (-3209.785) (-3210.344) (-3210.859) [-3209.088] * (-3208.368) [-3203.763] (-3204.941) (-3205.357) -- 0:04:31 140000 -- (-3213.834) (-3212.940) [-3207.937] (-3203.692) * [-3203.783] (-3204.293) (-3211.773) (-3209.918) -- 0:04:30 Average standard deviation of split frequencies: 0.011729 140500 -- (-3208.955) [-3204.209] (-3211.321) (-3204.100) * (-3218.170) (-3208.958) (-3210.792) [-3205.027] -- 0:04:29 141000 -- (-3210.237) [-3208.754] (-3211.993) (-3210.935) * (-3203.514) (-3205.460) [-3205.279] (-3205.530) -- 0:04:28 141500 -- (-3212.633) [-3213.142] (-3206.127) (-3209.160) * (-3206.538) [-3207.744] (-3210.434) (-3203.829) -- 0:04:26 142000 -- (-3208.389) [-3211.215] (-3204.982) (-3206.359) * (-3208.505) (-3205.162) [-3206.500] (-3205.192) -- 0:04:25 142500 -- [-3207.306] (-3211.087) (-3213.710) (-3212.559) * (-3204.967) [-3209.003] (-3213.034) (-3211.060) -- 0:04:30 143000 -- [-3207.571] (-3211.651) (-3213.330) (-3211.078) * (-3203.542) (-3209.737) [-3204.330] (-3204.362) -- 0:04:29 143500 -- (-3209.181) [-3210.545] (-3212.480) (-3210.864) * (-3201.127) (-3210.942) [-3209.275] (-3206.870) -- 0:04:28 144000 -- (-3209.492) (-3209.613) [-3206.938] (-3218.424) * [-3204.773] (-3216.147) (-3206.602) (-3207.187) -- 0:04:27 144500 -- (-3207.386) (-3208.711) (-3207.411) [-3207.673] * (-3208.121) [-3210.503] (-3210.369) (-3216.439) -- 0:04:26 145000 -- [-3204.768] (-3213.241) (-3206.001) (-3208.450) * [-3205.125] (-3211.475) (-3211.235) (-3204.636) -- 0:04:25 Average standard deviation of split frequencies: 0.016144 145500 -- (-3201.750) (-3220.431) (-3206.200) [-3208.187] * (-3215.285) (-3216.345) (-3215.594) [-3205.648] -- 0:04:24 146000 -- [-3203.256] (-3210.685) (-3210.281) (-3204.331) * (-3215.688) (-3209.500) [-3207.535] (-3207.842) -- 0:04:29 146500 -- (-3211.625) (-3202.881) [-3206.258] (-3212.677) * (-3206.282) (-3204.780) [-3206.965] (-3206.476) -- 0:04:27 147000 -- (-3208.153) (-3205.597) [-3207.047] (-3207.491) * (-3203.787) [-3207.303] (-3206.323) (-3207.876) -- 0:04:26 147500 -- (-3206.992) [-3208.482] (-3203.653) (-3209.071) * [-3208.094] (-3208.292) (-3209.998) (-3204.347) -- 0:04:25 148000 -- (-3210.435) (-3207.645) [-3207.415] (-3210.423) * (-3206.604) [-3212.499] (-3208.075) (-3211.552) -- 0:04:24 148500 -- (-3204.397) [-3208.848] (-3208.729) (-3206.714) * [-3205.813] (-3211.123) (-3207.976) (-3205.954) -- 0:04:23 149000 -- [-3212.417] (-3207.269) (-3212.191) (-3206.046) * (-3208.761) [-3209.253] (-3210.642) (-3205.519) -- 0:04:28 149500 -- (-3215.787) (-3212.764) (-3214.906) [-3202.650] * (-3204.483) [-3205.971] (-3214.285) (-3215.269) -- 0:04:27 150000 -- [-3210.170] (-3204.733) (-3206.477) (-3205.495) * (-3203.401) (-3208.660) (-3215.851) [-3205.009] -- 0:04:26 Average standard deviation of split frequencies: 0.012515 150500 -- [-3210.187] (-3207.487) (-3203.477) (-3205.479) * (-3206.216) (-3219.776) [-3206.972] (-3206.745) -- 0:04:25 151000 -- (-3208.134) [-3202.467] (-3210.495) (-3206.963) * [-3207.938] (-3216.804) (-3208.151) (-3205.497) -- 0:04:24 151500 -- (-3219.053) (-3208.613) [-3205.485] (-3208.349) * [-3208.920] (-3212.586) (-3203.854) (-3205.465) -- 0:04:23 152000 -- (-3208.006) (-3203.879) [-3209.633] (-3212.586) * (-3210.512) (-3214.722) (-3217.490) [-3206.266] -- 0:04:22 152500 -- (-3208.297) (-3207.880) (-3208.155) [-3205.128] * (-3208.965) (-3217.279) [-3205.561] (-3212.724) -- 0:04:26 153000 -- [-3208.453] (-3217.365) (-3207.388) (-3204.519) * (-3213.614) [-3214.566] (-3211.640) (-3204.413) -- 0:04:25 153500 -- (-3203.280) [-3211.598] (-3206.776) (-3208.254) * (-3213.375) (-3214.944) [-3210.155] (-3210.276) -- 0:04:24 154000 -- [-3203.904] (-3206.222) (-3209.986) (-3210.962) * [-3211.110] (-3216.397) (-3213.832) (-3210.050) -- 0:04:23 154500 -- (-3212.422) (-3208.852) [-3205.034] (-3211.181) * (-3210.034) [-3208.880] (-3216.124) (-3208.382) -- 0:04:22 155000 -- (-3208.760) [-3206.717] (-3209.964) (-3205.035) * (-3209.824) (-3206.941) (-3210.098) [-3209.692] -- 0:04:21 Average standard deviation of split frequencies: 0.004533 155500 -- (-3205.827) (-3206.735) (-3210.309) [-3211.477] * (-3206.714) (-3209.891) (-3204.257) [-3216.112] -- 0:04:26 156000 -- [-3207.504] (-3205.573) (-3211.528) (-3206.106) * (-3204.252) (-3207.096) (-3212.597) [-3212.905] -- 0:04:25 156500 -- [-3207.713] (-3211.338) (-3211.355) (-3211.092) * [-3203.894] (-3210.623) (-3217.479) (-3206.355) -- 0:04:24 157000 -- [-3206.892] (-3211.439) (-3212.094) (-3212.411) * [-3207.251] (-3210.708) (-3213.430) (-3214.436) -- 0:04:23 157500 -- (-3205.505) (-3211.160) (-3209.236) [-3212.059] * (-3212.288) (-3209.560) [-3205.384] (-3207.197) -- 0:04:22 158000 -- (-3207.333) (-3214.770) (-3210.097) [-3214.479] * (-3214.730) (-3207.280) [-3203.052] (-3207.931) -- 0:04:21 158500 -- (-3209.960) (-3208.999) [-3202.852] (-3206.221) * (-3214.391) (-3210.366) (-3202.691) [-3204.555] -- 0:04:25 159000 -- [-3205.731] (-3211.323) (-3210.854) (-3207.058) * (-3208.790) (-3205.847) [-3204.508] (-3217.373) -- 0:04:24 159500 -- (-3210.055) [-3208.869] (-3203.824) (-3206.201) * (-3208.922) [-3206.367] (-3204.933) (-3207.581) -- 0:04:23 160000 -- (-3208.821) (-3208.801) (-3211.346) [-3205.351] * [-3217.347] (-3207.907) (-3210.199) (-3208.506) -- 0:04:22 Average standard deviation of split frequencies: 0.013203 160500 -- (-3206.992) [-3209.183] (-3209.394) (-3203.073) * (-3209.215) (-3207.799) [-3205.338] (-3210.320) -- 0:04:21 161000 -- [-3207.028] (-3209.666) (-3212.831) (-3205.140) * (-3206.260) [-3208.931] (-3213.473) (-3210.991) -- 0:04:20 161500 -- [-3203.827] (-3206.048) (-3205.732) (-3210.913) * (-3201.768) (-3209.448) (-3211.199) [-3209.146] -- 0:04:19 162000 -- (-3210.951) (-3210.693) [-3205.320] (-3207.428) * (-3205.572) (-3203.540) (-3207.489) [-3211.213] -- 0:04:23 162500 -- (-3208.836) (-3210.849) [-3207.343] (-3208.483) * (-3214.558) [-3206.663] (-3212.099) (-3207.071) -- 0:04:22 163000 -- (-3208.413) (-3204.941) (-3206.771) [-3205.976] * (-3202.764) (-3208.497) [-3209.634] (-3205.036) -- 0:04:21 163500 -- (-3207.847) (-3213.879) [-3201.719] (-3205.301) * (-3212.452) (-3214.178) [-3207.463] (-3215.626) -- 0:04:20 164000 -- (-3203.738) [-3210.493] (-3209.358) (-3204.013) * (-3215.750) [-3207.102] (-3210.038) (-3211.620) -- 0:04:19 164500 -- (-3209.516) (-3207.573) [-3207.254] (-3206.123) * (-3212.678) [-3206.536] (-3209.119) (-3214.111) -- 0:04:19 165000 -- (-3207.853) (-3207.217) (-3203.704) [-3207.702] * [-3213.418] (-3206.000) (-3209.939) (-3206.916) -- 0:04:23 Average standard deviation of split frequencies: 0.017039 165500 -- [-3203.819] (-3220.649) (-3207.728) (-3205.875) * (-3210.496) [-3205.547] (-3205.873) (-3211.906) -- 0:04:22 166000 -- (-3207.799) (-3210.900) (-3204.348) [-3203.810] * [-3203.714] (-3205.412) (-3210.497) (-3212.932) -- 0:04:21 166500 -- (-3205.532) (-3212.735) [-3201.794] (-3205.279) * (-3217.569) (-3206.297) [-3203.367] (-3209.632) -- 0:04:20 167000 -- [-3204.216] (-3206.290) (-3208.685) (-3212.458) * (-3207.350) (-3208.650) [-3205.136] (-3206.335) -- 0:04:19 167500 -- (-3202.857) (-3206.933) (-3210.503) [-3206.986] * (-3208.767) [-3205.602] (-3215.897) (-3208.585) -- 0:04:18 168000 -- (-3208.840) (-3212.587) (-3206.781) [-3203.800] * (-3206.386) [-3208.316] (-3213.136) (-3207.736) -- 0:04:17 168500 -- (-3208.001) [-3212.750] (-3207.119) (-3205.373) * [-3207.421] (-3206.741) (-3206.201) (-3204.644) -- 0:04:21 169000 -- [-3204.520] (-3210.052) (-3211.835) (-3206.995) * (-3207.330) (-3208.119) [-3204.585] (-3214.197) -- 0:04:20 169500 -- (-3205.547) (-3214.348) [-3210.562] (-3203.467) * [-3203.914] (-3208.108) (-3209.234) (-3205.220) -- 0:04:19 170000 -- [-3208.295] (-3207.515) (-3216.525) (-3218.905) * [-3203.456] (-3210.516) (-3211.978) (-3208.883) -- 0:04:18 Average standard deviation of split frequencies: 0.016573 170500 -- [-3209.120] (-3210.917) (-3207.376) (-3207.394) * (-3214.225) (-3207.983) [-3214.787] (-3206.675) -- 0:04:17 171000 -- (-3209.852) (-3211.898) (-3208.484) [-3203.760] * (-3210.302) [-3217.835] (-3212.956) (-3208.308) -- 0:04:16 171500 -- (-3209.731) (-3214.927) (-3208.090) [-3202.374] * (-3208.473) [-3211.425] (-3211.038) (-3214.070) -- 0:04:20 172000 -- (-3208.512) (-3205.610) (-3205.940) [-3204.778] * (-3211.354) [-3211.374] (-3214.993) (-3207.002) -- 0:04:19 172500 -- (-3206.254) (-3206.747) [-3209.311] (-3211.415) * (-3206.834) [-3209.498] (-3222.495) (-3210.379) -- 0:04:19 173000 -- [-3207.137] (-3202.048) (-3210.492) (-3205.287) * (-3211.829) [-3206.254] (-3212.540) (-3208.982) -- 0:04:18 173500 -- (-3206.038) [-3204.870] (-3208.890) (-3205.605) * [-3205.354] (-3211.957) (-3209.395) (-3217.792) -- 0:04:17 174000 -- (-3202.376) [-3203.899] (-3210.752) (-3213.635) * (-3211.430) [-3207.292] (-3209.922) (-3216.245) -- 0:04:16 174500 -- (-3212.071) (-3211.729) [-3206.866] (-3210.717) * (-3213.027) (-3207.784) [-3211.668] (-3217.288) -- 0:04:15 175000 -- [-3205.084] (-3216.203) (-3206.545) (-3208.917) * [-3209.299] (-3209.516) (-3211.922) (-3211.552) -- 0:04:19 Average standard deviation of split frequencies: 0.014731 175500 -- (-3206.135) (-3203.461) [-3207.313] (-3214.588) * (-3217.056) [-3207.361] (-3205.216) (-3206.367) -- 0:04:18 176000 -- (-3203.306) (-3208.088) (-3211.806) [-3212.291] * [-3206.885] (-3210.117) (-3204.725) (-3210.483) -- 0:04:17 176500 -- [-3202.693] (-3209.886) (-3210.558) (-3208.499) * (-3211.043) (-3209.219) [-3204.551] (-3210.115) -- 0:04:16 177000 -- [-3203.468] (-3209.165) (-3213.612) (-3211.547) * (-3209.315) [-3206.837] (-3203.134) (-3209.236) -- 0:04:15 177500 -- (-3206.734) [-3206.328] (-3208.440) (-3212.072) * (-3210.358) (-3218.661) [-3206.086] (-3209.564) -- 0:04:14 178000 -- (-3206.516) (-3209.897) [-3208.408] (-3213.634) * (-3206.803) [-3207.343] (-3204.096) (-3208.414) -- 0:04:18 178500 -- (-3217.315) (-3209.306) [-3204.926] (-3215.317) * (-3205.692) (-3209.169) [-3206.273] (-3208.623) -- 0:04:17 179000 -- (-3217.181) (-3213.467) [-3207.121] (-3209.942) * [-3204.646] (-3210.038) (-3207.154) (-3208.499) -- 0:04:16 179500 -- (-3207.962) [-3211.332] (-3209.955) (-3214.371) * (-3208.471) (-3209.157) [-3206.997] (-3204.295) -- 0:04:15 180000 -- [-3207.740] (-3215.617) (-3211.400) (-3212.691) * (-3209.922) [-3204.503] (-3212.511) (-3208.826) -- 0:04:15 Average standard deviation of split frequencies: 0.013046 180500 -- (-3206.560) (-3210.306) [-3206.639] (-3210.757) * [-3209.925] (-3207.469) (-3209.222) (-3204.020) -- 0:04:14 181000 -- (-3207.305) (-3212.486) (-3204.549) [-3209.753] * (-3208.212) (-3210.466) (-3208.805) [-3206.049] -- 0:04:13 181500 -- [-3205.101] (-3218.666) (-3208.078) (-3211.220) * [-3205.733] (-3207.735) (-3203.689) (-3206.009) -- 0:04:17 182000 -- (-3208.782) [-3210.755] (-3206.249) (-3212.189) * (-3211.144) [-3202.463] (-3205.081) (-3205.256) -- 0:04:16 182500 -- [-3209.482] (-3205.071) (-3205.493) (-3209.297) * (-3207.076) (-3208.766) [-3202.251] (-3205.390) -- 0:04:15 183000 -- (-3210.543) (-3207.759) [-3206.177] (-3216.068) * (-3213.896) (-3210.034) [-3205.859] (-3206.217) -- 0:04:14 183500 -- (-3212.269) (-3211.897) (-3208.552) [-3202.842] * (-3207.575) [-3211.735] (-3205.324) (-3204.939) -- 0:04:13 184000 -- (-3208.425) [-3210.536] (-3209.276) (-3202.735) * (-3204.643) (-3220.286) (-3206.870) [-3208.615] -- 0:04:12 184500 -- (-3208.130) (-3209.599) (-3207.612) [-3212.268] * (-3209.094) (-3216.479) (-3206.945) [-3201.004] -- 0:04:16 185000 -- [-3208.368] (-3215.133) (-3211.922) (-3205.227) * (-3214.294) (-3206.671) (-3207.403) [-3202.634] -- 0:04:15 Average standard deviation of split frequencies: 0.013939 185500 -- (-3208.241) (-3203.262) [-3207.682] (-3210.297) * (-3214.941) (-3207.996) (-3209.970) [-3206.280] -- 0:04:14 186000 -- (-3207.420) (-3204.535) [-3205.876] (-3211.363) * (-3212.175) (-3205.300) (-3205.489) [-3204.022] -- 0:04:13 186500 -- (-3203.869) [-3209.541] (-3203.780) (-3205.053) * [-3204.369] (-3206.251) (-3207.363) (-3204.760) -- 0:04:12 187000 -- (-3209.391) [-3208.099] (-3210.008) (-3207.630) * (-3212.981) [-3206.249] (-3209.645) (-3209.159) -- 0:04:12 187500 -- [-3205.812] (-3209.673) (-3213.472) (-3205.024) * (-3211.333) (-3210.342) [-3203.587] (-3207.002) -- 0:04:15 188000 -- [-3201.323] (-3206.125) (-3207.546) (-3215.000) * [-3205.488] (-3210.908) (-3205.429) (-3214.073) -- 0:04:14 188500 -- (-3207.158) [-3212.446] (-3203.394) (-3212.057) * (-3222.279) (-3210.982) (-3211.825) [-3206.572] -- 0:04:13 189000 -- (-3202.507) (-3212.500) [-3206.859] (-3206.184) * (-3215.335) (-3208.672) (-3213.724) [-3204.982] -- 0:04:13 189500 -- (-3211.133) (-3221.179) (-3207.994) [-3208.336] * (-3213.699) [-3208.359] (-3205.898) (-3204.905) -- 0:04:12 190000 -- (-3208.201) (-3215.964) (-3202.965) [-3209.767] * (-3211.332) [-3210.195] (-3204.546) (-3206.499) -- 0:04:11 Average standard deviation of split frequencies: 0.013598 190500 -- (-3206.508) (-3204.864) [-3202.485] (-3213.342) * (-3216.863) (-3206.417) (-3210.414) [-3203.072] -- 0:04:10 191000 -- (-3205.180) [-3207.299] (-3201.567) (-3209.209) * (-3209.418) [-3210.519] (-3204.558) (-3206.669) -- 0:04:14 191500 -- [-3203.840] (-3201.590) (-3210.147) (-3209.323) * (-3210.602) (-3207.686) (-3206.958) [-3205.428] -- 0:04:13 192000 -- [-3207.642] (-3210.173) (-3206.302) (-3209.470) * (-3212.442) (-3215.955) [-3202.926] (-3205.638) -- 0:04:12 192500 -- (-3210.165) (-3213.548) [-3209.140] (-3207.247) * (-3211.025) (-3207.724) [-3203.633] (-3205.667) -- 0:04:11 193000 -- (-3213.469) (-3211.430) [-3205.939] (-3208.119) * (-3207.662) (-3211.139) [-3213.819] (-3215.989) -- 0:04:10 193500 -- [-3210.163] (-3217.334) (-3215.898) (-3203.375) * (-3208.705) (-3206.156) (-3213.441) [-3204.949] -- 0:04:10 194000 -- [-3209.042] (-3209.213) (-3213.037) (-3210.942) * (-3215.086) [-3208.132] (-3211.936) (-3210.000) -- 0:04:13 194500 -- (-3209.723) (-3210.364) (-3215.216) [-3203.390] * (-3209.747) (-3210.337) (-3207.214) [-3205.884] -- 0:04:12 195000 -- [-3212.022] (-3206.294) (-3212.249) (-3200.483) * (-3206.047) [-3206.591] (-3215.824) (-3209.452) -- 0:04:11 Average standard deviation of split frequencies: 0.013228 195500 -- (-3203.936) (-3212.714) (-3212.854) [-3200.706] * [-3211.615] (-3202.986) (-3203.198) (-3211.673) -- 0:04:11 196000 -- (-3205.204) (-3214.377) [-3211.111] (-3202.273) * (-3204.963) (-3214.028) (-3213.013) [-3210.336] -- 0:04:10 196500 -- (-3209.918) (-3208.469) [-3207.746] (-3214.334) * (-3210.903) (-3207.697) (-3203.218) [-3206.885] -- 0:04:09 197000 -- (-3218.168) [-3214.929] (-3212.164) (-3217.127) * (-3205.470) [-3205.282] (-3204.988) (-3206.438) -- 0:04:08 197500 -- (-3210.572) (-3205.638) [-3207.500] (-3204.226) * (-3207.231) (-3210.391) (-3204.062) [-3209.581] -- 0:04:11 198000 -- (-3207.658) (-3207.713) (-3202.482) [-3207.245] * (-3207.402) (-3204.484) [-3208.555] (-3213.585) -- 0:04:11 198500 -- (-3212.915) (-3210.778) (-3203.114) [-3208.054] * [-3204.268] (-3209.379) (-3215.019) (-3211.775) -- 0:04:10 199000 -- (-3212.751) (-3209.397) (-3205.024) [-3209.980] * (-3212.061) [-3205.963] (-3214.902) (-3206.220) -- 0:04:09 199500 -- (-3209.380) [-3206.306] (-3212.072) (-3210.299) * [-3208.748] (-3206.921) (-3208.127) (-3208.766) -- 0:04:08 200000 -- (-3209.713) (-3209.789) [-3207.978] (-3209.537) * (-3203.415) (-3209.136) (-3209.542) [-3205.784] -- 0:04:08 Average standard deviation of split frequencies: 0.014095 200500 -- (-3210.209) [-3206.429] (-3218.759) (-3206.216) * [-3205.937] (-3208.426) (-3213.282) (-3212.798) -- 0:04:11 201000 -- (-3208.964) [-3210.084] (-3213.702) (-3216.267) * (-3211.424) (-3203.440) [-3214.169] (-3210.891) -- 0:04:10 201500 -- [-3206.455] (-3210.011) (-3211.623) (-3211.057) * (-3209.618) [-3203.144] (-3207.463) (-3212.883) -- 0:04:09 202000 -- (-3205.186) [-3206.421] (-3204.798) (-3208.403) * (-3217.221) (-3206.824) (-3208.579) [-3204.684] -- 0:04:08 202500 -- (-3212.969) (-3205.547) (-3216.644) [-3206.509] * (-3204.092) (-3213.743) (-3204.136) [-3205.476] -- 0:04:08 203000 -- (-3214.871) [-3208.883] (-3205.900) (-3209.912) * (-3205.804) (-3208.176) [-3204.958] (-3207.008) -- 0:04:07 203500 -- (-3212.807) (-3209.045) (-3206.557) [-3203.006] * (-3206.238) [-3206.565] (-3207.719) (-3211.646) -- 0:04:10 204000 -- [-3208.943] (-3218.604) (-3206.467) (-3204.381) * (-3210.284) [-3206.330] (-3205.794) (-3209.130) -- 0:04:09 204500 -- (-3207.038) [-3212.511] (-3210.693) (-3209.426) * [-3205.714] (-3208.279) (-3207.118) (-3212.174) -- 0:04:08 205000 -- [-3215.653] (-3202.871) (-3208.167) (-3209.034) * [-3213.151] (-3215.600) (-3211.187) (-3205.666) -- 0:04:08 Average standard deviation of split frequencies: 0.011442 205500 -- (-3210.002) (-3204.985) [-3201.700] (-3207.633) * [-3214.544] (-3209.410) (-3212.993) (-3208.463) -- 0:04:07 206000 -- (-3207.161) (-3203.203) [-3203.974] (-3207.608) * (-3205.590) (-3205.764) (-3203.846) [-3206.641] -- 0:04:06 206500 -- (-3207.048) (-3202.356) [-3210.566] (-3207.038) * (-3209.936) (-3208.369) (-3211.894) [-3208.177] -- 0:04:05 207000 -- (-3203.972) (-3206.440) (-3210.521) [-3208.484] * [-3211.272] (-3203.825) (-3214.721) (-3207.899) -- 0:04:09 207500 -- (-3210.365) [-3210.866] (-3209.301) (-3206.266) * (-3207.877) (-3209.223) [-3211.610] (-3208.786) -- 0:04:08 208000 -- (-3204.897) (-3210.159) (-3208.284) [-3202.979] * (-3208.485) [-3206.923] (-3212.020) (-3209.908) -- 0:04:07 208500 -- (-3205.935) [-3209.706] (-3211.198) (-3208.319) * (-3201.552) (-3211.769) (-3205.300) [-3208.598] -- 0:04:06 209000 -- (-3209.710) (-3209.754) [-3203.852] (-3204.506) * [-3205.768] (-3206.923) (-3210.102) (-3210.415) -- 0:04:06 209500 -- (-3210.328) (-3215.264) (-3210.738) [-3204.884] * (-3209.236) (-3207.880) [-3205.668] (-3209.754) -- 0:04:05 210000 -- (-3217.493) (-3209.063) (-3208.926) [-3206.791] * (-3211.911) (-3206.152) (-3207.120) [-3216.182] -- 0:04:08 Average standard deviation of split frequencies: 0.010070 210500 -- [-3210.393] (-3209.105) (-3208.959) (-3211.790) * (-3212.474) (-3207.687) (-3206.105) [-3209.610] -- 0:04:07 211000 -- (-3207.418) [-3206.750] (-3208.454) (-3205.151) * [-3206.046] (-3203.615) (-3209.745) (-3205.482) -- 0:04:06 211500 -- (-3206.082) [-3202.742] (-3201.809) (-3212.259) * (-3213.488) (-3205.491) (-3210.768) [-3207.020] -- 0:04:06 212000 -- (-3209.883) (-3207.012) [-3201.520] (-3210.360) * [-3214.079] (-3211.029) (-3209.394) (-3207.635) -- 0:04:05 212500 -- (-3219.881) (-3210.060) [-3210.107] (-3212.067) * (-3206.870) (-3211.737) [-3207.960] (-3213.786) -- 0:04:04 213000 -- (-3208.291) (-3205.691) [-3213.055] (-3206.258) * (-3206.454) [-3205.027] (-3211.974) (-3211.728) -- 0:04:07 213500 -- [-3208.485] (-3207.996) (-3214.808) (-3207.637) * (-3218.020) (-3206.708) (-3205.633) [-3201.510] -- 0:04:06 214000 -- (-3206.217) (-3205.380) (-3209.170) [-3207.856] * [-3206.605] (-3206.673) (-3208.748) (-3215.690) -- 0:04:06 214500 -- (-3210.431) (-3207.623) (-3207.739) [-3203.682] * (-3206.161) (-3208.835) [-3208.018] (-3206.765) -- 0:04:05 215000 -- (-3209.229) (-3208.516) (-3208.393) [-3207.446] * (-3212.389) (-3206.290) [-3207.392] (-3213.598) -- 0:04:04 Average standard deviation of split frequencies: 0.014186 215500 -- [-3209.425] (-3212.335) (-3214.756) (-3207.179) * (-3214.555) (-3208.287) (-3215.841) [-3209.385] -- 0:04:03 216000 -- (-3209.716) (-3212.143) (-3213.568) [-3203.887] * [-3208.313] (-3207.628) (-3212.996) (-3204.033) -- 0:04:03 216500 -- (-3207.373) (-3208.506) (-3206.076) [-3203.486] * (-3205.045) (-3207.707) (-3212.277) [-3207.008] -- 0:04:06 217000 -- (-3208.964) (-3214.302) (-3204.661) [-3205.985] * [-3207.291] (-3204.061) (-3213.658) (-3214.525) -- 0:04:05 217500 -- (-3207.865) (-3212.059) [-3205.762] (-3211.402) * (-3206.749) [-3208.565] (-3209.103) (-3211.699) -- 0:04:04 218000 -- [-3214.833] (-3217.204) (-3210.980) (-3212.420) * (-3204.803) [-3206.814] (-3210.391) (-3212.056) -- 0:04:03 218500 -- (-3218.207) (-3210.075) [-3206.795] (-3205.582) * (-3212.451) (-3216.535) (-3206.187) [-3213.350] -- 0:04:03 219000 -- (-3216.358) (-3205.203) (-3205.575) [-3207.555] * (-3209.387) (-3208.116) [-3210.131] (-3216.158) -- 0:04:02 219500 -- [-3206.958] (-3211.511) (-3206.953) (-3208.635) * (-3208.208) [-3207.441] (-3208.320) (-3209.238) -- 0:04:05 220000 -- (-3211.958) (-3208.038) (-3211.050) [-3203.788] * (-3204.329) [-3202.114] (-3209.265) (-3207.400) -- 0:04:04 Average standard deviation of split frequencies: 0.008545 220500 -- (-3210.414) [-3207.475] (-3213.775) (-3205.762) * (-3205.858) (-3206.389) (-3212.137) [-3202.255] -- 0:04:03 221000 -- [-3217.339] (-3206.360) (-3208.137) (-3205.431) * [-3204.746] (-3209.614) (-3208.429) (-3207.651) -- 0:04:03 221500 -- (-3209.651) (-3206.408) (-3211.670) [-3207.668] * (-3208.560) (-3206.342) (-3210.943) [-3203.549] -- 0:04:02 222000 -- [-3205.262] (-3213.651) (-3206.116) (-3211.752) * (-3206.087) (-3210.059) (-3206.748) [-3203.658] -- 0:04:01 222500 -- [-3204.305] (-3210.971) (-3212.027) (-3206.944) * (-3207.677) (-3206.832) [-3206.428] (-3213.187) -- 0:04:01 223000 -- (-3205.390) (-3209.805) (-3208.224) [-3209.018] * (-3223.574) (-3211.207) [-3205.624] (-3215.890) -- 0:04:03 223500 -- (-3208.749) [-3211.693] (-3208.924) (-3206.341) * [-3204.464] (-3208.393) (-3203.622) (-3206.400) -- 0:04:03 224000 -- (-3209.166) (-3206.101) [-3206.277] (-3209.550) * (-3208.856) (-3206.271) [-3203.012] (-3206.142) -- 0:04:02 224500 -- (-3209.541) (-3212.584) (-3210.108) [-3207.354] * [-3209.893] (-3204.986) (-3208.943) (-3206.417) -- 0:04:01 225000 -- (-3206.992) (-3204.299) (-3208.485) [-3203.826] * (-3210.654) (-3208.575) (-3207.537) [-3206.445] -- 0:04:01 Average standard deviation of split frequencies: 0.009386 225500 -- (-3211.347) (-3206.426) (-3208.719) [-3203.911] * [-3210.076] (-3211.108) (-3206.719) (-3208.883) -- 0:04:00 226000 -- (-3208.094) (-3208.817) (-3206.203) [-3208.491] * (-3210.480) [-3207.155] (-3211.568) (-3205.340) -- 0:04:03 226500 -- (-3207.620) (-3207.800) (-3208.138) [-3205.469] * (-3215.162) [-3212.155] (-3212.546) (-3205.627) -- 0:04:02 227000 -- (-3204.125) (-3211.094) (-3210.494) [-3205.168] * (-3211.366) (-3210.368) (-3208.432) [-3209.161] -- 0:04:01 227500 -- (-3205.060) (-3215.292) [-3209.763] (-3207.162) * [-3208.895] (-3210.952) (-3208.673) (-3211.647) -- 0:04:01 228000 -- [-3210.539] (-3210.399) (-3207.321) (-3207.342) * (-3203.905) [-3206.270] (-3208.232) (-3209.365) -- 0:04:00 228500 -- (-3213.184) (-3213.670) [-3205.090] (-3208.591) * (-3207.248) (-3203.259) [-3208.675] (-3214.737) -- 0:03:59 229000 -- [-3210.921] (-3205.284) (-3209.420) (-3208.769) * (-3208.702) (-3208.335) (-3207.333) [-3205.830] -- 0:04:02 229500 -- (-3207.079) (-3208.520) (-3209.619) [-3205.521] * (-3211.751) (-3208.959) (-3208.363) [-3204.833] -- 0:04:01 230000 -- [-3207.873] (-3209.153) (-3207.996) (-3206.587) * (-3209.019) (-3207.027) [-3203.834] (-3203.442) -- 0:04:01 Average standard deviation of split frequencies: 0.011240 230500 -- [-3203.264] (-3210.013) (-3205.804) (-3209.953) * (-3205.710) (-3205.853) [-3207.390] (-3213.930) -- 0:04:00 231000 -- (-3203.760) (-3210.063) [-3208.069] (-3213.242) * (-3209.647) (-3206.251) (-3210.464) [-3204.466] -- 0:03:59 231500 -- (-3205.703) (-3212.201) (-3217.293) [-3206.936] * (-3208.933) (-3209.184) (-3209.402) [-3212.070] -- 0:03:59 232000 -- [-3209.035] (-3208.682) (-3211.824) (-3205.622) * (-3211.062) (-3208.002) [-3207.620] (-3206.540) -- 0:03:58 232500 -- (-3210.565) [-3210.777] (-3210.164) (-3208.601) * (-3207.022) [-3202.378] (-3210.382) (-3213.027) -- 0:04:00 233000 -- (-3218.826) (-3206.419) [-3204.346] (-3211.984) * (-3208.592) [-3207.641] (-3213.806) (-3203.149) -- 0:04:00 233500 -- (-3212.814) (-3208.698) [-3206.333] (-3203.081) * [-3207.177] (-3203.283) (-3209.515) (-3222.148) -- 0:03:59 234000 -- (-3208.993) (-3207.882) (-3203.291) [-3207.498] * (-3203.070) (-3205.730) (-3202.527) [-3207.908] -- 0:03:58 234500 -- [-3206.781] (-3204.536) (-3205.783) (-3209.450) * [-3208.709] (-3212.542) (-3207.295) (-3215.165) -- 0:03:58 235000 -- (-3208.709) (-3211.052) [-3207.582] (-3213.253) * (-3205.416) [-3206.964] (-3212.098) (-3208.128) -- 0:03:57 Average standard deviation of split frequencies: 0.011985 235500 -- (-3207.835) [-3203.837] (-3211.145) (-3210.115) * [-3203.055] (-3203.852) (-3215.537) (-3206.869) -- 0:04:00 236000 -- (-3206.688) (-3207.192) [-3207.572] (-3203.418) * [-3207.346] (-3206.675) (-3222.837) (-3210.483) -- 0:03:59 236500 -- (-3213.964) (-3207.468) [-3205.657] (-3205.984) * (-3206.340) [-3213.480] (-3211.660) (-3208.063) -- 0:03:58 237000 -- (-3210.458) (-3214.849) (-3206.730) [-3215.785] * (-3209.351) [-3207.958] (-3206.102) (-3211.994) -- 0:03:58 237500 -- (-3206.970) [-3209.906] (-3209.296) (-3203.289) * [-3208.417] (-3205.298) (-3221.133) (-3218.289) -- 0:03:57 238000 -- (-3208.708) (-3210.235) (-3207.009) [-3209.567] * (-3206.101) (-3210.381) (-3209.621) [-3204.868] -- 0:03:56 238500 -- (-3209.087) [-3210.753] (-3206.099) (-3208.114) * (-3209.380) (-3205.485) (-3207.741) [-3205.782] -- 0:03:56 239000 -- (-3203.375) (-3210.742) (-3210.735) [-3205.286] * (-3215.590) (-3210.219) [-3208.555] (-3208.890) -- 0:03:58 239500 -- (-3212.099) (-3203.903) [-3209.652] (-3206.305) * (-3211.967) [-3210.076] (-3212.175) (-3212.266) -- 0:03:58 240000 -- (-3211.939) [-3204.260] (-3211.845) (-3209.476) * (-3210.709) (-3208.565) (-3210.515) [-3209.354] -- 0:03:57 Average standard deviation of split frequencies: 0.015670 240500 -- [-3208.525] (-3207.446) (-3209.762) (-3208.848) * (-3211.924) (-3211.356) (-3208.689) [-3212.642] -- 0:03:56 241000 -- [-3204.467] (-3208.633) (-3208.137) (-3207.774) * (-3209.037) [-3204.680] (-3208.973) (-3203.447) -- 0:03:56 241500 -- (-3212.417) [-3204.749] (-3208.601) (-3208.720) * (-3206.723) (-3210.006) (-3205.331) [-3207.146] -- 0:03:55 242000 -- [-3212.113] (-3205.948) (-3213.059) (-3211.184) * [-3213.915] (-3213.249) (-3212.242) (-3206.292) -- 0:03:58 242500 -- [-3200.577] (-3215.631) (-3208.432) (-3203.925) * [-3205.738] (-3206.478) (-3215.463) (-3208.604) -- 0:03:57 243000 -- (-3207.140) [-3204.341] (-3207.806) (-3208.763) * (-3206.708) (-3205.990) [-3213.875] (-3213.116) -- 0:03:56 243500 -- [-3206.765] (-3206.480) (-3208.400) (-3207.546) * (-3205.300) [-3204.264] (-3212.199) (-3216.350) -- 0:03:56 244000 -- (-3210.954) [-3205.332] (-3207.939) (-3208.338) * (-3207.642) [-3205.126] (-3207.686) (-3214.393) -- 0:03:55 244500 -- (-3204.525) (-3204.940) [-3205.340] (-3207.942) * [-3208.152] (-3204.471) (-3206.961) (-3222.822) -- 0:03:54 245000 -- (-3207.652) (-3211.560) [-3204.916] (-3206.649) * [-3209.592] (-3209.711) (-3210.222) (-3211.848) -- 0:03:54 Average standard deviation of split frequencies: 0.015330 245500 -- (-3208.365) [-3204.133] (-3202.970) (-3205.119) * (-3209.001) (-3216.545) [-3208.612] (-3211.469) -- 0:03:56 246000 -- (-3208.139) (-3202.974) (-3211.165) [-3207.418] * [-3215.529] (-3215.619) (-3206.669) (-3212.810) -- 0:03:56 246500 -- (-3211.175) (-3204.940) [-3205.141] (-3209.703) * (-3209.787) (-3217.277) [-3207.728] (-3207.856) -- 0:03:55 247000 -- (-3210.815) (-3209.310) (-3204.358) [-3209.362] * (-3207.573) (-3207.927) (-3206.818) [-3209.444] -- 0:03:54 247500 -- (-3208.389) (-3209.318) [-3204.624] (-3214.952) * (-3210.217) [-3204.618] (-3208.921) (-3212.700) -- 0:03:54 248000 -- (-3204.123) (-3212.734) (-3208.629) [-3206.483] * [-3209.437] (-3207.626) (-3209.721) (-3206.748) -- 0:03:53 248500 -- (-3207.230) (-3216.940) (-3208.503) [-3207.712] * (-3212.027) (-3209.554) [-3209.490] (-3209.465) -- 0:03:55 249000 -- (-3206.687) (-3211.299) [-3202.932] (-3210.023) * (-3209.317) (-3204.438) (-3204.003) [-3207.058] -- 0:03:55 249500 -- (-3207.867) (-3213.089) (-3202.743) [-3217.372] * (-3214.218) (-3203.977) [-3207.693] (-3209.473) -- 0:03:54 250000 -- (-3204.401) (-3213.411) [-3202.174] (-3212.465) * (-3203.916) (-3208.270) (-3208.162) [-3206.954] -- 0:03:54 Average standard deviation of split frequencies: 0.015985 250500 -- (-3208.074) (-3214.378) [-3205.929] (-3206.134) * (-3209.378) [-3209.708] (-3210.544) (-3206.350) -- 0:03:53 251000 -- [-3204.366] (-3208.604) (-3212.510) (-3207.751) * (-3210.289) (-3211.288) [-3203.778] (-3211.061) -- 0:03:52 251500 -- (-3210.299) [-3213.183] (-3215.111) (-3208.074) * [-3211.521] (-3211.219) (-3203.733) (-3211.224) -- 0:03:52 252000 -- (-3206.778) [-3208.126] (-3208.817) (-3212.485) * (-3208.593) (-3209.245) (-3203.212) [-3206.846] -- 0:03:54 252500 -- (-3207.403) [-3209.143] (-3212.865) (-3211.169) * (-3214.879) (-3212.469) [-3204.657] (-3207.768) -- 0:03:53 253000 -- [-3206.180] (-3204.227) (-3213.698) (-3210.827) * (-3210.732) (-3207.681) (-3206.359) [-3204.460] -- 0:03:53 253500 -- (-3211.512) (-3208.262) [-3206.487] (-3208.335) * [-3206.122] (-3208.590) (-3207.385) (-3208.921) -- 0:03:52 254000 -- [-3203.675] (-3207.021) (-3205.449) (-3202.834) * (-3211.860) [-3203.311] (-3205.198) (-3206.282) -- 0:03:52 254500 -- [-3205.717] (-3204.512) (-3206.737) (-3210.740) * (-3207.802) [-3204.742] (-3206.229) (-3205.466) -- 0:03:51 255000 -- (-3208.859) [-3204.024] (-3207.100) (-3207.319) * (-3219.608) [-3202.227] (-3209.456) (-3213.997) -- 0:03:53 Average standard deviation of split frequencies: 0.016573 255500 -- (-3207.975) (-3205.807) [-3211.049] (-3206.704) * (-3211.918) (-3204.728) (-3205.864) [-3211.079] -- 0:03:53 256000 -- [-3206.000] (-3208.827) (-3209.566) (-3214.186) * [-3209.946] (-3212.885) (-3206.403) (-3204.723) -- 0:03:52 256500 -- (-3207.443) (-3203.467) (-3205.707) [-3211.362] * (-3209.465) (-3205.307) [-3204.196] (-3207.979) -- 0:03:51 257000 -- (-3207.095) (-3205.733) (-3210.477) [-3212.945] * (-3214.888) (-3212.658) [-3211.108] (-3206.413) -- 0:03:51 257500 -- (-3204.371) [-3204.470] (-3204.815) (-3209.608) * (-3212.878) (-3214.674) (-3205.413) [-3205.248] -- 0:03:50 258000 -- (-3207.894) [-3204.572] (-3202.633) (-3207.141) * (-3209.199) (-3209.130) (-3219.979) [-3210.898] -- 0:03:52 258500 -- (-3209.948) (-3209.102) [-3217.446] (-3208.099) * [-3203.602] (-3207.727) (-3208.171) (-3210.623) -- 0:03:52 259000 -- (-3211.795) (-3208.363) (-3213.795) [-3208.368] * (-3209.032) [-3203.205] (-3204.737) (-3213.977) -- 0:03:51 259500 -- (-3206.307) (-3211.746) [-3208.614] (-3210.849) * (-3217.773) (-3211.254) (-3208.846) [-3208.583] -- 0:03:51 260000 -- (-3208.147) (-3209.315) (-3213.228) [-3208.591] * (-3208.196) (-3211.557) [-3218.554] (-3208.198) -- 0:03:50 Average standard deviation of split frequencies: 0.018085 260500 -- (-3209.229) (-3211.104) [-3203.901] (-3202.596) * [-3207.289] (-3211.754) (-3208.700) (-3206.784) -- 0:03:49 261000 -- (-3207.262) (-3204.793) (-3206.064) [-3209.906] * (-3212.116) (-3211.128) [-3207.863] (-3207.318) -- 0:03:49 261500 -- (-3213.835) [-3205.763] (-3208.162) (-3211.144) * [-3205.759] (-3209.781) (-3215.252) (-3208.250) -- 0:03:51 262000 -- (-3207.809) [-3206.983] (-3211.513) (-3213.315) * (-3219.270) (-3204.824) [-3208.232] (-3211.717) -- 0:03:50 262500 -- (-3217.860) (-3210.639) [-3212.003] (-3213.138) * [-3204.434] (-3205.439) (-3211.170) (-3205.222) -- 0:03:50 263000 -- (-3210.568) (-3213.290) [-3210.893] (-3214.960) * (-3205.867) (-3211.398) [-3210.190] (-3213.599) -- 0:03:49 263500 -- (-3206.723) (-3212.041) [-3212.414] (-3219.231) * (-3208.444) [-3203.632] (-3206.462) (-3206.165) -- 0:03:49 264000 -- [-3206.837] (-3205.673) (-3211.859) (-3211.380) * (-3204.861) (-3207.708) [-3204.216] (-3209.589) -- 0:03:48 264500 -- (-3206.611) (-3206.980) (-3209.505) [-3212.086] * (-3206.773) (-3211.672) (-3207.288) [-3212.459] -- 0:03:50 265000 -- (-3209.658) (-3214.673) (-3210.414) [-3208.376] * [-3204.702] (-3206.632) (-3202.445) (-3209.490) -- 0:03:50 Average standard deviation of split frequencies: 0.015950 265500 -- (-3203.625) (-3206.959) (-3207.255) [-3207.014] * [-3205.017] (-3212.202) (-3207.648) (-3208.161) -- 0:03:49 266000 -- (-3202.277) (-3212.319) (-3207.350) [-3209.379] * [-3205.434] (-3206.073) (-3206.208) (-3208.202) -- 0:03:49 266500 -- (-3204.474) (-3212.367) [-3204.631] (-3208.332) * (-3207.905) [-3209.528] (-3208.741) (-3205.333) -- 0:03:48 267000 -- (-3205.977) (-3210.300) [-3205.391] (-3204.978) * (-3209.782) [-3209.622] (-3211.908) (-3215.038) -- 0:03:47 267500 -- (-3207.250) (-3215.134) (-3206.625) [-3211.352] * (-3205.580) (-3210.056) [-3204.681] (-3212.036) -- 0:03:47 268000 -- (-3207.904) (-3210.275) (-3208.891) [-3207.841] * (-3211.557) (-3205.496) (-3210.417) [-3209.704] -- 0:03:49 268500 -- (-3209.294) (-3210.933) (-3208.284) [-3211.989] * (-3209.492) (-3206.497) (-3204.207) [-3206.840] -- 0:03:48 269000 -- (-3210.414) (-3212.075) [-3206.564] (-3210.291) * (-3209.219) (-3207.463) [-3201.255] (-3204.885) -- 0:03:48 269500 -- (-3215.914) [-3209.086] (-3207.332) (-3207.426) * [-3208.561] (-3209.196) (-3208.895) (-3211.409) -- 0:03:47 270000 -- (-3215.263) (-3212.818) [-3209.908] (-3211.232) * (-3207.850) (-3209.936) (-3206.354) [-3207.411] -- 0:03:47 Average standard deviation of split frequencies: 0.015675 270500 -- (-3216.071) [-3206.407] (-3209.790) (-3205.694) * (-3205.525) [-3212.126] (-3208.886) (-3215.682) -- 0:03:46 271000 -- (-3212.543) (-3206.718) [-3203.284] (-3209.644) * (-3206.858) (-3209.326) [-3218.453] (-3211.805) -- 0:03:48 271500 -- [-3207.167] (-3211.285) (-3207.760) (-3212.264) * [-3204.019] (-3208.585) (-3213.274) (-3211.642) -- 0:03:48 272000 -- (-3205.012) (-3207.616) (-3215.231) [-3211.163] * (-3203.800) (-3210.387) [-3210.742] (-3209.909) -- 0:03:47 272500 -- (-3207.121) (-3211.544) (-3206.907) [-3205.271] * (-3206.695) [-3208.630] (-3215.223) (-3209.672) -- 0:03:46 273000 -- (-3211.947) (-3205.317) [-3204.901] (-3203.335) * [-3207.350] (-3213.379) (-3209.230) (-3207.688) -- 0:03:46 273500 -- (-3202.287) (-3206.799) (-3208.260) [-3208.934] * (-3209.918) (-3206.000) (-3210.414) [-3206.085] -- 0:03:45 274000 -- [-3207.348] (-3207.617) (-3214.923) (-3209.286) * (-3205.398) [-3206.202] (-3213.009) (-3210.020) -- 0:03:45 274500 -- (-3209.243) [-3206.924] (-3210.544) (-3209.710) * (-3207.060) [-3203.933] (-3208.178) (-3212.717) -- 0:03:47 275000 -- (-3205.535) (-3206.715) [-3209.913] (-3207.046) * [-3213.090] (-3213.388) (-3204.566) (-3206.045) -- 0:03:46 Average standard deviation of split frequencies: 0.017934 275500 -- (-3211.023) (-3200.872) [-3209.655] (-3209.707) * (-3216.210) (-3213.072) (-3210.109) [-3211.060] -- 0:03:46 276000 -- [-3204.593] (-3210.944) (-3210.475) (-3212.741) * (-3210.564) [-3209.386] (-3209.597) (-3208.054) -- 0:03:45 276500 -- (-3203.309) (-3206.704) (-3208.976) [-3206.581] * (-3210.609) [-3209.104] (-3211.970) (-3207.238) -- 0:03:45 277000 -- (-3211.682) [-3203.898] (-3206.941) (-3213.451) * (-3212.341) (-3206.298) [-3204.757] (-3208.618) -- 0:03:44 277500 -- (-3210.226) (-3211.990) (-3206.892) [-3210.259] * (-3209.808) [-3204.719] (-3210.123) (-3207.854) -- 0:03:46 278000 -- (-3206.309) [-3208.278] (-3213.431) (-3212.126) * (-3205.563) [-3206.922] (-3207.601) (-3209.881) -- 0:03:45 278500 -- [-3209.248] (-3208.565) (-3207.308) (-3208.109) * (-3208.553) [-3207.188] (-3207.925) (-3204.422) -- 0:03:45 279000 -- (-3208.393) [-3208.630] (-3208.948) (-3207.720) * (-3204.034) (-3207.342) [-3203.424] (-3216.823) -- 0:03:44 279500 -- (-3208.495) (-3210.274) [-3213.120] (-3207.584) * [-3206.681] (-3206.737) (-3205.787) (-3219.092) -- 0:03:44 280000 -- [-3204.939] (-3208.780) (-3209.644) (-3204.781) * (-3206.283) [-3212.319] (-3207.400) (-3209.062) -- 0:03:43 Average standard deviation of split frequencies: 0.016796 280500 -- [-3209.705] (-3202.053) (-3212.827) (-3209.576) * [-3214.994] (-3208.795) (-3207.052) (-3212.585) -- 0:03:45 281000 -- (-3206.225) [-3206.352] (-3206.786) (-3210.206) * [-3206.115] (-3212.807) (-3208.065) (-3205.848) -- 0:03:45 281500 -- (-3206.967) [-3209.304] (-3211.434) (-3215.705) * (-3208.521) [-3203.744] (-3205.611) (-3205.890) -- 0:03:44 282000 -- (-3212.005) [-3207.844] (-3208.241) (-3212.544) * (-3211.314) (-3211.033) [-3204.405] (-3207.883) -- 0:03:44 282500 -- [-3210.672] (-3204.758) (-3210.876) (-3212.050) * [-3204.865] (-3206.724) (-3206.295) (-3214.904) -- 0:03:43 283000 -- [-3207.476] (-3205.208) (-3206.986) (-3207.674) * (-3208.943) [-3208.331] (-3211.339) (-3209.618) -- 0:03:42 283500 -- (-3201.587) (-3206.945) [-3210.447] (-3213.326) * (-3204.919) [-3207.596] (-3209.706) (-3211.724) -- 0:03:42 284000 -- (-3206.284) (-3207.394) (-3207.036) [-3209.162] * [-3209.926] (-3207.481) (-3208.083) (-3205.272) -- 0:03:44 284500 -- (-3210.778) (-3212.126) (-3204.439) [-3208.067] * (-3215.337) [-3208.174] (-3204.806) (-3208.207) -- 0:03:43 285000 -- (-3205.982) (-3211.900) [-3209.284] (-3215.118) * (-3208.377) (-3209.671) (-3204.986) [-3207.376] -- 0:03:43 Average standard deviation of split frequencies: 0.018131 285500 -- (-3215.126) (-3205.895) [-3208.185] (-3210.896) * (-3211.620) [-3214.195] (-3206.657) (-3208.815) -- 0:03:42 286000 -- (-3214.320) [-3202.746] (-3204.137) (-3207.934) * (-3205.863) (-3213.453) [-3209.783] (-3210.809) -- 0:03:42 286500 -- [-3203.613] (-3214.726) (-3212.026) (-3211.251) * (-3205.974) (-3207.140) [-3205.532] (-3206.825) -- 0:03:41 287000 -- (-3210.226) (-3206.785) [-3204.400] (-3214.028) * (-3209.747) [-3203.009] (-3201.861) (-3216.136) -- 0:03:43 287500 -- (-3215.744) (-3206.128) (-3204.167) [-3211.620] * (-3209.831) [-3205.409] (-3212.832) (-3207.848) -- 0:03:43 288000 -- (-3208.697) [-3205.845] (-3203.377) (-3205.262) * (-3214.968) [-3209.278] (-3206.815) (-3213.427) -- 0:03:42 288500 -- [-3206.487] (-3217.013) (-3209.611) (-3211.468) * (-3205.478) (-3216.010) (-3204.287) [-3208.209] -- 0:03:41 289000 -- (-3211.080) (-3206.204) [-3209.497] (-3208.545) * (-3207.001) (-3216.141) (-3209.046) [-3209.798] -- 0:03:41 289500 -- (-3206.600) (-3206.422) (-3207.457) [-3207.443] * [-3205.332] (-3206.146) (-3210.446) (-3211.750) -- 0:03:40 290000 -- (-3204.054) (-3212.449) (-3208.873) [-3209.093] * (-3202.299) [-3203.834] (-3209.508) (-3207.775) -- 0:03:40 Average standard deviation of split frequencies: 0.018651 290500 -- (-3206.193) [-3208.096] (-3211.231) (-3205.700) * (-3209.147) (-3208.153) (-3210.272) [-3212.179] -- 0:03:42 291000 -- (-3214.641) (-3206.904) [-3205.058] (-3207.866) * (-3205.433) (-3212.213) [-3208.526] (-3205.956) -- 0:03:41 291500 -- (-3216.302) [-3212.322] (-3214.295) (-3213.179) * (-3208.404) [-3209.101] (-3208.978) (-3208.854) -- 0:03:41 292000 -- (-3211.476) (-3207.779) [-3213.256] (-3208.902) * (-3210.798) (-3214.106) (-3208.118) [-3211.159] -- 0:03:40 292500 -- (-3204.297) (-3208.358) (-3214.846) [-3205.076] * (-3207.711) [-3204.605] (-3209.574) (-3207.674) -- 0:03:40 293000 -- (-3215.134) (-3211.256) (-3207.512) [-3210.791] * (-3209.207) (-3209.977) [-3205.895] (-3205.646) -- 0:03:39 293500 -- (-3215.055) (-3208.276) (-3211.181) [-3208.048] * [-3203.657] (-3202.293) (-3220.516) (-3204.304) -- 0:03:41 294000 -- (-3212.880) (-3208.309) (-3209.180) [-3202.836] * (-3208.990) [-3207.152] (-3212.269) (-3207.361) -- 0:03:40 294500 -- (-3217.939) (-3208.308) [-3207.972] (-3208.099) * (-3213.609) (-3206.212) (-3209.505) [-3205.453] -- 0:03:40 295000 -- [-3205.658] (-3209.221) (-3206.979) (-3207.140) * (-3209.263) (-3207.220) (-3205.551) [-3206.293] -- 0:03:39 Average standard deviation of split frequencies: 0.018315 295500 -- (-3204.813) (-3213.671) [-3211.632] (-3212.807) * (-3210.388) (-3205.297) [-3212.763] (-3203.998) -- 0:03:39 296000 -- [-3206.727] (-3212.991) (-3208.630) (-3210.056) * (-3204.081) [-3206.305] (-3208.181) (-3204.854) -- 0:03:38 296500 -- (-3212.434) [-3206.851] (-3209.147) (-3210.133) * (-3209.163) (-3207.767) [-3205.794] (-3205.377) -- 0:03:38 297000 -- (-3207.216) (-3210.133) [-3205.728] (-3213.439) * (-3212.457) (-3209.305) [-3204.314] (-3214.473) -- 0:03:40 297500 -- (-3213.622) (-3206.570) (-3207.976) [-3208.240] * (-3210.306) (-3210.817) (-3209.099) [-3205.821] -- 0:03:39 298000 -- (-3208.369) (-3217.729) [-3208.851] (-3211.327) * [-3211.018] (-3212.127) (-3211.291) (-3209.213) -- 0:03:39 298500 -- (-3210.554) (-3213.368) [-3205.527] (-3205.743) * (-3209.297) [-3209.083] (-3210.480) (-3211.597) -- 0:03:38 299000 -- (-3206.432) [-3207.796] (-3207.538) (-3213.067) * [-3204.909] (-3209.573) (-3209.590) (-3208.464) -- 0:03:38 299500 -- (-3206.598) (-3213.449) [-3204.147] (-3205.952) * (-3210.735) (-3215.548) [-3206.059] (-3207.609) -- 0:03:37 300000 -- (-3203.638) (-3217.700) [-3204.354] (-3206.894) * (-3207.291) (-3208.154) [-3203.889] (-3210.440) -- 0:03:39 Average standard deviation of split frequencies: 0.018030 300500 -- (-3206.721) (-3213.779) [-3207.557] (-3208.091) * (-3210.210) (-3211.687) [-3205.497] (-3214.846) -- 0:03:38 301000 -- (-3207.091) (-3218.823) (-3209.798) [-3208.661] * (-3209.324) (-3213.284) (-3207.998) [-3211.031] -- 0:03:38 301500 -- (-3214.541) (-3217.693) [-3209.033] (-3210.875) * (-3211.076) (-3203.695) [-3206.212] (-3214.839) -- 0:03:37 302000 -- (-3215.172) (-3214.703) (-3210.864) [-3210.780] * (-3209.117) (-3207.423) (-3207.770) [-3210.363] -- 0:03:37 302500 -- (-3208.721) (-3211.605) (-3203.819) [-3214.079] * [-3206.184] (-3206.081) (-3205.699) (-3209.668) -- 0:03:36 303000 -- (-3204.180) (-3211.797) [-3205.513] (-3208.863) * (-3209.806) (-3201.551) [-3211.588] (-3207.931) -- 0:03:38 303500 -- (-3208.615) [-3206.337] (-3215.484) (-3209.376) * (-3203.134) (-3203.868) [-3210.544] (-3217.357) -- 0:03:38 304000 -- [-3209.101] (-3205.971) (-3209.344) (-3208.803) * (-3207.791) (-3208.146) (-3208.618) [-3210.832] -- 0:03:37 304500 -- [-3207.033] (-3210.928) (-3203.119) (-3207.144) * (-3208.113) (-3205.000) (-3204.677) [-3209.538] -- 0:03:36 305000 -- [-3205.448] (-3218.897) (-3209.207) (-3202.886) * (-3204.184) (-3212.818) (-3207.944) [-3212.151] -- 0:03:36 Average standard deviation of split frequencies: 0.016176 305500 -- (-3206.589) (-3206.465) [-3209.854] (-3205.287) * (-3204.762) (-3207.724) (-3206.880) [-3210.838] -- 0:03:35 306000 -- [-3205.273] (-3207.715) (-3208.284) (-3206.208) * (-3209.089) (-3212.551) (-3207.472) [-3210.478] -- 0:03:35 306500 -- (-3202.664) (-3210.064) [-3205.275] (-3205.975) * (-3207.739) (-3211.962) (-3206.946) [-3209.956] -- 0:03:37 307000 -- [-3210.246] (-3203.410) (-3202.627) (-3214.852) * (-3210.061) (-3204.111) [-3209.797] (-3209.550) -- 0:03:36 307500 -- (-3205.447) (-3209.382) (-3206.879) [-3210.893] * (-3206.412) [-3206.200] (-3203.793) (-3209.889) -- 0:03:36 308000 -- (-3211.499) [-3211.174] (-3207.653) (-3202.559) * [-3205.894] (-3212.067) (-3207.238) (-3203.803) -- 0:03:35 308500 -- (-3213.039) (-3216.570) (-3209.829) [-3213.768] * (-3215.265) (-3203.929) [-3204.318] (-3210.501) -- 0:03:35 309000 -- (-3207.018) (-3213.807) [-3207.073] (-3213.459) * (-3208.864) (-3207.828) (-3206.477) [-3208.311] -- 0:03:34 309500 -- (-3205.922) (-3206.364) (-3205.775) [-3200.947] * (-3214.461) [-3212.349] (-3207.684) (-3211.573) -- 0:03:36 310000 -- [-3209.613] (-3207.394) (-3211.740) (-3206.307) * [-3207.756] (-3205.475) (-3207.297) (-3215.512) -- 0:03:35 Average standard deviation of split frequencies: 0.018209 310500 -- (-3203.795) [-3208.459] (-3205.476) (-3205.329) * [-3212.138] (-3211.582) (-3206.066) (-3204.019) -- 0:03:35 311000 -- (-3205.083) [-3210.921] (-3211.491) (-3212.112) * (-3203.373) (-3210.965) [-3205.289] (-3205.332) -- 0:03:34 311500 -- (-3205.149) (-3210.628) (-3206.770) [-3208.845] * (-3210.026) (-3206.449) (-3207.808) [-3207.523] -- 0:03:34 312000 -- (-3203.573) (-3205.968) [-3204.083] (-3207.598) * (-3208.200) [-3203.033] (-3204.821) (-3209.060) -- 0:03:33 312500 -- (-3207.987) (-3204.763) (-3210.791) [-3205.385] * (-3208.303) (-3207.361) [-3204.144] (-3208.838) -- 0:03:33 313000 -- (-3206.624) [-3217.506] (-3208.608) (-3208.406) * [-3202.599] (-3207.168) (-3204.403) (-3207.083) -- 0:03:35 313500 -- (-3205.338) (-3208.092) (-3209.525) [-3206.746] * [-3208.784] (-3208.110) (-3207.208) (-3212.113) -- 0:03:34 314000 -- (-3212.525) (-3213.869) [-3208.993] (-3212.170) * [-3208.936] (-3207.044) (-3207.332) (-3208.593) -- 0:03:34 314500 -- (-3206.955) (-3205.881) (-3207.851) [-3208.432] * (-3202.770) (-3213.947) (-3206.784) [-3209.169] -- 0:03:33 315000 -- (-3211.790) [-3202.029] (-3208.464) (-3210.276) * (-3210.675) (-3204.685) (-3204.877) [-3202.939] -- 0:03:33 Average standard deviation of split frequencies: 0.016410 315500 -- (-3208.338) (-3205.872) (-3208.487) [-3205.035] * (-3207.617) (-3205.106) [-3212.502] (-3204.020) -- 0:03:32 316000 -- (-3207.236) (-3209.587) (-3209.217) [-3206.148] * (-3211.101) (-3210.593) (-3205.533) [-3205.999] -- 0:03:34 316500 -- (-3212.102) (-3206.496) (-3211.321) [-3206.857] * (-3205.455) (-3207.400) [-3208.067] (-3206.130) -- 0:03:33 317000 -- (-3203.387) (-3209.277) [-3208.632] (-3207.188) * (-3209.504) (-3208.885) (-3204.498) [-3208.691] -- 0:03:33 317500 -- (-3217.203) (-3204.567) (-3208.209) [-3204.422] * (-3210.939) [-3203.890] (-3206.777) (-3214.369) -- 0:03:32 318000 -- (-3214.759) (-3209.843) (-3214.907) [-3207.066] * [-3207.937] (-3209.782) (-3206.658) (-3209.377) -- 0:03:32 318500 -- (-3212.913) (-3215.158) [-3203.380] (-3210.003) * (-3203.361) (-3208.902) (-3205.087) [-3209.578] -- 0:03:31 319000 -- [-3208.871] (-3214.542) (-3202.119) (-3218.460) * [-3206.706] (-3205.757) (-3204.020) (-3214.332) -- 0:03:31 319500 -- (-3211.002) [-3211.635] (-3210.026) (-3216.078) * [-3204.970] (-3204.406) (-3205.651) (-3216.507) -- 0:03:32 320000 -- (-3203.598) [-3203.568] (-3202.493) (-3212.324) * (-3206.928) (-3221.984) [-3210.955] (-3208.040) -- 0:03:32 Average standard deviation of split frequencies: 0.013231 320500 -- (-3209.301) [-3210.846] (-3209.683) (-3212.569) * [-3203.463] (-3211.728) (-3212.375) (-3205.380) -- 0:03:32 321000 -- (-3211.577) [-3211.433] (-3209.847) (-3208.238) * [-3204.526] (-3211.862) (-3213.120) (-3204.172) -- 0:03:31 321500 -- (-3208.563) (-3207.438) [-3208.364] (-3210.269) * (-3206.197) (-3216.974) (-3211.744) [-3208.701] -- 0:03:31 322000 -- (-3215.298) [-3211.301] (-3210.505) (-3209.721) * (-3203.342) (-3208.349) (-3211.371) [-3207.443] -- 0:03:30 322500 -- (-3207.709) [-3207.224] (-3214.034) (-3211.612) * (-3208.347) (-3209.091) [-3204.756] (-3209.321) -- 0:03:32 323000 -- [-3207.948] (-3204.631) (-3210.683) (-3208.808) * (-3206.394) (-3216.782) (-3208.111) [-3203.868] -- 0:03:31 323500 -- [-3206.934] (-3211.835) (-3210.380) (-3207.797) * (-3207.934) (-3215.200) [-3202.127] (-3206.608) -- 0:03:31 324000 -- [-3203.911] (-3206.860) (-3207.288) (-3207.801) * (-3209.286) (-3206.596) [-3200.042] (-3209.592) -- 0:03:30 324500 -- (-3207.698) (-3206.418) (-3209.252) [-3203.509] * (-3212.602) (-3206.157) [-3203.787] (-3210.500) -- 0:03:30 325000 -- (-3211.248) (-3205.832) [-3206.882] (-3205.098) * (-3209.347) (-3211.909) (-3210.696) [-3203.841] -- 0:03:29 Average standard deviation of split frequencies: 0.013014 325500 -- (-3208.082) (-3209.643) (-3209.188) [-3205.160] * [-3209.858] (-3217.254) (-3211.798) (-3204.688) -- 0:03:29 326000 -- (-3209.166) (-3208.278) (-3204.171) [-3206.399] * (-3205.224) (-3214.119) (-3208.311) [-3205.798] -- 0:03:30 326500 -- (-3212.063) (-3210.928) [-3205.656] (-3206.174) * [-3206.053] (-3211.196) (-3217.799) (-3209.601) -- 0:03:30 327000 -- (-3216.063) (-3211.830) (-3214.776) [-3205.198] * (-3215.389) (-3212.718) (-3208.950) [-3210.314] -- 0:03:29 327500 -- [-3215.235] (-3203.031) (-3220.826) (-3206.561) * (-3205.739) [-3214.874] (-3205.736) (-3209.392) -- 0:03:29 328000 -- (-3213.803) (-3216.482) (-3209.071) [-3206.398] * (-3209.750) (-3213.642) [-3205.911] (-3201.776) -- 0:03:28 328500 -- [-3208.759] (-3212.216) (-3204.705) (-3211.203) * (-3211.944) (-3208.333) (-3205.656) [-3208.852] -- 0:03:28 329000 -- (-3214.467) [-3204.007] (-3205.501) (-3208.148) * [-3204.318] (-3224.850) (-3207.666) (-3205.229) -- 0:03:30 329500 -- (-3208.751) (-3205.734) [-3208.125] (-3212.089) * (-3210.469) (-3213.678) (-3208.642) [-3205.184] -- 0:03:29 330000 -- (-3207.648) (-3205.613) [-3206.355] (-3210.821) * (-3206.421) [-3209.336] (-3203.516) (-3211.623) -- 0:03:29 Average standard deviation of split frequencies: 0.013543 330500 -- (-3210.006) (-3212.073) (-3211.723) [-3204.991] * [-3213.320] (-3212.424) (-3207.250) (-3208.307) -- 0:03:28 331000 -- (-3204.632) (-3208.976) (-3208.649) [-3205.737] * (-3208.726) (-3214.190) [-3206.399] (-3208.688) -- 0:03:28 331500 -- (-3210.865) [-3212.158] (-3211.809) (-3204.763) * [-3205.478] (-3205.359) (-3212.246) (-3212.180) -- 0:03:27 332000 -- (-3211.296) (-3205.147) [-3221.450] (-3211.726) * (-3207.883) [-3202.838] (-3208.650) (-3209.374) -- 0:03:27 332500 -- [-3203.243] (-3207.667) (-3211.706) (-3208.200) * (-3209.270) [-3204.533] (-3216.567) (-3205.086) -- 0:03:28 333000 -- (-3206.731) [-3210.023] (-3210.164) (-3209.594) * (-3206.531) [-3205.669] (-3205.653) (-3214.895) -- 0:03:28 333500 -- (-3212.006) (-3209.880) [-3211.855] (-3211.400) * (-3214.938) (-3209.924) (-3204.376) [-3204.547] -- 0:03:27 334000 -- (-3213.074) (-3209.515) (-3209.556) [-3205.718] * (-3222.399) (-3209.415) [-3207.794] (-3202.559) -- 0:03:27 334500 -- (-3214.252) [-3204.326] (-3212.193) (-3213.469) * [-3206.746] (-3214.549) (-3209.755) (-3211.806) -- 0:03:26 335000 -- (-3208.488) [-3207.258] (-3212.252) (-3207.904) * (-3206.417) (-3212.324) [-3205.273] (-3211.917) -- 0:03:26 Average standard deviation of split frequencies: 0.012627 335500 -- (-3208.490) [-3209.913] (-3209.709) (-3203.538) * (-3211.993) (-3208.582) (-3207.481) [-3210.472] -- 0:03:27 336000 -- [-3216.710] (-3208.465) (-3210.815) (-3207.747) * (-3212.079) (-3209.798) (-3212.204) [-3209.873] -- 0:03:27 336500 -- (-3203.887) [-3207.113] (-3208.109) (-3211.143) * [-3203.600] (-3204.595) (-3214.094) (-3216.733) -- 0:03:27 337000 -- [-3206.158] (-3207.657) (-3209.684) (-3208.962) * [-3207.455] (-3202.742) (-3207.687) (-3216.311) -- 0:03:26 337500 -- (-3207.501) (-3211.152) [-3205.208] (-3217.740) * (-3207.358) [-3207.163] (-3208.359) (-3211.973) -- 0:03:26 338000 -- (-3211.672) (-3213.013) [-3208.722] (-3203.603) * [-3203.381] (-3207.319) (-3206.152) (-3214.722) -- 0:03:25 338500 -- (-3213.284) (-3206.394) [-3206.085] (-3210.270) * (-3205.470) [-3205.093] (-3207.311) (-3209.838) -- 0:03:27 339000 -- (-3208.382) (-3209.650) [-3203.652] (-3208.051) * (-3203.798) (-3205.690) [-3205.174] (-3210.744) -- 0:03:26 339500 -- (-3209.305) [-3211.925] (-3209.360) (-3207.153) * (-3210.256) [-3208.368] (-3205.292) (-3211.996) -- 0:03:26 340000 -- [-3204.581] (-3217.311) (-3215.185) (-3205.710) * (-3206.102) [-3207.973] (-3205.325) (-3207.972) -- 0:03:25 Average standard deviation of split frequencies: 0.013146 340500 -- (-3205.958) (-3212.297) [-3208.666] (-3212.526) * (-3202.633) [-3208.245] (-3213.620) (-3208.209) -- 0:03:25 341000 -- [-3204.755] (-3210.387) (-3210.071) (-3209.085) * [-3205.706] (-3208.388) (-3210.553) (-3208.820) -- 0:03:24 341500 -- (-3210.190) (-3211.114) [-3208.788] (-3205.743) * (-3202.926) (-3214.100) [-3207.111] (-3206.843) -- 0:03:24 342000 -- (-3208.157) (-3205.214) [-3209.179] (-3208.517) * (-3209.054) (-3208.198) [-3203.357] (-3204.947) -- 0:03:25 342500 -- (-3208.922) [-3206.400] (-3204.877) (-3208.036) * (-3209.164) (-3212.804) (-3205.507) [-3203.876] -- 0:03:25 343000 -- (-3208.861) [-3206.556] (-3210.830) (-3216.952) * (-3204.688) [-3204.971] (-3213.515) (-3206.368) -- 0:03:24 343500 -- (-3209.831) (-3207.140) (-3208.065) [-3207.492] * (-3201.384) (-3214.498) [-3204.134] (-3214.004) -- 0:03:24 344000 -- (-3207.704) (-3205.615) [-3212.191] (-3208.697) * (-3205.707) (-3206.259) (-3208.815) [-3204.209] -- 0:03:24 344500 -- (-3209.438) (-3201.788) (-3211.237) [-3208.942] * (-3208.842) [-3206.427] (-3208.003) (-3210.243) -- 0:03:23 345000 -- (-3207.661) (-3206.854) [-3202.612] (-3203.814) * (-3207.896) (-3210.737) [-3205.518] (-3208.453) -- 0:03:25 Average standard deviation of split frequencies: 0.012262 345500 -- (-3213.641) [-3204.995] (-3206.943) (-3207.974) * (-3208.886) (-3207.386) [-3205.452] (-3209.071) -- 0:03:24 346000 -- (-3218.666) (-3214.504) [-3205.528] (-3207.681) * (-3210.391) (-3205.576) [-3207.929] (-3211.448) -- 0:03:24 346500 -- (-3211.485) (-3205.553) (-3208.202) [-3213.824] * (-3219.917) (-3208.665) [-3208.607] (-3209.042) -- 0:03:23 347000 -- (-3210.615) [-3204.690] (-3205.863) (-3212.157) * [-3208.386] (-3208.117) (-3206.735) (-3206.844) -- 0:03:23 347500 -- [-3212.922] (-3205.009) (-3208.508) (-3213.576) * (-3204.874) (-3207.948) [-3207.464] (-3212.387) -- 0:03:22 348000 -- (-3204.525) (-3214.689) [-3208.632] (-3205.203) * [-3204.222] (-3208.352) (-3212.868) (-3206.637) -- 0:03:22 348500 -- (-3207.738) [-3205.070] (-3204.631) (-3214.028) * [-3207.574] (-3216.856) (-3204.762) (-3210.380) -- 0:03:23 349000 -- (-3211.605) (-3209.650) [-3207.989] (-3210.822) * (-3208.234) [-3204.345] (-3211.973) (-3207.095) -- 0:03:23 349500 -- [-3207.578] (-3214.545) (-3211.430) (-3207.221) * (-3205.742) [-3208.568] (-3212.631) (-3206.432) -- 0:03:22 350000 -- (-3211.595) (-3211.047) [-3208.775] (-3203.565) * [-3204.406] (-3207.179) (-3209.930) (-3209.906) -- 0:03:22 Average standard deviation of split frequencies: 0.016132 350500 -- (-3211.714) [-3213.145] (-3208.349) (-3206.703) * (-3204.446) [-3208.596] (-3214.386) (-3218.390) -- 0:03:21 351000 -- [-3205.055] (-3216.601) (-3211.144) (-3211.238) * [-3203.999] (-3206.768) (-3207.653) (-3212.824) -- 0:03:21 351500 -- [-3208.664] (-3208.807) (-3207.331) (-3207.354) * (-3208.848) [-3209.604] (-3203.355) (-3211.181) -- 0:03:22 352000 -- (-3208.759) (-3206.833) [-3205.386] (-3205.802) * (-3208.425) (-3218.449) [-3205.506] (-3204.207) -- 0:03:22 352500 -- (-3213.751) (-3207.830) [-3207.233] (-3215.615) * [-3205.532] (-3207.408) (-3206.520) (-3217.252) -- 0:03:22 353000 -- (-3207.016) (-3206.325) [-3208.663] (-3215.306) * (-3205.109) (-3209.746) (-3212.398) [-3207.686] -- 0:03:21 353500 -- [-3202.937] (-3218.169) (-3212.748) (-3210.006) * [-3208.331] (-3212.536) (-3207.633) (-3210.714) -- 0:03:21 354000 -- (-3204.246) (-3208.388) (-3210.581) [-3202.085] * (-3207.248) [-3203.992] (-3206.863) (-3212.366) -- 0:03:20 354500 -- (-3206.594) (-3205.043) [-3206.712] (-3202.618) * (-3213.278) [-3205.237] (-3204.843) (-3208.997) -- 0:03:22 355000 -- (-3207.754) (-3206.826) (-3215.275) [-3201.509] * (-3212.005) [-3205.300] (-3206.880) (-3205.840) -- 0:03:21 Average standard deviation of split frequencies: 0.019200 355500 -- (-3205.939) [-3209.791] (-3210.213) (-3209.925) * (-3203.609) (-3210.969) (-3215.762) [-3206.223] -- 0:03:21 356000 -- (-3205.384) (-3207.067) [-3212.530] (-3210.285) * (-3206.492) (-3210.014) (-3215.363) [-3208.035] -- 0:03:20 356500 -- (-3207.919) (-3207.327) [-3203.801] (-3205.089) * [-3204.636] (-3210.133) (-3218.040) (-3203.851) -- 0:03:20 357000 -- [-3205.134] (-3203.631) (-3205.403) (-3207.937) * [-3204.085] (-3217.320) (-3211.944) (-3203.220) -- 0:03:19 357500 -- [-3205.517] (-3204.666) (-3209.775) (-3210.357) * [-3206.124] (-3210.185) (-3210.290) (-3206.198) -- 0:03:19 358000 -- (-3209.220) [-3203.662] (-3214.548) (-3208.888) * (-3217.600) (-3205.270) [-3206.186] (-3206.867) -- 0:03:20 358500 -- (-3207.715) (-3209.170) (-3211.711) [-3205.858] * (-3204.617) (-3210.724) [-3215.621] (-3206.764) -- 0:03:20 359000 -- (-3206.096) (-3207.505) (-3210.168) [-3209.120] * (-3211.462) [-3209.670] (-3214.644) (-3216.220) -- 0:03:19 359500 -- (-3207.065) (-3204.077) (-3211.039) [-3208.064] * (-3212.629) [-3207.524] (-3212.060) (-3209.035) -- 0:03:19 360000 -- [-3204.898] (-3207.526) (-3207.864) (-3209.991) * (-3209.147) [-3204.406] (-3212.032) (-3213.610) -- 0:03:19 Average standard deviation of split frequencies: 0.016991 360500 -- (-3210.960) [-3208.345] (-3205.583) (-3210.600) * (-3203.867) [-3209.228] (-3207.326) (-3211.269) -- 0:03:18 361000 -- (-3216.637) (-3205.218) (-3205.131) [-3209.965] * [-3206.652] (-3212.480) (-3211.356) (-3211.441) -- 0:03:20 361500 -- (-3206.520) (-3209.200) (-3206.023) [-3202.955] * (-3213.057) (-3212.512) [-3203.897] (-3206.009) -- 0:03:19 362000 -- (-3215.771) (-3203.918) [-3210.118] (-3210.662) * (-3206.215) [-3205.921] (-3212.351) (-3207.225) -- 0:03:19 362500 -- (-3207.432) (-3210.850) (-3207.620) [-3205.798] * (-3207.770) (-3205.060) (-3212.792) [-3205.532] -- 0:03:18 363000 -- (-3203.487) (-3203.635) [-3207.038] (-3203.397) * [-3207.047] (-3213.148) (-3206.173) (-3207.699) -- 0:03:18 363500 -- [-3204.277] (-3202.680) (-3204.943) (-3204.963) * [-3208.085] (-3201.781) (-3213.681) (-3211.747) -- 0:03:17 364000 -- (-3206.122) (-3212.874) (-3207.848) [-3204.121] * [-3205.358] (-3204.524) (-3204.065) (-3209.056) -- 0:03:17 364500 -- (-3212.835) (-3217.806) (-3213.208) [-3214.381] * (-3207.867) [-3206.243] (-3208.228) (-3207.088) -- 0:03:18 365000 -- [-3211.401] (-3215.428) (-3208.308) (-3212.006) * (-3215.204) (-3211.138) [-3210.658] (-3206.937) -- 0:03:18 Average standard deviation of split frequencies: 0.015456 365500 -- (-3207.161) (-3207.731) [-3210.236] (-3214.163) * (-3209.819) [-3205.731] (-3214.801) (-3207.744) -- 0:03:17 366000 -- (-3217.803) [-3208.763] (-3208.145) (-3210.512) * (-3206.519) [-3201.230] (-3216.339) (-3205.466) -- 0:03:17 366500 -- [-3204.796] (-3203.407) (-3207.442) (-3208.263) * (-3206.574) [-3201.121] (-3220.807) (-3206.506) -- 0:03:17 367000 -- (-3202.437) (-3210.956) [-3207.755] (-3213.809) * (-3207.298) (-3208.885) [-3205.946] (-3208.282) -- 0:03:16 367500 -- (-3216.528) (-3207.647) (-3215.524) [-3205.589] * (-3205.303) (-3207.324) (-3207.336) [-3207.182] -- 0:03:17 368000 -- (-3209.597) [-3202.923] (-3213.073) (-3210.481) * (-3203.884) (-3209.557) (-3206.947) [-3207.327] -- 0:03:17 368500 -- [-3207.791] (-3209.700) (-3216.338) (-3207.065) * (-3209.633) (-3210.720) (-3206.410) [-3216.413] -- 0:03:17 369000 -- [-3207.379] (-3211.301) (-3209.227) (-3209.141) * (-3206.070) (-3207.600) (-3209.599) [-3204.478] -- 0:03:16 369500 -- [-3213.891] (-3206.198) (-3208.710) (-3209.541) * [-3207.492] (-3205.449) (-3208.085) (-3208.356) -- 0:03:16 370000 -- [-3204.914] (-3205.847) (-3211.067) (-3209.243) * [-3202.989] (-3209.350) (-3210.223) (-3209.312) -- 0:03:15 Average standard deviation of split frequencies: 0.015261 370500 -- (-3215.088) (-3209.106) (-3211.690) [-3206.761] * (-3206.263) [-3204.466] (-3207.843) (-3211.818) -- 0:03:15 371000 -- [-3207.971] (-3209.743) (-3213.853) (-3213.384) * (-3207.375) [-3204.899] (-3210.882) (-3203.250) -- 0:03:16 371500 -- (-3212.856) [-3209.790] (-3212.695) (-3205.602) * (-3211.308) [-3206.089] (-3212.507) (-3208.791) -- 0:03:16 372000 -- (-3217.017) [-3207.931] (-3209.791) (-3204.988) * (-3211.558) [-3209.283] (-3208.057) (-3211.294) -- 0:03:15 372500 -- (-3210.786) (-3208.710) (-3204.866) [-3213.276] * (-3214.782) (-3207.982) (-3205.969) [-3208.643] -- 0:03:15 373000 -- (-3208.283) (-3206.811) [-3208.309] (-3204.127) * (-3212.930) [-3207.544] (-3212.435) (-3215.677) -- 0:03:14 373500 -- [-3205.911] (-3218.210) (-3210.004) (-3208.426) * (-3204.195) [-3206.977] (-3209.504) (-3208.355) -- 0:03:14 374000 -- (-3207.027) [-3206.950] (-3218.051) (-3211.045) * (-3212.291) (-3203.646) (-3205.173) [-3206.717] -- 0:03:15 374500 -- (-3214.050) [-3205.071] (-3215.242) (-3209.614) * (-3213.963) (-3213.577) [-3204.776] (-3206.691) -- 0:03:15 375000 -- (-3206.463) (-3205.499) [-3206.314] (-3208.968) * (-3213.847) [-3208.948] (-3210.711) (-3218.840) -- 0:03:15 Average standard deviation of split frequencies: 0.016299 375500 -- [-3206.612] (-3208.613) (-3209.498) (-3207.881) * (-3206.982) (-3216.001) (-3209.878) [-3204.536] -- 0:03:14 376000 -- (-3208.732) [-3204.108] (-3208.902) (-3210.663) * (-3212.051) [-3205.864] (-3211.717) (-3211.249) -- 0:03:14 376500 -- (-3212.758) [-3203.636] (-3212.547) (-3211.204) * (-3216.072) [-3205.938] (-3208.383) (-3208.663) -- 0:03:13 377000 -- [-3214.468] (-3206.949) (-3208.986) (-3205.780) * (-3211.703) [-3204.957] (-3210.823) (-3209.879) -- 0:03:13 377500 -- (-3209.539) (-3214.121) [-3205.770] (-3206.838) * (-3208.377) (-3213.126) (-3204.172) [-3205.759] -- 0:03:14 378000 -- (-3217.021) [-3206.664] (-3206.765) (-3207.031) * (-3205.555) [-3211.470] (-3206.945) (-3212.128) -- 0:03:14 378500 -- (-3211.824) (-3208.747) (-3205.048) [-3212.863] * (-3210.869) (-3210.348) (-3200.872) [-3217.626] -- 0:03:13 379000 -- [-3205.700] (-3214.996) (-3207.913) (-3205.554) * (-3211.186) (-3206.241) [-3205.226] (-3214.622) -- 0:03:13 379500 -- (-3205.708) [-3211.137] (-3205.868) (-3203.799) * (-3204.484) [-3206.317] (-3204.454) (-3212.070) -- 0:03:12 380000 -- (-3212.860) [-3208.832] (-3210.666) (-3204.721) * (-3205.720) [-3205.405] (-3203.005) (-3209.885) -- 0:03:12 Average standard deviation of split frequencies: 0.017956 380500 -- [-3211.275] (-3215.791) (-3213.736) (-3208.548) * (-3208.273) (-3204.123) (-3203.860) [-3214.110] -- 0:03:13 381000 -- (-3215.117) (-3209.379) (-3207.795) [-3207.378] * (-3211.596) (-3205.124) (-3207.289) [-3210.700] -- 0:03:13 381500 -- (-3212.112) (-3212.260) [-3207.408] (-3211.748) * (-3206.258) [-3206.976] (-3208.223) (-3210.513) -- 0:03:12 382000 -- (-3214.302) (-3210.304) (-3211.989) [-3205.731] * (-3211.728) [-3206.924] (-3206.906) (-3210.105) -- 0:03:12 382500 -- [-3218.118] (-3212.584) (-3205.314) (-3212.220) * (-3210.939) [-3205.994] (-3209.279) (-3218.786) -- 0:03:12 383000 -- (-3209.298) [-3208.375] (-3202.207) (-3206.191) * (-3209.191) [-3203.535] (-3203.736) (-3210.242) -- 0:03:11 383500 -- (-3209.814) (-3215.013) [-3205.900] (-3202.506) * (-3205.717) (-3204.107) (-3206.219) [-3206.191] -- 0:03:12 384000 -- [-3207.836] (-3205.981) (-3202.518) (-3210.219) * (-3213.456) (-3205.900) [-3206.914] (-3209.778) -- 0:03:12 384500 -- [-3210.958] (-3206.763) (-3209.683) (-3210.839) * (-3208.649) [-3206.784] (-3210.843) (-3216.989) -- 0:03:12 385000 -- (-3207.714) (-3209.810) (-3210.718) [-3210.664] * (-3202.965) [-3204.269] (-3216.177) (-3210.998) -- 0:03:11 Average standard deviation of split frequencies: 0.015876 385500 -- (-3210.118) [-3207.157] (-3207.082) (-3215.571) * (-3206.018) (-3212.576) [-3217.399] (-3207.768) -- 0:03:11 386000 -- (-3207.728) (-3208.726) [-3208.277] (-3210.880) * (-3209.879) (-3213.437) (-3215.476) [-3205.720] -- 0:03:10 386500 -- [-3205.218] (-3208.103) (-3209.312) (-3212.401) * (-3204.985) (-3204.748) (-3209.316) [-3203.828] -- 0:03:10 387000 -- (-3218.534) [-3215.578] (-3206.456) (-3213.986) * (-3212.709) [-3204.139] (-3211.625) (-3206.266) -- 0:03:11 387500 -- (-3208.521) (-3211.562) [-3206.365] (-3209.133) * [-3211.682] (-3208.606) (-3214.100) (-3212.447) -- 0:03:11 388000 -- (-3212.708) (-3207.793) (-3208.226) [-3208.281] * (-3214.092) (-3204.025) [-3205.146] (-3213.579) -- 0:03:10 388500 -- (-3213.301) (-3206.396) [-3204.802] (-3207.191) * [-3203.480] (-3207.349) (-3209.814) (-3205.543) -- 0:03:10 389000 -- (-3206.286) (-3210.362) (-3216.209) [-3207.597] * [-3209.352] (-3210.801) (-3208.226) (-3217.495) -- 0:03:10 389500 -- (-3207.897) [-3213.993] (-3207.419) (-3204.107) * (-3208.669) (-3209.470) (-3211.920) [-3209.864] -- 0:03:09 390000 -- (-3210.841) (-3211.694) (-3209.110) [-3212.572] * [-3206.165] (-3209.175) (-3217.854) (-3205.863) -- 0:03:10 Average standard deviation of split frequencies: 0.016893 390500 -- [-3209.816] (-3208.990) (-3207.587) (-3207.345) * (-3212.375) (-3212.666) (-3205.954) [-3208.305] -- 0:03:10 391000 -- (-3206.950) [-3209.034] (-3202.563) (-3213.304) * [-3207.766] (-3207.721) (-3205.064) (-3211.122) -- 0:03:10 391500 -- (-3213.296) [-3205.704] (-3215.874) (-3206.383) * [-3213.102] (-3209.978) (-3205.122) (-3207.683) -- 0:03:09 392000 -- (-3202.967) (-3207.623) (-3212.117) [-3207.662] * (-3208.308) (-3207.920) [-3203.106] (-3208.785) -- 0:03:09 392500 -- [-3202.942] (-3210.413) (-3208.917) (-3210.570) * (-3212.793) (-3208.919) [-3204.302] (-3214.753) -- 0:03:08 393000 -- (-3209.656) (-3206.343) [-3203.818] (-3211.364) * (-3208.194) [-3210.998] (-3204.719) (-3212.082) -- 0:03:08 393500 -- (-3207.613) (-3209.835) [-3202.016] (-3211.301) * [-3204.074] (-3207.281) (-3207.942) (-3209.421) -- 0:03:09 394000 -- (-3209.081) (-3209.954) (-3206.396) [-3206.035] * (-3207.774) (-3207.585) (-3209.508) [-3208.271] -- 0:03:09 394500 -- (-3209.879) (-3204.680) (-3208.745) [-3206.750] * [-3203.477] (-3206.816) (-3213.475) (-3207.516) -- 0:03:08 395000 -- [-3203.792] (-3205.887) (-3206.479) (-3204.185) * (-3205.105) (-3209.170) [-3206.023] (-3210.578) -- 0:03:08 Average standard deviation of split frequencies: 0.017856 395500 -- (-3216.986) [-3209.739] (-3207.986) (-3207.391) * (-3203.440) [-3205.279] (-3211.411) (-3207.814) -- 0:03:07 396000 -- (-3207.233) (-3203.122) [-3214.457] (-3203.459) * (-3215.165) (-3207.828) [-3207.132] (-3207.513) -- 0:03:07 396500 -- (-3208.499) (-3208.519) (-3211.203) [-3205.136] * (-3205.154) (-3206.934) (-3204.385) [-3207.884] -- 0:03:08 397000 -- (-3211.313) [-3207.432] (-3210.206) (-3216.468) * [-3208.944] (-3208.716) (-3216.807) (-3208.674) -- 0:03:08 397500 -- [-3207.200] (-3206.100) (-3205.281) (-3213.409) * [-3204.414] (-3213.593) (-3208.889) (-3207.865) -- 0:03:07 398000 -- (-3208.127) (-3208.432) (-3207.654) [-3211.501] * (-3214.519) [-3208.672] (-3207.104) (-3208.347) -- 0:03:07 398500 -- [-3204.851] (-3207.710) (-3217.255) (-3209.739) * (-3212.247) (-3208.333) [-3204.648] (-3210.613) -- 0:03:07 399000 -- (-3210.322) (-3213.474) (-3209.556) [-3205.422] * [-3207.176] (-3210.361) (-3205.115) (-3209.158) -- 0:03:06 399500 -- (-3210.837) [-3208.521] (-3209.851) (-3209.321) * (-3211.940) (-3217.715) (-3210.887) [-3212.025] -- 0:03:06 400000 -- (-3214.039) (-3205.994) (-3212.301) [-3207.742] * (-3205.768) (-3213.924) (-3214.126) [-3204.215] -- 0:03:07 Average standard deviation of split frequencies: 0.017060 400500 -- (-3211.145) (-3208.664) (-3209.809) [-3204.693] * (-3210.540) (-3206.363) [-3208.952] (-3211.659) -- 0:03:07 401000 -- (-3214.790) [-3208.240] (-3208.859) (-3210.069) * (-3204.922) [-3205.649] (-3204.408) (-3213.067) -- 0:03:06 401500 -- (-3211.012) [-3210.760] (-3208.803) (-3210.782) * (-3207.717) [-3201.348] (-3202.782) (-3203.661) -- 0:03:06 402000 -- (-3211.561) (-3206.428) [-3205.589] (-3207.123) * (-3206.503) (-3206.238) [-3210.340] (-3210.110) -- 0:03:05 402500 -- (-3217.931) (-3209.644) (-3206.040) [-3207.404] * (-3207.785) [-3205.626] (-3212.567) (-3205.539) -- 0:03:05 403000 -- [-3203.912] (-3200.985) (-3211.190) (-3211.140) * (-3207.212) (-3212.018) (-3209.499) [-3205.454] -- 0:03:06 403500 -- (-3211.620) (-3202.302) (-3204.670) [-3208.123] * (-3208.737) (-3208.880) (-3210.758) [-3202.961] -- 0:03:06 404000 -- (-3204.899) (-3214.550) [-3211.021] (-3211.857) * (-3209.515) (-3211.859) (-3215.965) [-3203.349] -- 0:03:05 404500 -- [-3205.260] (-3208.370) (-3208.015) (-3210.764) * (-3214.669) (-3212.598) (-3210.840) [-3210.340] -- 0:03:05 405000 -- (-3205.664) (-3208.884) [-3207.730] (-3219.304) * (-3210.005) [-3209.632] (-3209.799) (-3210.562) -- 0:03:05 Average standard deviation of split frequencies: 0.014514 405500 -- (-3203.935) (-3207.021) [-3209.563] (-3210.346) * (-3206.619) (-3212.199) [-3208.772] (-3215.550) -- 0:03:04 406000 -- (-3210.420) (-3216.928) (-3206.736) [-3204.365] * [-3206.275] (-3216.953) (-3209.976) (-3206.379) -- 0:03:05 406500 -- (-3209.032) [-3211.838] (-3211.344) (-3207.416) * (-3208.951) (-3216.546) (-3210.556) [-3206.134] -- 0:03:05 407000 -- (-3211.087) [-3210.754] (-3211.342) (-3208.367) * (-3206.601) [-3212.695] (-3211.259) (-3209.522) -- 0:03:05 407500 -- [-3208.176] (-3205.436) (-3209.638) (-3207.668) * [-3205.185] (-3216.562) (-3212.892) (-3209.279) -- 0:03:04 408000 -- (-3220.715) [-3207.883] (-3212.702) (-3208.312) * (-3204.458) [-3207.597] (-3209.285) (-3221.862) -- 0:03:04 408500 -- (-3216.324) [-3208.107] (-3211.300) (-3207.977) * (-3211.085) (-3209.019) [-3206.331] (-3206.812) -- 0:03:03 409000 -- (-3213.816) (-3205.837) [-3204.656] (-3211.598) * (-3208.603) (-3209.111) (-3207.030) [-3207.803] -- 0:03:03 409500 -- (-3208.842) [-3206.904] (-3207.576) (-3222.363) * [-3211.688] (-3214.000) (-3207.823) (-3212.936) -- 0:03:04 410000 -- (-3206.137) (-3207.135) [-3208.073] (-3207.344) * (-3212.427) (-3205.195) (-3209.814) [-3208.495] -- 0:03:04 Average standard deviation of split frequencies: 0.012627 410500 -- (-3211.086) (-3205.811) (-3208.379) [-3206.988] * (-3212.950) (-3211.635) [-3209.741] (-3208.125) -- 0:03:03 411000 -- (-3203.621) (-3214.503) [-3206.125] (-3200.868) * (-3206.850) (-3207.930) [-3202.190] (-3210.806) -- 0:03:03 411500 -- [-3205.562] (-3208.228) (-3209.481) (-3209.520) * (-3208.115) (-3209.585) (-3208.270) [-3205.279] -- 0:03:03 412000 -- (-3209.877) (-3202.563) (-3203.645) [-3213.890] * (-3210.833) [-3209.181] (-3209.215) (-3210.379) -- 0:03:02 412500 -- (-3210.379) (-3208.234) (-3207.068) [-3210.784] * (-3208.871) [-3204.371] (-3206.066) (-3220.097) -- 0:03:03 413000 -- (-3214.113) (-3207.135) [-3206.538] (-3206.293) * (-3205.310) (-3205.912) [-3208.392] (-3210.954) -- 0:03:03 413500 -- (-3215.527) [-3209.717] (-3205.119) (-3207.740) * (-3203.798) [-3207.759] (-3217.942) (-3205.865) -- 0:03:02 414000 -- (-3212.285) (-3210.697) [-3206.328] (-3218.931) * (-3207.282) [-3208.312] (-3224.640) (-3207.910) -- 0:03:02 414500 -- (-3213.632) [-3208.223] (-3211.341) (-3212.691) * (-3212.906) [-3207.366] (-3207.929) (-3205.342) -- 0:03:02 415000 -- (-3208.189) [-3203.289] (-3209.690) (-3209.526) * [-3210.733] (-3204.234) (-3207.289) (-3212.604) -- 0:03:01 Average standard deviation of split frequencies: 0.011898 415500 -- (-3212.750) (-3210.368) [-3207.577] (-3208.434) * (-3210.320) (-3205.814) [-3212.525] (-3204.834) -- 0:03:01 416000 -- (-3208.114) [-3205.798] (-3204.794) (-3205.792) * (-3206.535) [-3208.466] (-3203.051) (-3205.882) -- 0:03:02 416500 -- [-3207.865] (-3208.370) (-3206.864) (-3204.864) * (-3213.680) (-3206.973) [-3203.901] (-3215.868) -- 0:03:02 417000 -- (-3216.748) [-3205.994] (-3212.940) (-3203.993) * (-3213.577) (-3206.891) [-3208.548] (-3213.618) -- 0:03:01 417500 -- (-3206.142) (-3206.159) [-3205.629] (-3208.204) * (-3218.200) [-3206.422] (-3206.999) (-3212.670) -- 0:03:01 418000 -- (-3203.619) (-3205.374) [-3205.696] (-3207.592) * (-3204.851) (-3211.428) [-3203.615] (-3209.933) -- 0:03:01 418500 -- (-3203.860) (-3211.947) [-3205.496] (-3208.608) * (-3214.458) (-3209.931) [-3206.520] (-3206.237) -- 0:03:00 419000 -- (-3206.036) [-3207.107] (-3206.641) (-3204.240) * (-3207.413) (-3211.388) (-3205.501) [-3213.800] -- 0:03:01 419500 -- (-3206.692) (-3207.818) [-3206.010] (-3218.510) * [-3203.770] (-3211.137) (-3209.928) (-3204.554) -- 0:03:01 420000 -- (-3211.939) (-3204.315) [-3204.202] (-3209.528) * (-3210.178) (-3210.385) (-3209.757) [-3208.737] -- 0:03:00 Average standard deviation of split frequencies: 0.009525 420500 -- (-3205.474) [-3210.106] (-3211.392) (-3209.954) * (-3207.302) [-3205.932] (-3212.675) (-3208.472) -- 0:03:00 421000 -- (-3214.938) (-3201.471) (-3208.315) [-3207.482] * [-3212.753] (-3205.020) (-3210.449) (-3211.441) -- 0:03:00 421500 -- (-3211.674) (-3208.358) (-3209.550) [-3205.557] * (-3209.037) (-3208.869) (-3206.270) [-3215.796] -- 0:02:59 422000 -- (-3211.474) (-3212.467) [-3206.801] (-3204.107) * (-3207.983) [-3214.160] (-3208.010) (-3205.695) -- 0:03:00 422500 -- [-3214.441] (-3212.133) (-3211.920) (-3210.506) * (-3216.087) (-3209.083) [-3212.699] (-3210.535) -- 0:03:00 423000 -- (-3204.609) [-3209.142] (-3209.953) (-3205.004) * (-3207.047) (-3204.756) [-3202.511] (-3208.420) -- 0:03:00 423500 -- (-3206.746) (-3210.743) (-3209.059) [-3206.792] * (-3205.334) (-3206.248) (-3208.024) [-3209.585] -- 0:02:59 424000 -- [-3209.725] (-3206.288) (-3207.302) (-3206.100) * [-3207.441] (-3210.667) (-3203.768) (-3217.849) -- 0:02:59 424500 -- [-3205.868] (-3206.153) (-3202.604) (-3205.448) * (-3208.183) [-3209.550] (-3204.748) (-3207.927) -- 0:02:58 425000 -- (-3206.543) (-3209.733) (-3204.909) [-3204.778] * (-3213.059) (-3207.992) [-3207.177] (-3213.211) -- 0:02:58 Average standard deviation of split frequencies: 0.010513 425500 -- (-3205.261) [-3208.475] (-3206.349) (-3206.263) * (-3207.028) [-3208.571] (-3206.614) (-3214.512) -- 0:02:59 426000 -- (-3212.456) (-3214.396) [-3214.562] (-3206.241) * (-3209.370) (-3204.664) (-3201.179) [-3205.718] -- 0:02:59 426500 -- (-3208.372) (-3207.314) [-3209.465] (-3208.723) * (-3213.668) (-3207.011) [-3202.653] (-3204.895) -- 0:02:58 427000 -- (-3216.215) (-3207.257) (-3210.066) [-3204.590] * (-3211.762) (-3203.840) (-3214.271) [-3205.667] -- 0:02:58 427500 -- (-3210.522) (-3215.589) [-3204.032] (-3210.022) * (-3209.075) (-3206.708) (-3209.371) [-3206.824] -- 0:02:58 428000 -- (-3206.373) [-3215.631] (-3210.654) (-3210.254) * (-3203.172) [-3205.901] (-3206.954) (-3203.933) -- 0:02:57 428500 -- (-3219.957) (-3212.685) [-3212.208] (-3208.371) * (-3206.416) (-3206.824) (-3210.977) [-3204.068] -- 0:02:58 429000 -- (-3218.833) [-3211.524] (-3204.689) (-3204.582) * (-3210.364) (-3210.318) [-3206.676] (-3205.461) -- 0:02:58 429500 -- [-3212.634] (-3208.512) (-3207.989) (-3208.095) * (-3206.348) (-3204.093) (-3203.420) [-3207.309] -- 0:02:57 430000 -- (-3204.871) (-3206.742) (-3216.885) [-3210.094] * [-3203.032] (-3211.321) (-3204.867) (-3209.064) -- 0:02:57 Average standard deviation of split frequencies: 0.011493 430500 -- [-3204.131] (-3209.643) (-3210.306) (-3206.085) * (-3209.912) [-3207.218] (-3204.302) (-3207.537) -- 0:02:57 431000 -- (-3207.969) [-3206.543] (-3213.354) (-3204.671) * (-3212.877) [-3208.442] (-3206.142) (-3206.415) -- 0:02:56 431500 -- (-3208.309) (-3203.026) [-3208.391] (-3203.423) * (-3210.347) (-3207.650) (-3205.066) [-3204.606] -- 0:02:56 432000 -- [-3208.857] (-3211.613) (-3206.574) (-3211.248) * (-3209.394) (-3207.873) (-3214.256) [-3207.482] -- 0:02:57 432500 -- (-3211.109) (-3208.956) (-3206.374) [-3214.003] * (-3206.985) [-3206.107] (-3209.380) (-3214.803) -- 0:02:57 433000 -- [-3211.173] (-3207.643) (-3207.343) (-3209.425) * (-3211.482) (-3215.800) [-3206.549] (-3213.160) -- 0:02:56 433500 -- (-3215.702) (-3209.025) [-3209.885] (-3208.094) * [-3204.702] (-3204.134) (-3205.660) (-3207.338) -- 0:02:56 434000 -- (-3210.768) (-3209.044) (-3211.867) [-3205.968] * (-3209.995) [-3206.397] (-3205.746) (-3209.391) -- 0:02:56 434500 -- (-3207.239) (-3205.125) (-3205.644) [-3209.249] * (-3208.915) (-3214.545) [-3206.952] (-3209.147) -- 0:02:55 435000 -- (-3205.472) [-3207.376] (-3205.845) (-3204.924) * (-3209.936) [-3202.526] (-3205.300) (-3208.671) -- 0:02:56 Average standard deviation of split frequencies: 0.010271 435500 -- (-3210.944) (-3210.276) (-3205.391) [-3204.538] * (-3212.127) [-3203.361] (-3210.833) (-3208.867) -- 0:02:56 436000 -- (-3215.378) (-3204.285) [-3201.511] (-3209.304) * (-3214.908) (-3215.655) (-3207.164) [-3208.868] -- 0:02:55 436500 -- (-3211.841) [-3205.514] (-3207.767) (-3204.861) * [-3208.559] (-3213.432) (-3209.432) (-3205.494) -- 0:02:55 437000 -- (-3203.500) [-3201.792] (-3208.790) (-3210.362) * (-3212.885) (-3207.831) [-3209.078] (-3214.639) -- 0:02:55 437500 -- (-3208.185) [-3204.657] (-3211.619) (-3215.926) * (-3211.947) (-3210.309) (-3213.786) [-3206.768] -- 0:02:54 438000 -- (-3210.723) [-3213.460] (-3210.234) (-3213.541) * (-3208.274) (-3208.433) (-3206.417) [-3207.295] -- 0:02:54 438500 -- (-3216.310) (-3215.183) (-3211.879) [-3203.941] * (-3210.997) [-3205.269] (-3208.648) (-3208.349) -- 0:02:55 439000 -- (-3207.944) (-3209.666) (-3207.313) [-3209.284] * (-3211.425) (-3210.125) [-3204.151] (-3208.617) -- 0:02:55 439500 -- [-3201.758] (-3208.797) (-3210.629) (-3210.532) * (-3207.360) [-3203.955] (-3206.742) (-3206.400) -- 0:02:54 440000 -- (-3206.611) (-3212.999) [-3210.693] (-3218.002) * (-3220.625) (-3210.695) [-3205.907] (-3208.138) -- 0:02:54 Average standard deviation of split frequencies: 0.009093 440500 -- [-3209.103] (-3211.613) (-3215.992) (-3207.771) * (-3209.229) [-3206.796] (-3210.427) (-3206.781) -- 0:02:54 441000 -- [-3209.196] (-3208.752) (-3221.534) (-3204.326) * (-3210.679) [-3209.265] (-3209.444) (-3216.249) -- 0:02:53 441500 -- (-3208.042) [-3209.258] (-3210.760) (-3215.033) * [-3207.220] (-3204.943) (-3207.355) (-3210.321) -- 0:02:54 442000 -- (-3206.406) (-3212.827) (-3215.177) [-3204.761] * (-3214.419) (-3204.483) (-3210.832) [-3210.321] -- 0:02:54 442500 -- [-3211.256] (-3222.643) (-3211.573) (-3213.522) * [-3211.333] (-3206.772) (-3204.977) (-3206.934) -- 0:02:53 443000 -- (-3215.063) (-3215.337) (-3208.153) [-3211.308] * (-3207.622) (-3209.203) [-3203.123] (-3206.289) -- 0:02:53 443500 -- (-3207.314) (-3217.687) (-3212.883) [-3210.648] * (-3208.726) (-3207.633) [-3205.573] (-3208.307) -- 0:02:53 444000 -- (-3205.467) (-3210.434) (-3216.189) [-3209.757] * (-3220.325) (-3209.215) (-3206.249) [-3206.126] -- 0:02:52 444500 -- [-3203.149] (-3211.265) (-3212.430) (-3208.900) * (-3204.173) [-3209.962] (-3210.897) (-3206.052) -- 0:02:52 445000 -- [-3213.460] (-3218.146) (-3212.315) (-3207.355) * [-3208.988] (-3204.573) (-3206.205) (-3204.304) -- 0:02:53 Average standard deviation of split frequencies: 0.007399 445500 -- (-3206.086) (-3210.193) (-3204.480) [-3207.373] * [-3208.437] (-3203.744) (-3211.635) (-3210.158) -- 0:02:53 446000 -- (-3214.041) [-3212.427] (-3201.622) (-3210.410) * (-3205.752) (-3209.251) (-3209.318) [-3204.910] -- 0:02:52 446500 -- (-3210.904) [-3207.532] (-3209.210) (-3206.751) * [-3209.096] (-3208.525) (-3207.397) (-3206.236) -- 0:02:52 447000 -- (-3211.628) (-3211.327) [-3218.784] (-3205.183) * (-3209.668) (-3204.512) (-3210.377) [-3205.726] -- 0:02:51 447500 -- [-3204.227] (-3215.039) (-3213.186) (-3209.936) * (-3210.347) [-3201.566] (-3203.758) (-3204.338) -- 0:02:51 448000 -- (-3210.896) [-3209.991] (-3207.648) (-3206.492) * (-3213.784) (-3203.504) [-3204.345] (-3206.328) -- 0:02:52 448500 -- [-3208.246] (-3213.104) (-3206.238) (-3213.689) * (-3209.871) [-3203.613] (-3202.539) (-3206.354) -- 0:02:52 449000 -- (-3207.249) (-3209.753) [-3211.398] (-3210.742) * (-3220.242) [-3206.689] (-3208.013) (-3206.250) -- 0:02:51 449500 -- [-3205.770] (-3208.012) (-3207.529) (-3207.086) * (-3210.706) (-3208.574) [-3208.312] (-3208.558) -- 0:02:51 450000 -- [-3204.474] (-3209.970) (-3205.558) (-3208.112) * (-3216.682) (-3212.763) [-3211.460] (-3209.559) -- 0:02:51 Average standard deviation of split frequencies: 0.006276 450500 -- (-3207.379) [-3207.776] (-3206.645) (-3205.714) * (-3209.885) [-3205.650] (-3209.971) (-3211.055) -- 0:02:50 451000 -- (-3206.555) (-3205.546) [-3210.286] (-3213.502) * (-3206.846) (-3206.679) [-3206.685] (-3205.200) -- 0:02:51 451500 -- (-3221.172) (-3208.049) (-3213.679) [-3205.331] * [-3207.799] (-3210.354) (-3212.902) (-3203.780) -- 0:02:51 452000 -- (-3208.685) (-3209.946) (-3204.615) [-3209.147] * (-3209.732) (-3213.231) [-3211.012] (-3211.370) -- 0:02:50 452500 -- (-3214.971) (-3211.911) (-3205.837) [-3211.434] * (-3208.471) (-3206.722) [-3203.458] (-3209.835) -- 0:02:50 453000 -- (-3204.652) (-3210.229) [-3212.603] (-3209.679) * (-3211.947) [-3205.546] (-3210.997) (-3209.507) -- 0:02:50 453500 -- (-3212.282) (-3220.606) (-3210.388) [-3209.986] * (-3208.412) (-3209.024) [-3210.060] (-3204.229) -- 0:02:49 454000 -- (-3207.929) (-3218.694) (-3209.505) [-3209.814] * [-3214.395] (-3209.394) (-3214.165) (-3209.292) -- 0:02:49 454500 -- (-3207.131) (-3207.689) [-3206.725] (-3206.499) * (-3210.572) (-3211.208) [-3208.573] (-3205.570) -- 0:02:50 455000 -- (-3210.889) (-3210.101) [-3204.455] (-3210.396) * (-3208.012) [-3208.289] (-3213.664) (-3210.099) -- 0:02:50 Average standard deviation of split frequencies: 0.007753 455500 -- [-3210.908] (-3204.343) (-3209.344) (-3216.145) * (-3216.788) [-3206.442] (-3211.207) (-3216.285) -- 0:02:49 456000 -- (-3210.617) [-3208.292] (-3210.322) (-3216.299) * [-3212.160] (-3206.548) (-3211.179) (-3205.943) -- 0:02:49 456500 -- (-3206.241) (-3210.927) (-3215.840) [-3209.347] * (-3210.231) (-3210.120) [-3210.000] (-3212.037) -- 0:02:49 457000 -- (-3205.626) [-3210.053] (-3213.954) (-3212.111) * (-3210.751) (-3206.852) (-3208.810) [-3207.829] -- 0:02:48 457500 -- (-3217.970) [-3206.330] (-3213.334) (-3222.023) * (-3210.873) (-3204.383) [-3214.432] (-3207.944) -- 0:02:49 458000 -- [-3205.675] (-3207.164) (-3208.321) (-3210.832) * (-3206.813) (-3208.471) (-3205.973) [-3210.402] -- 0:02:49 458500 -- [-3209.675] (-3207.975) (-3209.914) (-3213.161) * [-3203.976] (-3205.025) (-3213.202) (-3206.761) -- 0:02:48 459000 -- [-3207.035] (-3205.198) (-3205.722) (-3205.377) * (-3207.666) [-3207.991] (-3215.444) (-3203.813) -- 0:02:48 459500 -- (-3206.898) [-3208.277] (-3203.792) (-3208.873) * (-3207.390) (-3204.929) [-3209.497] (-3208.709) -- 0:02:48 460000 -- (-3208.907) (-3213.922) [-3205.966] (-3209.971) * (-3212.231) (-3208.598) [-3207.792] (-3211.420) -- 0:02:47 Average standard deviation of split frequencies: 0.008698 460500 -- (-3205.088) [-3204.447] (-3213.839) (-3217.901) * (-3220.495) (-3211.262) [-3203.682] (-3211.487) -- 0:02:47 461000 -- [-3204.302] (-3212.828) (-3215.276) (-3214.944) * (-3205.931) (-3213.747) (-3208.106) [-3216.570] -- 0:02:48 461500 -- [-3208.220] (-3205.219) (-3205.061) (-3211.658) * [-3209.617] (-3213.493) (-3214.546) (-3214.188) -- 0:02:48 462000 -- (-3212.042) (-3203.928) [-3209.803] (-3211.204) * (-3204.159) (-3220.142) [-3210.670] (-3211.411) -- 0:02:47 462500 -- (-3206.465) [-3210.489] (-3215.509) (-3206.507) * (-3210.808) (-3206.991) (-3211.707) [-3207.685] -- 0:02:47 463000 -- [-3208.407] (-3208.312) (-3208.853) (-3207.928) * (-3213.904) (-3205.833) [-3207.214] (-3207.407) -- 0:02:47 463500 -- (-3208.632) [-3215.866] (-3212.513) (-3202.183) * (-3210.015) [-3204.172] (-3206.730) (-3212.038) -- 0:02:46 464000 -- (-3201.223) [-3208.283] (-3217.840) (-3206.516) * (-3205.268) [-3212.017] (-3220.228) (-3216.593) -- 0:02:47 464500 -- (-3201.668) (-3210.044) (-3205.916) [-3205.088] * [-3205.795] (-3204.092) (-3210.296) (-3208.768) -- 0:02:47 465000 -- (-3206.278) (-3208.767) (-3207.779) [-3203.592] * (-3201.280) [-3204.932] (-3206.937) (-3210.342) -- 0:02:46 Average standard deviation of split frequencies: 0.007587 465500 -- (-3205.072) [-3207.765] (-3205.344) (-3209.821) * [-3208.335] (-3217.485) (-3208.588) (-3208.206) -- 0:02:46 466000 -- (-3212.637) (-3219.096) (-3204.784) [-3203.964] * (-3206.914) (-3209.485) (-3210.845) [-3205.532] -- 0:02:46 466500 -- (-3209.827) [-3212.232] (-3206.272) (-3206.479) * (-3212.832) (-3206.804) [-3207.053] (-3219.536) -- 0:02:45 467000 -- (-3213.929) (-3209.309) (-3208.700) [-3203.717] * (-3204.650) [-3208.547] (-3207.548) (-3202.177) -- 0:02:46 467500 -- [-3203.165] (-3204.411) (-3206.237) (-3206.055) * [-3200.164] (-3203.637) (-3203.490) (-3217.240) -- 0:02:46 468000 -- (-3208.950) [-3207.990] (-3210.100) (-3207.858) * (-3209.549) (-3209.621) (-3212.465) [-3206.076] -- 0:02:45 468500 -- (-3215.448) (-3211.498) [-3212.297] (-3210.826) * (-3205.997) (-3208.174) [-3207.238] (-3210.086) -- 0:02:45 469000 -- (-3207.086) (-3208.308) [-3207.182] (-3203.492) * (-3211.937) (-3207.211) [-3208.820] (-3210.273) -- 0:02:45 469500 -- (-3208.333) (-3215.305) (-3207.103) [-3203.609] * (-3209.916) (-3212.858) [-3211.802] (-3208.353) -- 0:02:44 470000 -- [-3208.525] (-3208.102) (-3207.089) (-3208.299) * (-3209.606) (-3210.751) (-3209.548) [-3207.309] -- 0:02:44 Average standard deviation of split frequencies: 0.006510 470500 -- (-3203.562) (-3206.667) [-3206.828] (-3215.024) * (-3210.777) [-3209.637] (-3209.847) (-3205.228) -- 0:02:45 471000 -- [-3211.423] (-3210.020) (-3206.080) (-3210.118) * (-3206.089) [-3211.892] (-3206.751) (-3206.508) -- 0:02:45 471500 -- [-3207.913] (-3212.818) (-3212.029) (-3211.457) * (-3204.467) (-3214.428) [-3208.881] (-3212.180) -- 0:02:44 472000 -- (-3206.320) (-3211.459) [-3206.400] (-3207.914) * (-3206.747) [-3207.182] (-3207.926) (-3207.078) -- 0:02:44 472500 -- (-3209.900) [-3213.419] (-3205.592) (-3216.875) * (-3212.471) (-3209.283) (-3206.731) [-3207.796] -- 0:02:44 473000 -- (-3209.743) (-3214.253) [-3204.668] (-3210.486) * [-3212.894] (-3203.475) (-3205.956) (-3202.816) -- 0:02:43 473500 -- (-3211.081) (-3204.395) [-3205.159] (-3212.977) * (-3213.310) (-3210.360) [-3208.613] (-3205.891) -- 0:02:44 474000 -- (-3207.474) [-3205.396] (-3208.025) (-3215.879) * (-3204.649) (-3205.274) (-3208.362) [-3210.452] -- 0:02:44 474500 -- (-3209.711) [-3207.059] (-3219.549) (-3212.023) * [-3210.233] (-3215.846) (-3209.335) (-3204.472) -- 0:02:43 475000 -- (-3206.271) [-3213.865] (-3213.535) (-3213.481) * (-3206.538) (-3219.204) (-3207.737) [-3208.838] -- 0:02:43 Average standard deviation of split frequencies: 0.006932 475500 -- (-3213.922) (-3204.885) (-3207.916) [-3211.428] * (-3216.737) (-3210.661) (-3209.977) [-3204.378] -- 0:02:43 476000 -- (-3206.760) [-3207.488] (-3212.470) (-3207.059) * (-3210.596) (-3212.280) (-3211.853) [-3205.748] -- 0:02:42 476500 -- (-3208.835) [-3206.537] (-3211.621) (-3208.231) * (-3212.807) [-3203.031] (-3205.097) (-3208.142) -- 0:02:42 477000 -- (-3204.735) [-3207.245] (-3209.253) (-3215.649) * (-3204.175) (-3210.714) (-3204.204) [-3208.722] -- 0:02:43 477500 -- (-3203.601) (-3207.005) (-3207.185) [-3205.778] * (-3208.770) (-3208.414) [-3207.479] (-3205.328) -- 0:02:43 478000 -- (-3208.410) (-3209.929) [-3211.971] (-3208.073) * (-3208.240) (-3210.164) (-3205.396) [-3208.157] -- 0:02:42 478500 -- (-3204.552) (-3209.448) [-3206.967] (-3210.189) * (-3209.607) (-3206.763) [-3204.452] (-3211.415) -- 0:02:42 479000 -- (-3205.617) (-3211.876) (-3207.198) [-3210.034] * [-3213.590] (-3211.461) (-3210.472) (-3207.630) -- 0:02:42 479500 -- (-3207.661) [-3209.670] (-3206.884) (-3210.997) * (-3215.182) (-3208.128) [-3207.223] (-3209.549) -- 0:02:41 480000 -- (-3210.087) (-3227.728) (-3208.610) [-3207.132] * (-3210.726) [-3209.422] (-3210.042) (-3209.258) -- 0:02:42 Average standard deviation of split frequencies: 0.007355 480500 -- [-3205.622] (-3211.369) (-3210.569) (-3205.054) * (-3207.243) (-3213.411) [-3205.560] (-3208.360) -- 0:02:42 481000 -- [-3205.705] (-3205.335) (-3215.635) (-3212.192) * (-3206.592) (-3210.757) [-3206.453] (-3207.146) -- 0:02:41 481500 -- (-3203.292) [-3206.316] (-3207.453) (-3211.309) * (-3207.949) [-3207.627] (-3214.057) (-3206.555) -- 0:02:41 482000 -- (-3203.345) (-3210.761) [-3209.916] (-3205.544) * [-3207.030] (-3207.417) (-3214.566) (-3205.839) -- 0:02:41 482500 -- [-3202.699] (-3210.605) (-3208.538) (-3206.467) * [-3211.328] (-3214.787) (-3213.972) (-3206.819) -- 0:02:40 483000 -- (-3204.642) (-3207.145) [-3203.661] (-3207.213) * (-3211.853) [-3206.229] (-3208.990) (-3207.739) -- 0:02:40 483500 -- (-3207.845) [-3206.302] (-3203.414) (-3206.404) * [-3204.760] (-3205.249) (-3209.329) (-3210.493) -- 0:02:41 484000 -- (-3208.008) [-3209.286] (-3213.996) (-3206.776) * (-3215.647) (-3209.372) [-3208.068] (-3204.294) -- 0:02:40 484500 -- (-3208.894) [-3206.153] (-3205.429) (-3204.382) * (-3205.118) [-3206.365] (-3208.324) (-3210.279) -- 0:02:40 485000 -- (-3208.805) (-3204.640) [-3202.463] (-3202.969) * [-3204.511] (-3205.607) (-3209.581) (-3201.529) -- 0:02:40 Average standard deviation of split frequencies: 0.008730 485500 -- (-3206.178) [-3209.814] (-3206.945) (-3213.902) * (-3208.395) [-3205.496] (-3205.681) (-3216.200) -- 0:02:40 486000 -- (-3208.220) (-3211.340) (-3209.378) [-3211.487] * (-3206.381) (-3206.101) (-3211.408) [-3208.443] -- 0:02:39 486500 -- (-3207.823) (-3208.172) [-3207.321] (-3209.901) * (-3208.136) (-3208.362) [-3215.622] (-3203.827) -- 0:02:40 487000 -- (-3208.477) [-3205.588] (-3206.201) (-3211.666) * (-3207.846) (-3212.090) [-3209.345] (-3207.963) -- 0:02:40 487500 -- (-3210.340) (-3203.956) [-3206.426] (-3209.764) * (-3211.471) (-3212.173) [-3207.248] (-3212.159) -- 0:02:39 488000 -- (-3211.590) (-3214.517) (-3208.733) [-3202.653] * (-3214.295) (-3205.725) (-3206.494) [-3204.592] -- 0:02:39 488500 -- (-3206.190) (-3209.746) (-3208.792) [-3204.072] * [-3207.676] (-3210.220) (-3212.627) (-3204.870) -- 0:02:39 489000 -- (-3206.804) (-3210.124) (-3206.199) [-3212.457] * (-3206.097) (-3210.501) [-3203.291] (-3203.249) -- 0:02:38 489500 -- (-3205.487) [-3206.818] (-3209.472) (-3205.277) * (-3203.773) (-3205.580) (-3212.055) [-3208.273] -- 0:02:39 490000 -- (-3214.488) (-3210.992) (-3212.583) [-3210.689] * (-3208.786) [-3206.552] (-3208.518) (-3212.335) -- 0:02:39 Average standard deviation of split frequencies: 0.008166 490500 -- (-3210.430) [-3209.954] (-3211.101) (-3213.479) * [-3207.048] (-3205.875) (-3213.179) (-3205.099) -- 0:02:38 491000 -- (-3207.208) (-3208.828) [-3207.031] (-3206.969) * (-3204.005) (-3206.179) (-3209.603) [-3209.369] -- 0:02:38 491500 -- (-3204.784) [-3203.038] (-3211.758) (-3206.047) * (-3207.463) (-3212.107) (-3205.424) [-3202.059] -- 0:02:38 492000 -- [-3211.640] (-3207.763) (-3210.791) (-3205.616) * [-3206.472] (-3204.410) (-3204.037) (-3210.250) -- 0:02:37 492500 -- [-3205.233] (-3212.575) (-3212.370) (-3204.377) * (-3211.489) (-3204.260) [-3208.289] (-3203.233) -- 0:02:38 493000 -- (-3204.332) (-3205.881) [-3206.188] (-3209.888) * [-3207.870] (-3207.001) (-3209.044) (-3204.774) -- 0:02:38 493500 -- (-3215.940) (-3205.793) [-3204.706] (-3211.261) * (-3213.313) (-3213.188) [-3211.082] (-3215.167) -- 0:02:38 494000 -- (-3211.412) (-3204.112) [-3210.261] (-3212.204) * (-3210.360) [-3207.853] (-3215.427) (-3210.779) -- 0:02:37 494500 -- (-3205.038) (-3211.964) (-3205.787) [-3206.407] * (-3209.194) [-3201.402] (-3214.166) (-3207.108) -- 0:02:37 495000 -- (-3206.299) (-3213.490) (-3210.441) [-3208.568] * (-3209.602) [-3207.524] (-3208.300) (-3208.664) -- 0:02:37 Average standard deviation of split frequencies: 0.008079 495500 -- (-3211.290) (-3212.048) (-3210.377) [-3210.576] * [-3206.781] (-3207.756) (-3207.718) (-3211.488) -- 0:02:36 496000 -- (-3208.493) (-3211.202) [-3205.220] (-3209.000) * (-3209.422) (-3201.602) (-3208.783) [-3214.361] -- 0:02:37 496500 -- (-3212.844) (-3210.065) [-3207.081] (-3214.532) * (-3204.483) [-3206.640] (-3211.836) (-3213.429) -- 0:02:37 497000 -- (-3208.465) (-3211.373) [-3209.523] (-3211.593) * (-3204.465) [-3211.557] (-3212.525) (-3206.659) -- 0:02:36 497500 -- (-3204.136) [-3209.591] (-3209.920) (-3209.935) * (-3207.471) (-3220.582) [-3208.607] (-3209.301) -- 0:02:36 498000 -- [-3215.390] (-3209.635) (-3206.611) (-3209.591) * (-3214.740) [-3211.072] (-3209.325) (-3202.593) -- 0:02:36 498500 -- (-3214.275) (-3212.338) (-3205.473) [-3207.018] * [-3209.303] (-3209.926) (-3207.022) (-3210.692) -- 0:02:35 499000 -- (-3204.969) (-3217.100) [-3209.012] (-3206.973) * [-3209.674] (-3206.265) (-3207.920) (-3206.411) -- 0:02:36 499500 -- (-3208.216) (-3210.227) (-3206.772) [-3201.884] * [-3205.481] (-3209.916) (-3207.104) (-3206.679) -- 0:02:36 500000 -- (-3205.585) (-3210.665) (-3207.753) [-3205.184] * (-3209.865) (-3209.822) (-3213.836) [-3211.474] -- 0:02:36 Average standard deviation of split frequencies: 0.006591 500500 -- [-3204.095] (-3205.671) (-3215.262) (-3208.252) * (-3206.168) (-3214.263) [-3205.946] (-3209.804) -- 0:02:35 501000 -- (-3207.202) [-3209.920] (-3214.543) (-3205.559) * [-3211.321] (-3218.409) (-3206.539) (-3207.231) -- 0:02:35 501500 -- (-3208.042) [-3207.084] (-3207.735) (-3211.245) * [-3205.902] (-3222.605) (-3215.282) (-3207.703) -- 0:02:35 502000 -- (-3209.909) (-3204.039) [-3206.670] (-3201.998) * (-3208.060) (-3207.433) (-3206.461) [-3202.616] -- 0:02:35 502500 -- (-3204.488) [-3208.125] (-3208.613) (-3205.137) * (-3210.395) [-3209.341] (-3206.726) (-3209.917) -- 0:02:35 503000 -- [-3204.672] (-3209.541) (-3215.043) (-3204.201) * (-3203.415) [-3210.645] (-3212.157) (-3209.705) -- 0:02:35 503500 -- (-3207.292) (-3216.674) (-3212.471) [-3208.739] * (-3209.951) (-3207.253) (-3204.619) [-3208.437] -- 0:02:34 504000 -- (-3207.616) (-3205.609) (-3207.744) [-3208.396] * (-3205.933) (-3202.626) [-3207.134] (-3206.876) -- 0:02:34 504500 -- (-3210.667) (-3202.625) (-3207.914) [-3206.651] * [-3206.417] (-3206.852) (-3204.360) (-3211.770) -- 0:02:34 505000 -- (-3206.181) (-3206.724) (-3210.291) [-3211.640] * (-3210.482) (-3219.328) [-3211.835] (-3210.088) -- 0:02:33 Average standard deviation of split frequencies: 0.007453 505500 -- [-3208.699] (-3219.948) (-3215.904) (-3207.198) * (-3211.425) (-3205.101) (-3205.057) [-3207.396] -- 0:02:34 506000 -- [-3211.514] (-3215.306) (-3221.612) (-3202.603) * (-3210.596) (-3207.963) (-3204.053) [-3207.654] -- 0:02:34 506500 -- [-3214.961] (-3215.936) (-3214.298) (-3208.708) * (-3219.099) [-3203.789] (-3204.075) (-3210.259) -- 0:02:33 507000 -- (-3206.711) (-3221.046) (-3204.299) [-3205.543] * (-3215.198) (-3207.318) [-3202.958] (-3204.481) -- 0:02:33 507500 -- (-3208.359) (-3211.294) [-3207.911] (-3207.804) * (-3212.020) (-3209.207) [-3204.095] (-3208.676) -- 0:02:33 508000 -- (-3210.690) (-3207.506) (-3204.599) [-3202.890] * (-3207.616) (-3214.734) [-3206.476] (-3210.656) -- 0:02:33 508500 -- (-3206.187) [-3209.084] (-3207.472) (-3203.114) * (-3211.676) (-3214.440) [-3208.233] (-3213.656) -- 0:02:33 509000 -- [-3211.827] (-3215.612) (-3211.175) (-3203.489) * (-3205.463) (-3212.027) [-3204.713] (-3214.373) -- 0:02:33 509500 -- (-3210.049) [-3209.507] (-3204.444) (-3216.440) * (-3206.275) (-3204.776) [-3206.168] (-3215.985) -- 0:02:33 510000 -- (-3212.584) [-3202.372] (-3208.919) (-3212.521) * [-3207.785] (-3213.058) (-3210.621) (-3206.688) -- 0:02:32 Average standard deviation of split frequencies: 0.007385 510500 -- (-3212.062) [-3208.355] (-3207.047) (-3206.921) * (-3207.957) [-3216.560] (-3211.131) (-3206.092) -- 0:02:32 511000 -- [-3206.748] (-3211.620) (-3211.056) (-3209.392) * [-3206.219] (-3206.089) (-3207.279) (-3220.923) -- 0:02:33 511500 -- (-3204.216) (-3211.881) [-3207.013] (-3219.470) * [-3215.179] (-3209.665) (-3206.057) (-3209.965) -- 0:02:32 512000 -- [-3208.869] (-3209.521) (-3206.670) (-3210.091) * (-3214.026) (-3209.605) [-3205.840] (-3215.069) -- 0:02:32 512500 -- (-3208.831) (-3216.342) (-3210.479) [-3205.919] * (-3206.418) (-3205.576) (-3206.439) [-3207.827] -- 0:02:32 513000 -- (-3211.171) [-3204.801] (-3213.137) (-3215.320) * (-3208.194) [-3207.581] (-3207.570) (-3209.456) -- 0:02:31 513500 -- (-3205.510) (-3205.765) [-3205.792] (-3211.246) * (-3204.660) (-3207.838) [-3203.636] (-3211.119) -- 0:02:31 514000 -- [-3203.407] (-3211.257) (-3208.707) (-3204.704) * (-3215.025) (-3204.694) (-3211.305) [-3216.001] -- 0:02:31 514500 -- [-3205.465] (-3210.964) (-3210.580) (-3206.820) * (-3210.252) (-3202.629) (-3212.787) [-3209.783] -- 0:02:31 515000 -- (-3210.901) [-3205.106] (-3205.682) (-3207.379) * (-3210.129) (-3210.045) (-3208.126) [-3207.371] -- 0:02:31 Average standard deviation of split frequencies: 0.009136 515500 -- (-3209.890) [-3207.228] (-3205.007) (-3204.368) * (-3207.401) (-3206.287) (-3214.621) [-3205.679] -- 0:02:31 516000 -- (-3215.349) [-3206.393] (-3203.603) (-3208.173) * [-3202.367] (-3207.728) (-3206.954) (-3205.008) -- 0:02:31 516500 -- (-3207.683) (-3210.212) (-3211.278) [-3204.995] * (-3213.670) [-3212.013] (-3213.753) (-3207.079) -- 0:02:30 517000 -- (-3210.988) (-3214.712) [-3208.059] (-3206.443) * (-3205.146) [-3204.435] (-3211.188) (-3206.410) -- 0:02:30 517500 -- (-3209.860) (-3217.152) (-3210.110) [-3210.409] * (-3207.182) [-3208.806] (-3209.491) (-3211.343) -- 0:02:31 518000 -- (-3208.385) (-3210.084) (-3205.303) [-3204.429] * [-3205.821] (-3212.318) (-3209.728) (-3208.294) -- 0:02:30 518500 -- (-3205.853) (-3206.419) (-3209.046) [-3209.417] * (-3206.226) [-3206.362] (-3214.299) (-3207.668) -- 0:02:30 519000 -- [-3205.601] (-3213.124) (-3211.595) (-3210.854) * (-3206.028) (-3206.387) (-3214.662) [-3206.066] -- 0:02:30 519500 -- (-3212.873) (-3206.923) [-3205.417] (-3206.223) * (-3206.018) [-3208.088] (-3215.963) (-3211.966) -- 0:02:29 520000 -- (-3214.550) (-3208.509) (-3209.553) [-3205.462] * (-3216.182) [-3207.747] (-3209.961) (-3204.373) -- 0:02:30 Average standard deviation of split frequencies: 0.009507 520500 -- (-3209.905) [-3207.603] (-3216.503) (-3207.102) * (-3207.860) (-3211.473) [-3204.584] (-3211.036) -- 0:02:30 521000 -- (-3206.967) (-3213.526) [-3206.879] (-3205.789) * [-3202.591] (-3206.698) (-3209.011) (-3206.673) -- 0:02:29 521500 -- [-3213.316] (-3216.376) (-3210.945) (-3206.108) * (-3207.885) (-3209.595) (-3207.115) [-3207.329] -- 0:02:29 522000 -- (-3217.242) (-3214.684) [-3209.746] (-3207.278) * (-3211.517) (-3209.650) [-3215.643] (-3212.750) -- 0:02:30 522500 -- (-3207.448) (-3207.743) [-3206.183] (-3203.516) * [-3218.033] (-3215.647) (-3212.986) (-3218.903) -- 0:02:29 523000 -- (-3210.302) [-3208.269] (-3202.626) (-3203.153) * (-3206.642) [-3205.238] (-3213.197) (-3212.224) -- 0:02:29 523500 -- [-3202.957] (-3205.413) (-3201.843) (-3205.549) * (-3206.258) [-3209.899] (-3211.397) (-3207.969) -- 0:02:29 524000 -- (-3203.208) (-3205.509) (-3205.022) [-3204.443] * [-3213.440] (-3207.041) (-3209.187) (-3204.466) -- 0:02:28 524500 -- [-3208.967] (-3215.862) (-3203.411) (-3204.980) * (-3213.187) (-3207.630) (-3209.124) [-3204.738] -- 0:02:28 525000 -- (-3214.057) (-3213.730) (-3205.359) [-3207.243] * (-3206.885) [-3207.724] (-3206.609) (-3203.805) -- 0:02:28 Average standard deviation of split frequencies: 0.008962 525500 -- (-3213.941) (-3213.178) [-3204.103] (-3213.223) * (-3214.067) (-3203.959) [-3209.194] (-3203.450) -- 0:02:28 526000 -- (-3205.683) [-3207.357] (-3209.595) (-3212.669) * (-3208.058) (-3209.420) [-3206.277] (-3209.209) -- 0:02:28 526500 -- (-3211.448) (-3212.026) (-3207.063) [-3206.004] * (-3210.568) (-3204.676) (-3202.928) [-3204.125] -- 0:02:28 527000 -- [-3206.568] (-3216.365) (-3206.878) (-3210.719) * (-3214.898) (-3205.864) (-3210.267) [-3204.152] -- 0:02:28 527500 -- [-3206.932] (-3220.624) (-3208.910) (-3208.149) * [-3206.517] (-3209.141) (-3206.558) (-3216.418) -- 0:02:27 528000 -- (-3206.941) [-3206.617] (-3204.482) (-3212.049) * (-3207.674) (-3208.673) (-3208.821) [-3213.409] -- 0:02:27 528500 -- (-3207.437) (-3208.147) [-3203.175] (-3209.587) * (-3207.811) [-3210.893] (-3205.802) (-3210.901) -- 0:02:28 529000 -- (-3203.805) (-3211.414) (-3202.459) [-3205.514] * [-3207.968] (-3214.930) (-3210.438) (-3209.217) -- 0:02:27 529500 -- (-3210.830) (-3211.878) [-3204.992] (-3207.778) * [-3208.865] (-3208.265) (-3215.332) (-3206.315) -- 0:02:27 530000 -- [-3212.242] (-3207.308) (-3209.083) (-3211.753) * (-3213.256) [-3205.848] (-3208.987) (-3209.637) -- 0:02:27 Average standard deviation of split frequencies: 0.008439 530500 -- (-3215.759) (-3205.057) [-3206.531] (-3209.403) * (-3210.592) (-3207.143) [-3206.287] (-3213.229) -- 0:02:26 531000 -- (-3211.510) [-3207.054] (-3208.693) (-3211.757) * (-3204.186) (-3210.549) [-3207.424] (-3216.716) -- 0:02:26 531500 -- (-3209.866) (-3208.361) [-3208.698] (-3209.867) * [-3204.938] (-3216.663) (-3206.429) (-3212.995) -- 0:02:27 532000 -- (-3208.534) (-3204.635) [-3207.020] (-3207.692) * (-3213.012) (-3210.381) [-3209.159] (-3208.651) -- 0:02:26 532500 -- (-3211.357) (-3209.361) [-3211.205] (-3203.699) * (-3207.463) (-3210.475) [-3207.509] (-3210.807) -- 0:02:26 533000 -- (-3211.939) (-3204.624) (-3206.027) [-3204.472] * (-3208.243) (-3205.212) (-3208.160) [-3210.176] -- 0:02:26 533500 -- (-3211.310) [-3206.280] (-3215.632) (-3207.968) * (-3209.803) (-3204.373) [-3208.924] (-3211.662) -- 0:02:26 534000 -- [-3211.477] (-3206.464) (-3217.428) (-3203.154) * (-3210.914) (-3209.880) [-3203.397] (-3204.888) -- 0:02:25 534500 -- (-3212.067) [-3207.484] (-3208.144) (-3205.831) * [-3203.102] (-3212.271) (-3205.560) (-3209.347) -- 0:02:26 535000 -- (-3206.661) (-3213.334) [-3206.187] (-3208.225) * (-3204.216) (-3210.053) [-3206.709] (-3205.928) -- 0:02:26 Average standard deviation of split frequencies: 0.008355 535500 -- (-3224.491) (-3206.231) (-3204.401) [-3207.811] * (-3207.667) [-3205.172] (-3209.667) (-3209.654) -- 0:02:25 536000 -- (-3213.613) (-3205.382) [-3210.658] (-3208.617) * (-3209.782) (-3212.551) (-3205.450) [-3205.017] -- 0:02:25 536500 -- [-3202.852] (-3216.605) (-3207.262) (-3207.588) * (-3211.809) [-3209.564] (-3215.351) (-3207.604) -- 0:02:25 537000 -- (-3204.972) (-3218.360) (-3213.379) [-3205.809] * (-3212.609) (-3207.206) (-3207.306) [-3210.959] -- 0:02:24 537500 -- (-3214.241) (-3211.438) [-3210.124] (-3206.243) * (-3209.429) (-3210.777) (-3205.483) [-3202.694] -- 0:02:24 538000 -- [-3215.275] (-3206.966) (-3203.820) (-3199.558) * (-3207.355) (-3214.451) (-3205.082) [-3209.025] -- 0:02:25 538500 -- (-3206.141) [-3210.290] (-3206.133) (-3207.365) * (-3210.461) (-3210.407) (-3204.045) [-3203.635] -- 0:02:24 539000 -- (-3207.025) (-3216.420) (-3205.852) [-3205.920] * [-3209.607] (-3205.727) (-3208.680) (-3211.152) -- 0:02:24 539500 -- (-3210.131) (-3218.894) (-3207.086) [-3212.242] * (-3203.944) (-3206.137) [-3207.384] (-3205.676) -- 0:02:24 540000 -- [-3212.518] (-3230.387) (-3208.130) (-3207.843) * (-3215.140) (-3205.013) (-3209.680) [-3203.471] -- 0:02:23 Average standard deviation of split frequencies: 0.008283 540500 -- [-3202.685] (-3208.645) (-3209.935) (-3207.729) * (-3210.025) [-3201.642] (-3209.155) (-3210.442) -- 0:02:23 541000 -- [-3210.779] (-3210.963) (-3216.378) (-3206.678) * (-3212.070) (-3207.297) [-3204.105] (-3210.642) -- 0:02:24 541500 -- [-3204.563] (-3213.741) (-3211.090) (-3202.198) * (-3210.921) (-3205.904) [-3206.987] (-3205.728) -- 0:02:23 542000 -- (-3204.815) (-3211.492) (-3208.640) [-3207.947] * (-3210.519) (-3210.666) (-3214.516) [-3207.087] -- 0:02:23 542500 -- (-3206.192) [-3209.469] (-3207.863) (-3208.727) * (-3208.795) [-3202.389] (-3207.794) (-3207.216) -- 0:02:23 543000 -- (-3208.022) [-3207.218] (-3210.577) (-3208.937) * [-3206.180] (-3213.998) (-3209.250) (-3206.271) -- 0:02:23 543500 -- (-3206.773) (-3207.504) (-3208.439) [-3208.593] * (-3207.726) (-3212.759) [-3208.982] (-3213.291) -- 0:02:22 544000 -- (-3206.460) (-3210.246) (-3209.825) [-3212.678] * [-3204.345] (-3214.188) (-3207.244) (-3212.765) -- 0:02:22 544500 -- [-3203.575] (-3204.942) (-3209.195) (-3209.751) * (-3203.921) (-3214.141) (-3206.763) [-3208.798] -- 0:02:23 545000 -- [-3208.306] (-3208.516) (-3213.048) (-3203.755) * (-3210.073) [-3208.820] (-3206.558) (-3211.263) -- 0:02:22 Average standard deviation of split frequencies: 0.006907 545500 -- [-3203.340] (-3205.478) (-3209.698) (-3206.638) * [-3205.024] (-3211.130) (-3209.129) (-3206.807) -- 0:02:22 546000 -- (-3205.152) [-3206.914] (-3216.517) (-3201.641) * (-3207.721) (-3204.174) [-3204.820] (-3208.696) -- 0:02:22 546500 -- [-3205.021] (-3209.113) (-3203.172) (-3206.826) * [-3211.229] (-3207.308) (-3208.672) (-3209.085) -- 0:02:21 547000 -- [-3208.066] (-3206.042) (-3206.605) (-3203.367) * (-3208.998) (-3211.925) (-3205.034) [-3212.970] -- 0:02:21 547500 -- (-3202.681) (-3213.032) (-3210.736) [-3207.038] * (-3216.169) (-3208.408) (-3203.995) [-3213.317] -- 0:02:22 548000 -- (-3211.587) (-3209.310) [-3204.513] (-3208.897) * (-3210.527) [-3203.815] (-3212.292) (-3212.132) -- 0:02:21 548500 -- (-3205.944) (-3204.990) [-3204.138] (-3211.091) * (-3210.785) (-3210.870) (-3206.872) [-3209.977] -- 0:02:21 549000 -- (-3224.229) (-3203.977) [-3214.648] (-3211.625) * (-3209.664) [-3211.464] (-3218.785) (-3213.526) -- 0:02:21 549500 -- (-3219.861) (-3210.690) [-3208.980] (-3209.801) * [-3206.595] (-3206.884) (-3205.500) (-3206.080) -- 0:02:21 550000 -- (-3214.068) (-3208.430) (-3205.562) [-3209.882] * (-3205.869) (-3211.434) (-3204.974) [-3207.618] -- 0:02:20 Average standard deviation of split frequencies: 0.006848 550500 -- (-3212.493) (-3209.804) [-3209.218] (-3213.251) * [-3207.514] (-3214.739) (-3208.649) (-3208.627) -- 0:02:20 551000 -- (-3205.007) (-3209.254) (-3214.000) [-3209.828] * (-3211.474) [-3209.297] (-3207.771) (-3211.521) -- 0:02:20 551500 -- (-3207.921) [-3203.162] (-3205.938) (-3206.801) * (-3208.838) (-3215.575) [-3204.948] (-3213.704) -- 0:02:20 552000 -- (-3207.506) [-3204.367] (-3206.896) (-3208.140) * (-3214.178) (-3210.972) [-3213.706] (-3212.883) -- 0:02:20 552500 -- [-3204.050] (-3203.317) (-3206.331) (-3212.959) * (-3208.415) [-3211.428] (-3218.273) (-3215.584) -- 0:02:20 553000 -- (-3205.033) (-3213.653) (-3205.558) [-3204.476] * (-3208.489) [-3208.153] (-3213.177) (-3212.332) -- 0:02:19 553500 -- (-3204.767) [-3207.371] (-3208.408) (-3206.654) * (-3206.038) [-3203.773] (-3210.072) (-3206.705) -- 0:02:19 554000 -- [-3209.063] (-3206.070) (-3212.619) (-3208.315) * [-3202.949] (-3204.715) (-3206.833) (-3206.826) -- 0:02:20 554500 -- [-3208.219] (-3211.101) (-3204.508) (-3204.970) * (-3209.232) (-3208.554) (-3208.934) [-3209.035] -- 0:02:19 555000 -- [-3206.797] (-3216.728) (-3208.579) (-3216.632) * (-3209.749) [-3203.998] (-3213.800) (-3212.661) -- 0:02:19 Average standard deviation of split frequencies: 0.006783 555500 -- (-3206.220) (-3208.212) [-3214.309] (-3210.519) * (-3210.983) (-3209.547) [-3205.120] (-3210.686) -- 0:02:19 556000 -- [-3206.087] (-3206.276) (-3208.313) (-3209.955) * (-3211.538) (-3209.382) [-3203.523] (-3207.660) -- 0:02:18 556500 -- (-3207.413) [-3205.089] (-3206.317) (-3207.114) * (-3207.206) (-3204.095) (-3207.342) [-3209.801] -- 0:02:18 557000 -- (-3204.194) [-3209.563] (-3205.704) (-3217.661) * (-3207.268) [-3207.523] (-3204.066) (-3213.364) -- 0:02:18 557500 -- (-3210.104) (-3208.993) [-3205.075] (-3209.807) * (-3208.691) (-3205.895) (-3214.009) [-3213.078] -- 0:02:18 558000 -- (-3205.753) (-3207.766) [-3206.266] (-3207.348) * (-3206.556) [-3201.189] (-3210.627) (-3211.777) -- 0:02:18 558500 -- (-3203.481) (-3215.645) [-3208.502] (-3209.541) * [-3208.603] (-3204.203) (-3207.385) (-3209.847) -- 0:02:18 559000 -- [-3207.407] (-3208.586) (-3203.492) (-3202.397) * (-3210.656) (-3205.914) (-3208.395) [-3204.243] -- 0:02:18 559500 -- [-3211.064] (-3208.467) (-3203.462) (-3204.996) * (-3208.545) (-3209.737) [-3209.090] (-3205.157) -- 0:02:17 560000 -- (-3207.768) (-3211.346) [-3207.406] (-3209.204) * [-3212.939] (-3207.469) (-3208.621) (-3205.150) -- 0:02:17 Average standard deviation of split frequencies: 0.005886 560500 -- (-3209.327) [-3203.929] (-3205.660) (-3209.612) * (-3213.467) [-3210.792] (-3210.712) (-3208.208) -- 0:02:18 561000 -- (-3209.301) (-3209.914) [-3212.005] (-3210.763) * (-3212.206) (-3214.604) (-3212.506) [-3207.897] -- 0:02:17 561500 -- (-3206.377) (-3208.941) (-3205.399) [-3207.608] * (-3212.068) (-3205.441) (-3209.027) [-3208.839] -- 0:02:17 562000 -- [-3212.004] (-3205.997) (-3209.008) (-3212.846) * (-3203.093) [-3201.553] (-3218.294) (-3208.502) -- 0:02:17 562500 -- (-3204.499) (-3211.019) [-3206.307] (-3210.924) * [-3203.473] (-3218.669) (-3210.858) (-3208.884) -- 0:02:16 563000 -- (-3209.526) [-3207.890] (-3212.805) (-3209.679) * (-3203.215) [-3206.615] (-3222.044) (-3209.040) -- 0:02:16 563500 -- (-3203.675) (-3212.208) [-3209.327] (-3203.940) * (-3213.871) (-3207.752) (-3204.847) [-3209.463] -- 0:02:16 564000 -- (-3210.824) [-3211.179] (-3203.572) (-3204.980) * (-3213.740) [-3212.446] (-3212.130) (-3206.569) -- 0:02:16 564500 -- (-3217.088) [-3206.970] (-3208.363) (-3205.577) * [-3208.877] (-3207.561) (-3209.076) (-3207.865) -- 0:02:16 565000 -- (-3215.813) (-3205.824) [-3211.796] (-3205.362) * [-3204.953] (-3204.964) (-3210.498) (-3216.199) -- 0:02:16 Average standard deviation of split frequencies: 0.007079 565500 -- (-3212.699) (-3211.488) (-3206.240) [-3208.960] * (-3203.228) (-3208.059) [-3205.484] (-3209.638) -- 0:02:15 566000 -- (-3213.145) (-3209.162) (-3210.166) [-3207.128] * (-3211.376) (-3205.070) [-3213.631] (-3207.678) -- 0:02:15 566500 -- [-3205.063] (-3207.512) (-3205.610) (-3211.431) * (-3203.576) (-3208.606) [-3211.493] (-3210.770) -- 0:02:15 567000 -- (-3202.946) (-3214.297) [-3208.104] (-3208.766) * (-3207.264) (-3210.319) [-3206.872] (-3211.193) -- 0:02:15 567500 -- (-3206.688) (-3213.497) [-3203.742] (-3210.539) * (-3219.878) [-3205.366] (-3210.783) (-3207.938) -- 0:02:15 568000 -- (-3209.270) [-3203.355] (-3211.278) (-3205.215) * (-3215.023) [-3214.897] (-3214.082) (-3210.033) -- 0:02:15 568500 -- (-3207.396) (-3206.575) (-3214.568) [-3210.264] * (-3208.020) [-3210.748] (-3206.766) (-3204.890) -- 0:02:15 569000 -- (-3204.791) [-3209.873] (-3207.767) (-3208.363) * (-3209.829) (-3210.272) (-3206.041) [-3208.573] -- 0:02:14 569500 -- (-3213.349) (-3210.204) (-3207.190) [-3208.370] * (-3207.775) (-3205.233) [-3204.394] (-3208.740) -- 0:02:14 570000 -- (-3205.732) [-3205.508] (-3207.524) (-3209.969) * (-3212.108) (-3204.862) [-3204.676] (-3208.287) -- 0:02:15 Average standard deviation of split frequencies: 0.006608 570500 -- (-3209.658) (-3208.516) [-3205.266] (-3204.810) * (-3206.421) [-3209.107] (-3214.742) (-3203.539) -- 0:02:14 571000 -- (-3207.373) (-3213.311) (-3208.300) [-3205.184] * (-3200.832) (-3209.832) (-3203.395) [-3207.461] -- 0:02:14 571500 -- (-3210.254) (-3208.151) (-3209.926) [-3209.870] * (-3205.325) [-3210.332] (-3215.068) (-3209.772) -- 0:02:14 572000 -- [-3205.154] (-3208.787) (-3209.370) (-3200.904) * [-3212.732] (-3205.703) (-3211.769) (-3210.115) -- 0:02:13 572500 -- (-3207.767) (-3206.181) (-3208.412) [-3210.316] * (-3213.259) [-3213.002] (-3207.058) (-3210.197) -- 0:02:13 573000 -- (-3210.766) (-3204.125) (-3204.562) [-3209.407] * (-3204.974) (-3204.162) [-3211.058] (-3209.850) -- 0:02:13 573500 -- [-3207.536] (-3206.973) (-3208.220) (-3207.852) * (-3208.221) [-3207.535] (-3205.360) (-3209.924) -- 0:02:13 574000 -- (-3216.984) [-3207.863] (-3205.250) (-3205.552) * (-3204.804) (-3203.827) (-3206.341) [-3208.980] -- 0:02:13 574500 -- (-3214.311) (-3209.201) (-3207.975) [-3206.245] * (-3205.841) (-3204.109) [-3201.922] (-3219.380) -- 0:02:13 575000 -- (-3213.446) (-3204.941) [-3203.536] (-3225.443) * [-3201.576] (-3210.785) (-3208.142) (-3210.949) -- 0:02:13 Average standard deviation of split frequencies: 0.008184 575500 -- (-3209.126) [-3206.955] (-3212.761) (-3214.010) * (-3209.541) [-3208.343] (-3205.169) (-3215.066) -- 0:02:12 576000 -- (-3208.465) (-3204.436) [-3206.368] (-3211.685) * [-3204.449] (-3209.947) (-3207.158) (-3211.108) -- 0:02:12 576500 -- [-3207.327] (-3212.906) (-3213.651) (-3208.309) * (-3205.911) (-3222.428) [-3207.890] (-3210.043) -- 0:02:12 577000 -- [-3215.419] (-3204.093) (-3212.296) (-3206.124) * (-3209.447) [-3208.804] (-3211.923) (-3215.845) -- 0:02:12 577500 -- (-3211.287) (-3206.165) (-3220.643) [-3203.276] * [-3207.527] (-3205.554) (-3216.199) (-3212.176) -- 0:02:12 578000 -- (-3210.568) [-3205.309] (-3208.416) (-3210.787) * [-3203.665] (-3203.898) (-3219.383) (-3206.475) -- 0:02:12 578500 -- (-3214.738) [-3208.939] (-3207.246) (-3214.927) * (-3209.022) (-3209.825) (-3213.643) [-3205.975] -- 0:02:11 579000 -- (-3210.672) [-3211.334] (-3211.867) (-3216.737) * [-3206.752] (-3210.734) (-3208.182) (-3205.255) -- 0:02:11 579500 -- (-3206.232) [-3208.641] (-3209.383) (-3208.090) * (-3211.197) (-3207.262) (-3206.766) [-3208.562] -- 0:02:11 580000 -- (-3208.723) [-3204.587] (-3207.712) (-3209.119) * (-3204.817) (-3212.209) [-3212.636] (-3207.429) -- 0:02:11 Average standard deviation of split frequencies: 0.008118 580500 -- (-3205.366) (-3203.941) [-3210.542] (-3204.621) * [-3204.418] (-3210.491) (-3212.915) (-3211.842) -- 0:02:11 581000 -- [-3203.075] (-3204.891) (-3206.437) (-3209.521) * [-3209.011] (-3213.483) (-3210.458) (-3202.049) -- 0:02:11 581500 -- (-3204.852) (-3209.118) [-3204.127] (-3212.674) * [-3206.540] (-3206.370) (-3210.598) (-3205.341) -- 0:02:10 582000 -- (-3205.563) (-3205.668) (-3206.825) [-3203.495] * [-3212.424] (-3207.793) (-3207.816) (-3205.449) -- 0:02:10 582500 -- [-3200.081] (-3209.769) (-3206.863) (-3205.672) * (-3209.306) (-3208.540) [-3210.444] (-3209.541) -- 0:02:10 583000 -- [-3207.697] (-3213.947) (-3214.377) (-3210.029) * (-3204.757) (-3213.844) (-3210.216) [-3203.932] -- 0:02:10 583500 -- [-3207.119] (-3207.995) (-3208.717) (-3205.860) * (-3210.381) (-3207.713) (-3210.859) [-3205.447] -- 0:02:10 584000 -- [-3208.069] (-3209.033) (-3217.814) (-3207.567) * (-3208.329) (-3215.127) (-3210.230) [-3206.290] -- 0:02:10 584500 -- (-3209.570) [-3212.076] (-3210.199) (-3210.870) * (-3212.879) [-3203.385] (-3209.702) (-3210.326) -- 0:02:10 585000 -- (-3203.334) (-3209.746) (-3209.966) [-3209.410] * (-3209.193) (-3208.282) [-3208.976] (-3214.301) -- 0:02:09 Average standard deviation of split frequencies: 0.008447 585500 -- (-3206.155) (-3208.290) (-3212.710) [-3209.915] * (-3208.097) (-3212.489) [-3201.862] (-3204.576) -- 0:02:09 586000 -- (-3212.136) (-3211.965) [-3209.288] (-3209.213) * (-3215.151) [-3207.391] (-3207.948) (-3207.848) -- 0:02:09 586500 -- (-3208.872) [-3205.622] (-3210.053) (-3213.095) * [-3207.793] (-3207.229) (-3208.499) (-3211.769) -- 0:02:09 587000 -- (-3204.481) (-3205.750) (-3202.440) [-3209.355] * (-3205.485) [-3216.440] (-3205.325) (-3206.294) -- 0:02:09 587500 -- (-3210.431) (-3208.477) [-3206.765] (-3218.850) * (-3212.977) (-3204.116) (-3213.934) [-3205.741] -- 0:02:09 588000 -- (-3203.493) (-3209.754) (-3205.973) [-3204.784] * (-3213.438) [-3204.200] (-3208.265) (-3203.676) -- 0:02:08 588500 -- [-3208.394] (-3212.627) (-3211.064) (-3210.865) * (-3207.618) (-3209.969) (-3213.974) [-3209.178] -- 0:02:08 589000 -- (-3209.756) (-3206.773) [-3204.525] (-3202.867) * (-3208.433) [-3210.715] (-3217.380) (-3212.257) -- 0:02:08 589500 -- (-3223.119) [-3209.692] (-3204.223) (-3206.059) * [-3203.892] (-3208.484) (-3218.788) (-3211.057) -- 0:02:08 590000 -- (-3213.872) [-3206.246] (-3211.388) (-3203.927) * (-3208.884) (-3203.669) (-3211.806) [-3204.904] -- 0:02:08 Average standard deviation of split frequencies: 0.009178 590500 -- (-3208.919) [-3211.568] (-3208.834) (-3201.243) * (-3208.484) (-3211.854) [-3206.339] (-3203.393) -- 0:02:08 591000 -- (-3201.275) (-3208.870) (-3208.019) [-3204.980] * (-3211.343) (-3204.790) (-3207.689) [-3212.991] -- 0:02:08 591500 -- (-3205.892) [-3204.095] (-3209.779) (-3207.254) * (-3208.674) [-3209.257] (-3210.016) (-3205.948) -- 0:02:07 592000 -- (-3204.846) [-3209.627] (-3206.199) (-3205.932) * (-3210.685) (-3211.807) [-3206.890] (-3209.077) -- 0:02:07 592500 -- (-3208.660) (-3211.942) (-3215.791) [-3201.233] * (-3204.988) (-3207.679) [-3208.671] (-3204.293) -- 0:02:07 593000 -- (-3204.829) [-3205.790] (-3213.498) (-3218.139) * (-3210.731) (-3208.766) [-3208.107] (-3208.427) -- 0:02:07 593500 -- (-3206.177) (-3205.768) (-3210.975) [-3212.234] * (-3208.343) (-3208.133) (-3208.024) [-3206.543] -- 0:02:07 594000 -- (-3221.530) [-3209.346] (-3203.944) (-3205.534) * [-3205.750] (-3214.163) (-3209.704) (-3209.283) -- 0:02:07 594500 -- (-3209.219) (-3209.972) [-3206.765] (-3208.129) * (-3214.223) [-3206.661] (-3218.575) (-3209.304) -- 0:02:06 595000 -- (-3211.357) [-3208.751] (-3205.259) (-3210.347) * (-3208.474) (-3206.097) [-3205.184] (-3214.385) -- 0:02:06 Average standard deviation of split frequencies: 0.010282 595500 -- (-3214.015) [-3205.716] (-3214.244) (-3213.064) * (-3208.552) (-3204.633) (-3212.233) [-3205.742] -- 0:02:06 596000 -- (-3214.040) (-3206.973) (-3213.842) [-3213.226] * [-3211.746] (-3211.508) (-3206.951) (-3203.118) -- 0:02:06 596500 -- (-3209.020) (-3203.160) (-3205.757) [-3206.496] * (-3214.292) (-3203.833) (-3205.883) [-3207.430] -- 0:02:06 597000 -- [-3205.209] (-3209.174) (-3208.993) (-3208.121) * [-3203.926] (-3204.341) (-3205.721) (-3205.756) -- 0:02:06 597500 -- (-3212.738) [-3205.746] (-3210.285) (-3212.418) * (-3211.697) (-3210.170) (-3207.646) [-3206.916] -- 0:02:05 598000 -- (-3208.363) (-3209.193) (-3211.981) [-3207.763] * (-3206.775) [-3205.477] (-3204.681) (-3207.173) -- 0:02:05 598500 -- (-3212.974) (-3204.792) (-3208.533) [-3203.928] * [-3205.469] (-3211.840) (-3205.629) (-3208.152) -- 0:02:05 599000 -- (-3213.891) [-3204.625] (-3211.512) (-3209.323) * (-3203.173) (-3208.597) (-3204.214) [-3204.650] -- 0:02:05 599500 -- (-3218.829) [-3206.303] (-3212.239) (-3213.066) * [-3211.499] (-3213.008) (-3204.148) (-3205.632) -- 0:02:05 600000 -- [-3211.257] (-3207.381) (-3207.393) (-3210.102) * (-3207.707) (-3211.902) [-3205.276] (-3210.814) -- 0:02:05 Average standard deviation of split frequencies: 0.009810 600500 -- (-3208.860) (-3210.963) [-3212.430] (-3203.164) * (-3203.500) (-3209.804) [-3202.363] (-3203.843) -- 0:02:05 601000 -- (-3210.891) (-3210.946) (-3203.072) [-3208.317] * [-3208.408] (-3210.540) (-3207.117) (-3215.385) -- 0:02:04 601500 -- (-3203.693) (-3205.840) [-3206.914] (-3209.811) * (-3226.935) [-3208.586] (-3207.482) (-3213.497) -- 0:02:04 602000 -- [-3207.052] (-3211.999) (-3211.372) (-3208.106) * [-3210.128] (-3216.872) (-3206.139) (-3206.178) -- 0:02:04 602500 -- (-3215.495) [-3211.990] (-3206.882) (-3212.412) * (-3201.299) [-3205.424] (-3205.936) (-3205.616) -- 0:02:04 603000 -- (-3208.788) (-3212.259) (-3212.039) [-3208.270] * (-3206.033) (-3207.253) (-3208.795) [-3205.410] -- 0:02:04 603500 -- (-3206.568) [-3213.527] (-3208.238) (-3211.272) * (-3210.836) [-3203.264] (-3209.817) (-3208.017) -- 0:02:04 604000 -- (-3213.055) (-3213.163) (-3210.472) [-3207.838] * (-3210.506) [-3206.587] (-3206.021) (-3206.176) -- 0:02:03 604500 -- (-3214.367) (-3210.553) (-3205.533) [-3209.829] * (-3209.249) (-3209.284) (-3219.753) [-3208.418] -- 0:02:03 605000 -- (-3208.213) (-3206.545) [-3205.388] (-3211.728) * [-3205.796] (-3209.673) (-3220.967) (-3207.248) -- 0:02:03 Average standard deviation of split frequencies: 0.010113 605500 -- (-3205.992) (-3214.584) (-3200.798) [-3206.585] * (-3204.660) (-3207.773) [-3214.037] (-3210.539) -- 0:02:03 606000 -- (-3203.967) [-3211.809] (-3204.582) (-3205.786) * (-3209.195) (-3208.665) [-3208.154] (-3209.584) -- 0:02:03 606500 -- [-3206.132] (-3209.832) (-3207.851) (-3209.522) * (-3208.433) [-3205.173] (-3207.113) (-3212.622) -- 0:02:03 607000 -- (-3209.473) [-3206.723] (-3212.715) (-3219.700) * (-3212.057) [-3204.934] (-3209.415) (-3202.503) -- 0:02:03 607500 -- (-3210.535) [-3213.061] (-3207.182) (-3209.506) * [-3214.788] (-3206.694) (-3212.680) (-3209.228) -- 0:02:02 608000 -- (-3213.414) (-3201.804) [-3209.430] (-3211.327) * [-3207.732] (-3203.246) (-3211.906) (-3209.903) -- 0:02:02 608500 -- (-3213.096) (-3210.963) (-3209.242) [-3207.527] * (-3210.782) [-3206.885] (-3209.871) (-3206.662) -- 0:02:02 609000 -- (-3208.757) (-3212.254) (-3218.252) [-3206.489] * [-3203.703] (-3207.934) (-3210.562) (-3207.077) -- 0:02:02 609500 -- (-3209.458) [-3205.802] (-3213.286) (-3207.882) * (-3208.865) [-3209.366] (-3211.391) (-3207.092) -- 0:02:02 610000 -- (-3210.763) (-3203.474) (-3210.329) [-3208.984] * (-3205.248) (-3209.922) [-3208.582] (-3207.746) -- 0:02:02 Average standard deviation of split frequencies: 0.011579 610500 -- [-3206.996] (-3205.432) (-3207.962) (-3215.089) * (-3208.086) (-3207.943) (-3213.028) [-3203.974] -- 0:02:01 611000 -- (-3216.076) (-3206.587) (-3205.034) [-3207.874] * (-3209.891) (-3212.241) (-3214.992) [-3203.996] -- 0:02:01 611500 -- (-3210.149) (-3206.349) (-3206.292) [-3210.337] * (-3205.291) (-3213.822) (-3217.119) [-3206.045] -- 0:02:01 612000 -- (-3211.068) (-3207.071) (-3206.450) [-3206.181] * [-3207.955] (-3212.064) (-3215.559) (-3210.752) -- 0:02:01 612500 -- (-3211.547) (-3209.324) (-3208.272) [-3202.884] * (-3205.440) (-3211.141) [-3208.951] (-3204.317) -- 0:02:01 613000 -- (-3207.239) (-3205.641) (-3209.242) [-3209.003] * [-3214.717] (-3226.343) (-3210.496) (-3203.818) -- 0:02:01 613500 -- (-3211.439) [-3207.887] (-3208.963) (-3209.073) * (-3211.433) [-3216.369] (-3208.753) (-3215.272) -- 0:02:00 614000 -- (-3209.968) (-3208.163) (-3204.987) [-3210.253] * (-3216.914) (-3207.743) [-3203.262] (-3215.507) -- 0:02:00 614500 -- (-3212.772) (-3207.009) [-3205.375] (-3214.307) * [-3206.323] (-3211.459) (-3205.393) (-3204.608) -- 0:02:00 615000 -- (-3211.858) (-3206.403) [-3214.265] (-3206.412) * (-3205.577) (-3209.062) (-3204.617) [-3211.580] -- 0:02:00 Average standard deviation of split frequencies: 0.012627 615500 -- (-3212.363) (-3207.976) [-3211.769] (-3217.108) * [-3204.567] (-3206.762) (-3212.125) (-3208.145) -- 0:02:00 616000 -- (-3202.515) [-3208.916] (-3209.025) (-3206.726) * [-3203.435] (-3214.991) (-3209.886) (-3206.554) -- 0:02:00 616500 -- (-3212.264) [-3207.890] (-3211.362) (-3212.811) * (-3207.739) (-3206.162) (-3202.340) [-3206.857] -- 0:02:00 617000 -- (-3217.554) (-3209.974) [-3211.687] (-3212.711) * (-3205.220) (-3205.710) (-3205.416) [-3208.625] -- 0:01:59 617500 -- (-3208.508) (-3205.271) (-3204.801) [-3211.239] * (-3206.880) (-3205.554) [-3209.316] (-3206.584) -- 0:01:59 618000 -- (-3215.266) (-3205.479) [-3208.725] (-3209.527) * (-3213.138) (-3214.590) (-3209.520) [-3211.697] -- 0:01:59 618500 -- (-3206.071) (-3208.057) (-3210.266) [-3208.755] * (-3208.904) (-3211.857) [-3209.386] (-3213.076) -- 0:01:59 619000 -- (-3209.829) (-3207.766) [-3206.385] (-3204.777) * (-3205.946) (-3208.189) (-3211.703) [-3214.769] -- 0:01:59 619500 -- (-3212.594) [-3207.946] (-3208.752) (-3209.247) * [-3204.035] (-3215.454) (-3210.013) (-3204.989) -- 0:01:59 620000 -- (-3206.346) [-3206.008] (-3207.178) (-3203.867) * (-3208.653) (-3210.347) (-3205.187) [-3205.276] -- 0:01:58 Average standard deviation of split frequencies: 0.013291 620500 -- (-3206.424) (-3213.294) [-3204.962] (-3208.969) * (-3215.572) (-3211.833) (-3205.945) [-3205.172] -- 0:01:58 621000 -- (-3209.626) (-3210.028) [-3208.657] (-3218.156) * (-3213.824) (-3213.159) (-3208.493) [-3210.826] -- 0:01:58 621500 -- (-3213.123) [-3201.706] (-3205.921) (-3206.612) * (-3207.411) (-3207.540) (-3213.402) [-3206.267] -- 0:01:58 622000 -- (-3205.658) [-3210.564] (-3205.404) (-3205.546) * (-3213.862) [-3208.661] (-3208.697) (-3209.208) -- 0:01:58 622500 -- (-3211.115) (-3211.276) (-3205.579) [-3202.974] * (-3207.558) (-3209.319) (-3204.410) [-3205.115] -- 0:01:58 623000 -- [-3204.429] (-3203.031) (-3206.019) (-3210.620) * (-3209.718) (-3210.613) [-3208.398] (-3213.038) -- 0:01:58 623500 -- [-3204.199] (-3211.520) (-3206.890) (-3215.602) * (-3210.230) (-3207.751) (-3216.375) [-3203.064] -- 0:01:57 624000 -- (-3208.388) [-3208.121] (-3205.850) (-3210.220) * (-3211.212) (-3212.477) (-3205.158) [-3204.246] -- 0:01:57 624500 -- [-3205.017] (-3212.444) (-3206.307) (-3202.665) * (-3208.004) (-3205.584) [-3212.475] (-3223.082) -- 0:01:57 625000 -- (-3204.580) (-3210.366) [-3209.864] (-3208.433) * (-3206.435) (-3209.096) (-3223.298) [-3207.114] -- 0:01:57 Average standard deviation of split frequencies: 0.013178 625500 -- (-3207.757) [-3202.589] (-3205.324) (-3211.322) * (-3205.907) [-3207.483] (-3217.421) (-3203.041) -- 0:01:57 626000 -- [-3207.049] (-3205.346) (-3205.432) (-3208.621) * (-3208.138) (-3210.077) [-3207.026] (-3203.370) -- 0:01:57 626500 -- (-3207.231) (-3209.272) (-3207.818) [-3208.791] * (-3205.775) (-3212.133) [-3206.051] (-3205.850) -- 0:01:56 627000 -- (-3202.873) (-3208.110) [-3205.178] (-3208.987) * (-3209.303) [-3208.850] (-3209.039) (-3206.183) -- 0:01:56 627500 -- (-3208.196) (-3206.608) (-3206.483) [-3206.826] * (-3213.675) (-3203.517) [-3207.338] (-3206.956) -- 0:01:56 628000 -- (-3208.402) [-3210.756] (-3212.920) (-3214.565) * (-3206.162) [-3209.874] (-3199.986) (-3208.322) -- 0:01:56 628500 -- (-3209.129) (-3205.131) (-3209.501) [-3202.823] * (-3206.930) (-3209.705) [-3211.740] (-3214.926) -- 0:01:56 629000 -- (-3210.481) (-3211.808) (-3210.644) [-3211.954] * [-3209.311] (-3210.320) (-3213.661) (-3205.600) -- 0:01:56 629500 -- [-3204.821] (-3208.442) (-3208.799) (-3202.442) * (-3210.531) (-3201.274) [-3207.041] (-3207.213) -- 0:01:55 630000 -- (-3211.151) (-3210.274) [-3208.377] (-3210.207) * (-3204.930) (-3213.485) (-3209.490) [-3208.529] -- 0:01:55 Average standard deviation of split frequencies: 0.013081 630500 -- (-3206.721) [-3209.356] (-3206.053) (-3215.664) * (-3205.251) [-3210.374] (-3208.091) (-3203.598) -- 0:01:55 631000 -- (-3206.056) (-3208.342) (-3205.724) [-3205.789] * [-3201.050] (-3207.529) (-3208.593) (-3205.830) -- 0:01:55 631500 -- [-3210.196] (-3210.417) (-3209.415) (-3209.523) * (-3206.460) (-3209.079) (-3206.565) [-3203.267] -- 0:01:54 632000 -- (-3217.055) (-3209.734) (-3213.190) [-3208.704] * (-3209.929) (-3207.345) (-3211.568) [-3211.256] -- 0:01:55 632500 -- (-3207.196) (-3207.918) [-3205.860] (-3207.384) * (-3210.099) [-3203.743] (-3203.742) (-3207.053) -- 0:01:55 633000 -- [-3208.296] (-3206.537) (-3212.247) (-3220.964) * (-3213.427) (-3207.943) [-3205.050] (-3216.545) -- 0:01:54 633500 -- (-3204.775) [-3205.652] (-3209.369) (-3208.955) * (-3207.524) (-3212.572) [-3209.352] (-3217.236) -- 0:01:54 634000 -- (-3212.089) (-3204.510) [-3205.133] (-3210.494) * (-3206.822) [-3217.407] (-3205.421) (-3207.897) -- 0:01:54 634500 -- [-3209.177] (-3207.397) (-3209.185) (-3206.860) * (-3207.149) (-3206.092) [-3213.611] (-3206.658) -- 0:01:54 635000 -- (-3203.397) (-3214.679) (-3208.363) [-3208.424] * (-3220.372) (-3211.486) (-3205.505) [-3209.797] -- 0:01:54 Average standard deviation of split frequencies: 0.012600 635500 -- [-3204.523] (-3208.515) (-3204.133) (-3210.123) * (-3211.052) (-3216.688) (-3204.344) [-3205.998] -- 0:01:54 636000 -- (-3211.692) (-3209.779) (-3217.766) [-3203.129] * (-3209.964) (-3211.037) (-3211.341) [-3209.045] -- 0:01:53 636500 -- [-3208.610] (-3214.531) (-3206.686) (-3213.747) * (-3206.302) (-3202.973) (-3206.998) [-3206.891] -- 0:01:53 637000 -- (-3216.824) [-3209.775] (-3208.345) (-3212.756) * (-3208.830) [-3202.031] (-3210.316) (-3206.995) -- 0:01:53 637500 -- (-3213.737) (-3209.491) (-3209.751) [-3209.714] * (-3219.026) [-3209.282] (-3209.251) (-3220.395) -- 0:01:53 638000 -- (-3207.903) (-3214.700) [-3207.231] (-3209.260) * (-3219.211) [-3212.360] (-3209.931) (-3215.484) -- 0:01:52 638500 -- (-3210.988) [-3204.691] (-3211.045) (-3206.681) * (-3221.307) (-3210.431) [-3207.938] (-3209.710) -- 0:01:53 639000 -- (-3204.650) [-3208.945] (-3211.900) (-3208.484) * (-3209.888) (-3206.131) (-3208.819) [-3206.523] -- 0:01:52 639500 -- (-3211.012) (-3204.676) [-3213.987] (-3216.996) * (-3209.061) (-3209.604) (-3212.022) [-3206.323] -- 0:01:52 640000 -- (-3209.952) (-3206.327) [-3212.289] (-3203.871) * (-3206.326) (-3211.924) [-3211.381] (-3207.476) -- 0:01:52 Average standard deviation of split frequencies: 0.012509 640500 -- (-3217.110) (-3209.724) (-3209.473) [-3203.379] * [-3206.376] (-3210.676) (-3211.671) (-3217.899) -- 0:01:52 641000 -- (-3214.352) [-3204.560] (-3211.282) (-3208.572) * (-3205.734) [-3205.762] (-3207.703) (-3208.448) -- 0:01:52 641500 -- (-3203.122) (-3205.552) (-3206.966) [-3211.844] * [-3214.239] (-3214.537) (-3204.555) (-3207.643) -- 0:01:52 642000 -- (-3207.809) (-3205.082) (-3209.208) [-3204.196] * (-3210.166) (-3214.129) (-3214.362) [-3207.106] -- 0:01:52 642500 -- (-3210.236) [-3205.264] (-3207.099) (-3210.368) * (-3211.242) (-3204.320) [-3208.486] (-3206.248) -- 0:01:51 643000 -- (-3206.662) (-3208.385) (-3209.055) [-3204.307] * (-3202.705) [-3204.180] (-3207.482) (-3206.031) -- 0:01:51 643500 -- [-3213.018] (-3206.507) (-3209.933) (-3211.175) * [-3205.781] (-3206.801) (-3206.320) (-3216.704) -- 0:01:51 644000 -- (-3208.894) (-3217.381) (-3203.876) [-3203.964] * (-3206.669) (-3202.351) [-3215.437] (-3221.302) -- 0:01:51 644500 -- [-3209.352] (-3206.987) (-3208.039) (-3205.767) * (-3208.833) (-3208.190) [-3204.207] (-3215.459) -- 0:01:50 645000 -- [-3206.591] (-3209.566) (-3210.225) (-3205.898) * (-3206.242) [-3205.197] (-3203.175) (-3223.236) -- 0:01:51 Average standard deviation of split frequencies: 0.012041 645500 -- (-3208.687) (-3203.258) [-3208.686] (-3208.419) * (-3214.293) [-3210.276] (-3209.413) (-3214.892) -- 0:01:50 646000 -- (-3216.984) (-3206.500) [-3213.491] (-3208.709) * (-3209.198) (-3205.286) (-3209.056) [-3205.066] -- 0:01:50 646500 -- (-3205.540) (-3210.652) (-3207.010) [-3206.226] * [-3206.263] (-3210.681) (-3217.422) (-3204.664) -- 0:01:50 647000 -- (-3208.181) [-3203.399] (-3209.118) (-3209.418) * [-3211.535] (-3206.960) (-3215.815) (-3206.883) -- 0:01:50 647500 -- (-3210.070) [-3207.790] (-3208.854) (-3204.788) * (-3210.442) (-3205.641) [-3209.439] (-3204.914) -- 0:01:49 648000 -- (-3209.812) (-3211.344) [-3208.242] (-3207.569) * (-3202.925) (-3209.480) (-3210.021) [-3210.012] -- 0:01:50 648500 -- [-3207.560] (-3210.752) (-3208.855) (-3205.758) * [-3207.478] (-3209.532) (-3207.976) (-3205.027) -- 0:01:50 649000 -- [-3213.535] (-3204.901) (-3204.376) (-3204.244) * (-3206.413) [-3210.274] (-3209.035) (-3209.323) -- 0:01:49 649500 -- (-3219.253) [-3211.237] (-3208.046) (-3207.930) * [-3208.131] (-3209.670) (-3210.856) (-3206.509) -- 0:01:49 650000 -- (-3208.482) (-3212.898) (-3206.539) [-3208.898] * (-3207.595) [-3206.869] (-3206.797) (-3214.591) -- 0:01:49 Average standard deviation of split frequencies: 0.011230 650500 -- [-3207.305] (-3218.754) (-3217.848) (-3203.939) * (-3211.342) [-3204.460] (-3212.341) (-3201.694) -- 0:01:49 651000 -- (-3208.048) (-3217.791) [-3214.500] (-3205.001) * (-3209.015) (-3207.560) (-3206.807) [-3202.204] -- 0:01:48 651500 -- (-3204.861) [-3208.219] (-3218.145) (-3202.074) * (-3205.872) [-3205.900] (-3212.485) (-3205.107) -- 0:01:49 652000 -- (-3212.360) (-3209.725) [-3213.935] (-3207.060) * (-3209.851) [-3205.485] (-3219.851) (-3214.137) -- 0:01:48 652500 -- (-3210.186) [-3209.216] (-3207.704) (-3206.538) * (-3210.620) (-3210.671) [-3203.756] (-3205.838) -- 0:01:48 653000 -- [-3205.683] (-3209.783) (-3213.849) (-3207.608) * (-3215.335) (-3213.017) (-3212.945) [-3207.683] -- 0:01:48 653500 -- (-3213.898) (-3217.659) [-3210.624] (-3214.837) * [-3210.140] (-3208.499) (-3213.300) (-3209.335) -- 0:01:48 654000 -- [-3207.072] (-3212.660) (-3210.990) (-3206.300) * [-3202.725] (-3213.973) (-3209.649) (-3214.847) -- 0:01:47 654500 -- (-3208.785) (-3213.222) (-3207.846) [-3204.912] * (-3207.002) [-3208.562] (-3206.624) (-3208.112) -- 0:01:48 655000 -- (-3209.364) [-3204.629] (-3215.446) (-3205.898) * (-3213.645) [-3209.342] (-3204.266) (-3206.258) -- 0:01:47 Average standard deviation of split frequencies: 0.010420 655500 -- (-3211.306) [-3208.550] (-3209.895) (-3206.296) * (-3215.514) [-3206.519] (-3213.379) (-3208.827) -- 0:01:47 656000 -- (-3216.415) (-3203.123) [-3208.509] (-3202.045) * (-3212.155) [-3213.505] (-3205.537) (-3208.095) -- 0:01:47 656500 -- [-3213.348] (-3206.424) (-3205.113) (-3209.574) * (-3209.810) [-3212.687] (-3207.860) (-3207.479) -- 0:01:47 657000 -- [-3213.202] (-3208.517) (-3216.072) (-3217.036) * (-3213.957) (-3216.484) (-3215.445) [-3208.780] -- 0:01:47 657500 -- (-3220.818) (-3209.065) [-3209.079] (-3207.921) * (-3207.789) (-3213.089) [-3211.077] (-3203.243) -- 0:01:46 658000 -- [-3212.995] (-3211.707) (-3213.953) (-3208.429) * (-3205.320) (-3210.765) [-3206.623] (-3207.906) -- 0:01:47 658500 -- (-3208.488) (-3204.481) [-3208.685] (-3203.341) * (-3205.853) (-3212.437) (-3205.237) [-3207.685] -- 0:01:46 659000 -- (-3201.828) [-3205.843] (-3206.059) (-3215.716) * (-3207.919) (-3211.401) (-3206.889) [-3205.851] -- 0:01:46 659500 -- (-3215.123) (-3203.617) [-3212.578] (-3203.430) * (-3212.749) (-3207.894) [-3209.538] (-3210.268) -- 0:01:46 660000 -- (-3202.604) [-3206.405] (-3203.716) (-3205.237) * (-3212.680) [-3205.815] (-3205.563) (-3204.852) -- 0:01:46 Average standard deviation of split frequencies: 0.007492 660500 -- (-3211.393) [-3202.649] (-3204.208) (-3213.551) * [-3210.651] (-3205.981) (-3207.747) (-3207.246) -- 0:01:45 661000 -- (-3208.063) [-3202.845] (-3205.137) (-3213.119) * [-3202.705] (-3209.908) (-3208.093) (-3205.708) -- 0:01:46 661500 -- (-3203.838) [-3204.844] (-3202.720) (-3206.688) * (-3209.857) (-3208.826) (-3207.810) [-3203.336] -- 0:01:45 662000 -- (-3205.565) (-3215.110) [-3206.618] (-3216.275) * (-3207.168) (-3208.627) [-3208.509] (-3208.036) -- 0:01:45 662500 -- (-3209.499) (-3208.015) [-3213.078] (-3205.080) * (-3206.421) (-3206.235) [-3215.289] (-3204.135) -- 0:01:45 663000 -- (-3204.737) (-3204.018) [-3206.144] (-3214.691) * [-3203.692] (-3208.983) (-3208.909) (-3213.465) -- 0:01:45 663500 -- (-3206.699) [-3205.712] (-3208.409) (-3212.973) * (-3209.451) [-3203.051] (-3205.651) (-3206.694) -- 0:01:44 664000 -- (-3209.669) (-3206.038) [-3210.996] (-3207.494) * [-3203.819] (-3210.107) (-3207.255) (-3213.157) -- 0:01:44 664500 -- [-3208.221] (-3214.373) (-3212.064) (-3205.603) * (-3208.938) (-3208.297) (-3201.559) [-3207.424] -- 0:01:45 665000 -- [-3212.207] (-3207.597) (-3214.223) (-3211.453) * (-3207.283) (-3206.204) [-3206.447] (-3219.496) -- 0:01:44 Average standard deviation of split frequencies: 0.007078 665500 -- (-3205.546) (-3210.362) [-3212.859] (-3211.338) * (-3201.707) (-3208.019) (-3210.619) [-3206.776] -- 0:01:44 666000 -- (-3212.405) (-3210.991) (-3207.163) [-3206.546] * (-3204.057) (-3208.147) [-3207.121] (-3213.461) -- 0:01:44 666500 -- (-3208.916) (-3211.152) [-3209.177] (-3209.247) * [-3206.357] (-3218.080) (-3206.079) (-3212.056) -- 0:01:44 667000 -- (-3207.592) [-3207.973] (-3203.011) (-3213.575) * (-3214.673) (-3210.186) [-3205.302] (-3208.671) -- 0:01:43 667500 -- (-3207.657) (-3210.619) [-3204.376] (-3201.617) * [-3213.307] (-3212.667) (-3216.740) (-3211.249) -- 0:01:44 668000 -- (-3206.973) [-3206.023] (-3209.463) (-3204.832) * (-3210.575) [-3209.059] (-3213.751) (-3209.789) -- 0:01:43 668500 -- (-3206.205) [-3207.800] (-3204.977) (-3203.595) * (-3205.859) (-3204.683) (-3213.422) [-3203.874] -- 0:01:43 669000 -- (-3207.403) (-3206.383) [-3204.716] (-3209.897) * (-3205.805) [-3207.902] (-3217.807) (-3202.824) -- 0:01:43 669500 -- (-3205.701) [-3212.067] (-3211.787) (-3203.985) * [-3203.283] (-3207.734) (-3209.708) (-3207.849) -- 0:01:43 670000 -- [-3206.811] (-3211.094) (-3213.380) (-3209.920) * (-3209.555) (-3204.537) [-3205.134] (-3217.710) -- 0:01:42 Average standard deviation of split frequencies: 0.007029 670500 -- [-3211.318] (-3206.897) (-3204.384) (-3210.011) * (-3213.901) (-3212.723) [-3206.786] (-3213.911) -- 0:01:42 671000 -- (-3206.920) [-3207.495] (-3208.866) (-3211.694) * [-3205.256] (-3206.597) (-3205.383) (-3206.943) -- 0:01:42 671500 -- (-3208.398) (-3208.284) [-3212.852] (-3203.941) * (-3210.925) (-3204.720) [-3206.578] (-3210.151) -- 0:01:42 672000 -- [-3208.901] (-3204.435) (-3209.798) (-3206.238) * (-3207.760) [-3215.109] (-3207.412) (-3208.015) -- 0:01:42 672500 -- (-3208.937) [-3210.249] (-3212.329) (-3203.588) * (-3205.995) (-3212.885) (-3208.618) [-3209.093] -- 0:01:42 673000 -- (-3209.535) (-3205.380) (-3209.484) [-3206.821] * (-3213.388) (-3210.536) (-3203.863) [-3206.300] -- 0:01:42 673500 -- (-3211.146) (-3207.521) [-3206.982] (-3209.486) * (-3206.146) (-3210.139) (-3206.485) [-3204.689] -- 0:01:41 674000 -- (-3206.178) (-3207.863) (-3209.351) [-3200.141] * (-3207.217) (-3214.030) [-3212.439] (-3208.713) -- 0:01:42 674500 -- [-3203.574] (-3202.996) (-3207.891) (-3209.187) * (-3209.337) (-3207.456) (-3212.119) [-3206.024] -- 0:01:41 675000 -- (-3203.687) (-3211.227) [-3205.809] (-3209.021) * (-3204.344) (-3209.381) (-3206.448) [-3202.353] -- 0:01:41 Average standard deviation of split frequencies: 0.006625 675500 -- (-3207.681) (-3205.173) (-3207.781) [-3204.345] * (-3203.481) (-3209.327) [-3206.276] (-3207.359) -- 0:01:41 676000 -- (-3206.673) (-3214.986) (-3208.140) [-3208.455] * (-3210.003) (-3207.223) [-3206.940] (-3206.384) -- 0:01:41 676500 -- (-3204.815) (-3206.856) (-3209.321) [-3212.726] * (-3207.778) (-3208.506) [-3205.954] (-3201.860) -- 0:01:40 677000 -- (-3204.332) [-3211.567] (-3205.204) (-3212.227) * (-3219.150) (-3204.856) [-3207.754] (-3207.591) -- 0:01:41 677500 -- (-3210.556) [-3207.520] (-3207.372) (-3213.263) * [-3206.821] (-3209.383) (-3204.884) (-3223.158) -- 0:01:40 678000 -- (-3208.257) [-3208.280] (-3208.472) (-3210.966) * (-3210.389) (-3206.225) [-3205.764] (-3213.416) -- 0:01:40 678500 -- (-3209.715) (-3201.564) [-3204.154] (-3205.701) * (-3207.046) (-3201.696) (-3209.330) [-3206.844] -- 0:01:40 679000 -- (-3216.260) (-3207.054) (-3214.369) [-3205.132] * (-3212.341) (-3208.989) [-3205.734] (-3206.879) -- 0:01:40 679500 -- [-3208.888] (-3203.809) (-3206.844) (-3215.549) * (-3206.384) (-3205.289) [-3213.048] (-3206.099) -- 0:01:39 680000 -- (-3212.793) (-3210.447) [-3207.985] (-3210.034) * (-3209.944) [-3207.715] (-3210.291) (-3208.956) -- 0:01:39 Average standard deviation of split frequencies: 0.006579 680500 -- (-3212.752) [-3217.707] (-3205.589) (-3215.969) * (-3213.173) (-3208.338) (-3212.993) [-3207.791] -- 0:01:40 681000 -- (-3207.993) (-3210.765) [-3209.213] (-3212.912) * (-3208.515) [-3203.671] (-3203.659) (-3209.366) -- 0:01:39 681500 -- [-3202.991] (-3212.461) (-3208.773) (-3208.581) * (-3211.560) (-3206.581) [-3213.221] (-3204.851) -- 0:01:39 682000 -- (-3202.749) (-3209.340) [-3205.402] (-3205.667) * [-3208.105] (-3204.971) (-3206.092) (-3212.435) -- 0:01:39 682500 -- (-3211.039) (-3203.124) (-3215.607) [-3216.485] * (-3205.795) (-3211.835) (-3206.301) [-3209.332] -- 0:01:39 683000 -- (-3212.511) [-3200.439] (-3212.416) (-3210.361) * [-3210.109] (-3206.167) (-3202.164) (-3206.169) -- 0:01:38 683500 -- (-3211.516) (-3206.974) [-3207.795] (-3213.393) * (-3213.529) (-3208.160) [-3202.696] (-3204.544) -- 0:01:38 684000 -- [-3208.226] (-3208.076) (-3208.305) (-3206.799) * (-3206.880) (-3206.769) [-3208.907] (-3207.754) -- 0:01:38 684500 -- (-3216.662) [-3206.466] (-3204.109) (-3223.320) * (-3205.042) (-3209.843) (-3207.377) [-3208.904] -- 0:01:38 685000 -- (-3207.747) [-3206.335] (-3206.062) (-3207.235) * [-3205.925] (-3204.253) (-3208.904) (-3208.130) -- 0:01:38 Average standard deviation of split frequencies: 0.006528 685500 -- [-3204.979] (-3203.725) (-3207.310) (-3207.656) * (-3203.858) [-3209.511] (-3209.244) (-3209.126) -- 0:01:38 686000 -- [-3205.759] (-3206.327) (-3205.229) (-3207.300) * (-3206.767) [-3210.010] (-3213.087) (-3211.181) -- 0:01:37 686500 -- (-3205.178) (-3203.008) [-3213.144] (-3211.810) * (-3217.107) [-3211.203] (-3206.792) (-3206.616) -- 0:01:37 687000 -- (-3207.831) (-3209.343) (-3201.868) [-3209.017] * [-3210.645] (-3211.124) (-3202.639) (-3206.425) -- 0:01:37 687500 -- (-3213.532) (-3206.346) (-3206.153) [-3208.230] * (-3208.459) [-3206.905] (-3217.017) (-3212.783) -- 0:01:37 688000 -- (-3212.163) (-3211.659) (-3209.632) [-3202.605] * (-3210.669) [-3208.499] (-3211.617) (-3212.868) -- 0:01:37 688500 -- (-3208.427) (-3207.697) [-3207.979] (-3220.244) * (-3205.330) (-3208.958) [-3212.735] (-3206.540) -- 0:01:37 689000 -- [-3206.853] (-3209.183) (-3213.382) (-3209.039) * [-3206.229] (-3221.563) (-3210.552) (-3210.563) -- 0:01:37 689500 -- (-3207.954) [-3203.421] (-3206.716) (-3208.892) * [-3205.476] (-3210.361) (-3214.244) (-3209.804) -- 0:01:36 690000 -- [-3211.176] (-3210.282) (-3208.793) (-3209.048) * (-3205.848) (-3208.094) [-3210.484] (-3216.237) -- 0:01:37 Average standard deviation of split frequencies: 0.006143 690500 -- (-3208.488) (-3205.690) (-3215.650) [-3207.989] * [-3208.407] (-3211.679) (-3207.735) (-3210.755) -- 0:01:36 691000 -- (-3204.150) (-3207.910) (-3207.927) [-3213.115] * (-3210.738) (-3209.492) [-3204.244] (-3210.402) -- 0:01:36 691500 -- (-3205.910) (-3206.170) [-3205.985] (-3209.102) * [-3219.418] (-3213.088) (-3204.209) (-3206.703) -- 0:01:36 692000 -- [-3206.733] (-3213.546) (-3209.456) (-3210.951) * (-3205.240) (-3206.759) [-3209.531] (-3207.118) -- 0:01:36 692500 -- (-3202.828) (-3206.592) (-3213.112) [-3208.228] * (-3209.368) (-3206.149) [-3208.863] (-3208.999) -- 0:01:35 693000 -- (-3201.960) (-3206.227) (-3209.414) [-3212.297] * (-3207.538) (-3208.674) [-3209.287] (-3210.630) -- 0:01:35 693500 -- (-3206.797) (-3207.279) [-3207.316] (-3214.238) * (-3217.272) (-3207.744) [-3210.325] (-3209.351) -- 0:01:35 694000 -- (-3205.461) (-3206.031) [-3205.943] (-3208.924) * (-3210.068) (-3205.419) (-3208.580) [-3206.561] -- 0:01:35 694500 -- (-3212.642) (-3216.513) [-3209.754] (-3207.826) * (-3207.167) (-3204.905) [-3211.261] (-3209.263) -- 0:01:35 695000 -- (-3212.779) [-3208.196] (-3213.484) (-3211.596) * (-3207.704) (-3207.747) (-3207.857) [-3206.315] -- 0:01:35 Average standard deviation of split frequencies: 0.006773 695500 -- (-3207.299) [-3208.794] (-3208.644) (-3205.104) * (-3211.623) [-3207.987] (-3208.461) (-3205.561) -- 0:01:35 696000 -- (-3204.957) (-3215.109) (-3209.482) [-3204.246] * [-3206.318] (-3213.774) (-3205.260) (-3210.929) -- 0:01:34 696500 -- [-3212.633] (-3204.381) (-3204.753) (-3207.052) * (-3214.156) (-3208.487) (-3209.652) [-3208.431] -- 0:01:34 697000 -- (-3209.402) [-3207.779] (-3211.229) (-3203.526) * [-3205.932] (-3214.683) (-3207.493) (-3212.411) -- 0:01:34 697500 -- (-3211.161) (-3209.233) [-3204.937] (-3210.506) * (-3208.949) [-3209.248] (-3209.170) (-3206.146) -- 0:01:34 698000 -- (-3207.674) (-3214.040) [-3206.439] (-3208.493) * (-3207.906) (-3209.596) [-3205.012] (-3207.329) -- 0:01:34 698500 -- (-3206.080) [-3208.276] (-3202.871) (-3216.184) * (-3204.067) (-3210.480) [-3206.793] (-3208.924) -- 0:01:34 699000 -- [-3206.942] (-3218.134) (-3207.164) (-3214.084) * (-3209.275) (-3201.795) (-3212.342) [-3219.197] -- 0:01:33 699500 -- (-3204.885) (-3204.939) [-3204.218] (-3217.719) * [-3206.318] (-3213.976) (-3205.350) (-3215.472) -- 0:01:33 700000 -- [-3205.556] (-3210.952) (-3210.560) (-3207.142) * (-3216.759) (-3208.799) (-3216.034) [-3210.957] -- 0:01:33 Average standard deviation of split frequencies: 0.006728 700500 -- [-3204.762] (-3206.041) (-3214.577) (-3209.791) * [-3203.982] (-3203.651) (-3210.779) (-3205.085) -- 0:01:33 701000 -- (-3213.229) (-3213.280) (-3208.065) [-3202.587] * (-3208.184) (-3207.456) [-3211.262] (-3207.494) -- 0:01:33 701500 -- (-3212.971) [-3203.159] (-3207.962) (-3210.936) * (-3207.421) (-3204.201) (-3215.787) [-3207.197] -- 0:01:33 702000 -- (-3208.447) (-3208.389) [-3209.984] (-3204.852) * (-3202.695) (-3209.887) [-3214.498] (-3212.153) -- 0:01:32 702500 -- [-3205.913] (-3216.410) (-3206.960) (-3203.861) * [-3203.848] (-3205.236) (-3204.010) (-3208.182) -- 0:01:32 703000 -- (-3211.540) [-3209.520] (-3202.062) (-3213.204) * (-3212.312) [-3207.709] (-3205.866) (-3209.811) -- 0:01:32 703500 -- (-3207.431) [-3210.448] (-3205.504) (-3211.477) * (-3209.156) [-3203.255] (-3205.098) (-3204.082) -- 0:01:32 704000 -- (-3210.558) (-3207.191) (-3203.129) [-3204.878] * (-3207.982) [-3204.814] (-3215.432) (-3206.886) -- 0:01:32 704500 -- (-3203.135) [-3209.914] (-3209.718) (-3208.098) * [-3204.934] (-3210.160) (-3209.210) (-3210.293) -- 0:01:32 705000 -- (-3206.789) (-3206.515) (-3210.944) [-3209.413] * [-3219.143] (-3204.424) (-3212.993) (-3208.583) -- 0:01:32 Average standard deviation of split frequencies: 0.005676 705500 -- [-3205.189] (-3213.312) (-3208.872) (-3210.435) * [-3201.524] (-3206.170) (-3210.640) (-3208.109) -- 0:01:31 706000 -- (-3205.675) (-3213.464) (-3207.530) [-3206.457] * (-3209.836) [-3203.659] (-3204.771) (-3207.193) -- 0:01:31 706500 -- [-3211.267] (-3207.172) (-3208.320) (-3210.791) * (-3207.440) (-3212.130) [-3211.762] (-3209.672) -- 0:01:31 707000 -- (-3211.724) (-3211.047) [-3208.283] (-3203.498) * (-3216.552) (-3208.256) [-3202.629] (-3214.535) -- 0:01:31 707500 -- (-3210.140) (-3203.981) (-3203.064) [-3206.852] * (-3211.232) (-3208.564) (-3204.545) [-3207.288] -- 0:01:31 708000 -- (-3206.879) [-3207.664] (-3205.136) (-3204.525) * (-3204.344) (-3202.921) (-3205.946) [-3204.931] -- 0:01:31 708500 -- (-3209.967) (-3209.351) (-3205.990) [-3206.090] * (-3202.281) (-3209.724) (-3214.295) [-3206.799] -- 0:01:30 709000 -- [-3209.600] (-3207.192) (-3206.611) (-3205.822) * (-3206.882) [-3207.834] (-3209.823) (-3209.076) -- 0:01:30 709500 -- (-3207.151) (-3209.803) [-3202.325] (-3210.972) * (-3205.181) (-3203.883) (-3205.761) [-3204.709] -- 0:01:30 710000 -- (-3211.951) [-3210.882] (-3207.285) (-3210.470) * (-3206.828) (-3208.198) (-3208.936) [-3203.381] -- 0:01:30 Average standard deviation of split frequencies: 0.006302 710500 -- (-3210.454) (-3214.653) [-3202.899] (-3211.279) * (-3209.176) (-3206.885) [-3213.287] (-3200.014) -- 0:01:30 711000 -- (-3209.923) [-3206.351] (-3205.812) (-3202.347) * (-3206.485) (-3207.666) [-3213.704] (-3212.194) -- 0:01:30 711500 -- (-3204.833) (-3213.222) (-3204.931) [-3204.435] * (-3205.186) (-3205.463) (-3205.807) [-3209.383] -- 0:01:30 712000 -- [-3212.750] (-3207.363) (-3212.489) (-3208.258) * (-3203.528) (-3206.631) [-3211.878] (-3215.991) -- 0:01:29 712500 -- (-3205.379) (-3203.674) (-3210.358) [-3209.985] * (-3211.374) (-3206.838) (-3208.894) [-3207.318] -- 0:01:29 713000 -- (-3203.836) [-3206.468] (-3212.093) (-3205.627) * (-3211.754) [-3206.587] (-3211.007) (-3207.515) -- 0:01:29 713500 -- (-3204.614) (-3210.469) [-3213.198] (-3212.483) * (-3203.270) [-3210.935] (-3212.560) (-3202.418) -- 0:01:29 714000 -- (-3207.352) (-3205.898) (-3207.349) [-3206.813] * (-3204.775) [-3213.259] (-3218.655) (-3207.750) -- 0:01:29 714500 -- (-3207.221) [-3210.189] (-3211.336) (-3213.011) * (-3205.321) (-3210.906) (-3211.461) [-3205.236] -- 0:01:29 715000 -- (-3212.657) [-3205.165] (-3211.824) (-3209.311) * (-3208.242) [-3207.002] (-3207.283) (-3207.327) -- 0:01:28 Average standard deviation of split frequencies: 0.006913 715500 -- (-3214.722) (-3213.779) (-3206.391) [-3206.199] * (-3204.012) [-3209.844] (-3214.854) (-3204.077) -- 0:01:28 716000 -- (-3216.940) (-3209.387) [-3204.876] (-3205.336) * (-3206.354) (-3203.302) (-3204.883) [-3206.047] -- 0:01:28 716500 -- (-3204.176) (-3207.937) (-3207.687) [-3203.919] * (-3206.753) [-3205.826] (-3207.186) (-3213.157) -- 0:01:28 717000 -- [-3205.373] (-3207.101) (-3209.928) (-3211.980) * (-3208.654) (-3208.808) [-3202.299] (-3217.031) -- 0:01:28 717500 -- (-3205.299) (-3205.484) [-3202.883] (-3216.784) * (-3207.967) [-3210.136] (-3208.491) (-3223.913) -- 0:01:28 718000 -- (-3216.172) (-3206.374) [-3209.331] (-3208.365) * (-3215.985) (-3209.036) [-3208.619] (-3209.668) -- 0:01:27 718500 -- (-3211.478) (-3206.001) (-3214.247) [-3206.887] * (-3206.144) (-3206.217) [-3203.409] (-3211.765) -- 0:01:27 719000 -- [-3205.895] (-3207.663) (-3213.041) (-3204.482) * (-3208.164) (-3201.532) [-3205.395] (-3212.081) -- 0:01:27 719500 -- [-3213.721] (-3206.682) (-3209.070) (-3206.246) * (-3210.194) (-3207.191) [-3209.846] (-3207.103) -- 0:01:27 720000 -- [-3205.455] (-3208.094) (-3214.504) (-3204.385) * (-3207.767) (-3204.484) (-3201.485) [-3204.064] -- 0:01:27 Average standard deviation of split frequencies: 0.006868 720500 -- [-3205.191] (-3206.302) (-3206.662) (-3209.553) * [-3203.627] (-3208.190) (-3205.313) (-3213.745) -- 0:01:27 721000 -- (-3207.752) (-3206.509) [-3209.285] (-3205.923) * (-3208.850) (-3214.327) [-3207.639] (-3213.290) -- 0:01:27 721500 -- (-3213.378) [-3208.007] (-3204.400) (-3208.597) * [-3207.881] (-3208.957) (-3210.718) (-3209.992) -- 0:01:26 722000 -- (-3205.509) (-3204.827) (-3207.847) [-3213.418] * (-3209.011) (-3211.197) [-3208.744] (-3214.304) -- 0:01:26 722500 -- [-3206.174] (-3207.568) (-3209.012) (-3210.818) * (-3208.776) (-3211.119) [-3213.325] (-3205.165) -- 0:01:26 723000 -- (-3205.821) (-3210.685) (-3213.601) [-3208.256] * (-3203.727) (-3206.396) (-3211.583) [-3214.442] -- 0:01:26 723500 -- (-3208.097) (-3201.025) (-3217.408) [-3204.835] * (-3206.316) [-3211.517] (-3212.275) (-3203.612) -- 0:01:26 724000 -- (-3203.932) (-3203.124) [-3205.918] (-3211.433) * [-3205.392] (-3208.687) (-3213.534) (-3211.390) -- 0:01:26 724500 -- [-3205.221] (-3205.932) (-3204.541) (-3210.069) * [-3206.841] (-3209.771) (-3213.911) (-3214.133) -- 0:01:25 725000 -- [-3206.462] (-3208.739) (-3209.243) (-3214.469) * (-3208.131) (-3208.351) [-3212.199] (-3209.908) -- 0:01:25 Average standard deviation of split frequencies: 0.006818 725500 -- (-3211.415) (-3208.561) (-3211.655) [-3207.061] * [-3205.972] (-3207.337) (-3212.468) (-3210.017) -- 0:01:25 726000 -- (-3209.633) (-3204.938) [-3211.477] (-3205.355) * [-3207.262] (-3208.502) (-3208.011) (-3205.462) -- 0:01:25 726500 -- (-3213.353) (-3209.647) (-3207.837) [-3213.141] * (-3211.534) [-3205.935] (-3208.732) (-3206.501) -- 0:01:25 727000 -- (-3210.838) (-3220.438) [-3204.529] (-3214.063) * (-3209.977) (-3206.211) (-3216.886) [-3204.728] -- 0:01:25 727500 -- [-3206.360] (-3212.005) (-3212.059) (-3213.722) * [-3211.863] (-3209.035) (-3206.208) (-3211.994) -- 0:01:25 728000 -- (-3213.850) (-3209.538) [-3207.194] (-3210.830) * [-3217.258] (-3207.757) (-3204.389) (-3214.192) -- 0:01:24 728500 -- (-3217.916) [-3211.962] (-3218.764) (-3208.469) * (-3219.249) (-3212.148) [-3206.761] (-3209.032) -- 0:01:24 729000 -- (-3208.200) (-3216.350) (-3211.920) [-3205.575] * (-3218.460) (-3211.293) (-3208.353) [-3209.333] -- 0:01:24 729500 -- (-3205.261) (-3208.322) (-3205.850) [-3204.384] * [-3212.448] (-3209.847) (-3212.092) (-3210.113) -- 0:01:24 730000 -- (-3219.140) [-3212.262] (-3206.811) (-3209.087) * (-3211.051) [-3209.122] (-3211.544) (-3201.878) -- 0:01:24 Average standard deviation of split frequencies: 0.007097 730500 -- (-3208.083) (-3210.931) (-3209.132) [-3207.405] * [-3205.737] (-3205.948) (-3206.508) (-3206.545) -- 0:01:24 731000 -- (-3205.649) (-3209.416) (-3207.611) [-3203.249] * [-3211.321] (-3211.018) (-3206.869) (-3211.903) -- 0:01:23 731500 -- (-3206.900) (-3210.267) [-3211.010] (-3205.572) * [-3209.924] (-3211.954) (-3205.470) (-3208.512) -- 0:01:23 732000 -- (-3210.444) (-3205.104) (-3208.445) [-3204.873] * (-3213.938) [-3205.692] (-3211.273) (-3208.482) -- 0:01:23 732500 -- (-3204.594) (-3204.769) (-3208.781) [-3204.642] * (-3216.076) (-3215.194) (-3207.963) [-3207.375] -- 0:01:23 733000 -- (-3219.202) [-3204.484] (-3214.000) (-3209.110) * (-3212.847) (-3209.573) (-3206.649) [-3213.944] -- 0:01:23 733500 -- (-3207.883) (-3207.751) (-3210.480) [-3205.783] * (-3210.506) (-3210.032) [-3206.969] (-3211.419) -- 0:01:23 734000 -- (-3207.357) (-3212.685) (-3206.545) [-3208.093] * [-3205.206] (-3211.792) (-3204.582) (-3220.197) -- 0:01:22 734500 -- (-3210.202) (-3209.609) (-3207.126) [-3205.464] * [-3207.994] (-3203.521) (-3207.929) (-3215.276) -- 0:01:22 735000 -- (-3214.377) (-3207.729) [-3210.054] (-3210.681) * (-3202.179) (-3207.491) (-3205.141) [-3203.916] -- 0:01:22 Average standard deviation of split frequencies: 0.008006 735500 -- [-3205.579] (-3210.809) (-3207.448) (-3209.016) * (-3203.473) [-3204.379] (-3213.689) (-3208.399) -- 0:01:22 736000 -- (-3205.277) (-3212.466) [-3204.039] (-3210.685) * (-3205.557) [-3206.263] (-3211.209) (-3212.397) -- 0:01:22 736500 -- [-3203.464] (-3210.261) (-3211.130) (-3206.482) * [-3207.869] (-3207.885) (-3211.103) (-3208.559) -- 0:01:22 737000 -- (-3203.289) (-3211.390) (-3207.796) [-3203.521] * [-3206.322] (-3210.201) (-3210.900) (-3203.413) -- 0:01:22 737500 -- (-3206.078) (-3210.404) [-3207.761] (-3214.531) * (-3211.645) (-3217.833) [-3217.473] (-3209.428) -- 0:01:21 738000 -- (-3211.905) (-3207.463) [-3205.711] (-3206.658) * (-3207.668) [-3207.865] (-3216.048) (-3209.904) -- 0:01:21 738500 -- (-3217.131) [-3205.702] (-3210.252) (-3210.636) * (-3217.951) (-3209.889) (-3210.010) [-3207.703] -- 0:01:21 739000 -- [-3203.195] (-3206.241) (-3207.339) (-3207.792) * (-3207.509) (-3215.771) (-3205.479) [-3214.885] -- 0:01:21 739500 -- (-3208.032) (-3208.326) (-3207.395) [-3211.134] * [-3210.075] (-3210.960) (-3211.911) (-3207.366) -- 0:01:21 740000 -- [-3206.643] (-3208.542) (-3203.639) (-3205.661) * (-3208.330) (-3206.725) [-3208.843] (-3205.808) -- 0:01:21 Average standard deviation of split frequencies: 0.007956 740500 -- (-3209.656) (-3207.899) [-3203.503] (-3206.704) * (-3207.639) (-3209.650) (-3205.629) [-3214.062] -- 0:01:20 741000 -- (-3206.797) [-3203.499] (-3205.541) (-3208.994) * (-3204.444) (-3212.605) (-3206.108) [-3209.438] -- 0:01:20 741500 -- [-3205.926] (-3206.511) (-3213.967) (-3207.527) * [-3209.032] (-3208.747) (-3208.592) (-3210.287) -- 0:01:20 742000 -- (-3212.351) (-3208.896) [-3207.445] (-3206.681) * (-3210.426) (-3210.899) [-3206.852] (-3212.133) -- 0:01:20 742500 -- (-3208.019) (-3208.697) (-3204.271) [-3201.905] * (-3207.575) (-3209.809) [-3208.554] (-3210.874) -- 0:01:20 743000 -- (-3209.499) (-3214.671) (-3209.621) [-3209.962] * [-3209.269] (-3215.079) (-3206.215) (-3206.265) -- 0:01:20 743500 -- (-3212.416) [-3217.791] (-3206.418) (-3211.322) * (-3207.053) (-3215.473) (-3211.029) [-3207.043] -- 0:01:20 744000 -- (-3218.967) [-3210.666] (-3207.624) (-3209.586) * [-3205.979] (-3211.417) (-3208.721) (-3206.014) -- 0:01:19 744500 -- (-3207.895) (-3216.390) (-3205.629) [-3209.561] * (-3210.876) (-3208.311) (-3208.812) [-3209.146] -- 0:01:19 745000 -- (-3214.034) (-3206.781) (-3206.665) [-3208.533] * (-3211.026) (-3215.588) [-3211.468] (-3204.281) -- 0:01:19 Average standard deviation of split frequencies: 0.008215 745500 -- (-3202.466) (-3207.358) (-3214.012) [-3202.503] * (-3208.185) (-3209.699) (-3209.207) [-3203.894] -- 0:01:19 746000 -- (-3204.611) [-3213.707] (-3210.724) (-3211.995) * (-3206.137) [-3207.445] (-3206.620) (-3204.106) -- 0:01:19 746500 -- (-3203.772) (-3208.628) (-3206.778) [-3206.001] * [-3206.439] (-3206.716) (-3209.428) (-3212.025) -- 0:01:19 747000 -- [-3209.094] (-3205.546) (-3205.433) (-3206.854) * [-3207.165] (-3208.863) (-3207.564) (-3213.287) -- 0:01:18 747500 -- (-3204.464) [-3211.749] (-3204.969) (-3208.730) * [-3209.460] (-3208.800) (-3218.278) (-3207.538) -- 0:01:18 748000 -- (-3206.582) [-3205.919] (-3215.620) (-3210.898) * [-3205.249] (-3211.562) (-3215.476) (-3208.010) -- 0:01:18 748500 -- [-3206.045] (-3216.172) (-3211.565) (-3209.376) * (-3209.612) (-3204.670) (-3207.668) [-3210.769] -- 0:01:18 749000 -- (-3214.385) (-3213.637) [-3211.173] (-3207.198) * (-3208.333) (-3205.407) (-3208.914) [-3209.946] -- 0:01:18 749500 -- [-3205.882] (-3219.803) (-3206.479) (-3208.742) * [-3210.731] (-3212.115) (-3219.414) (-3205.537) -- 0:01:18 750000 -- [-3203.177] (-3215.878) (-3203.660) (-3210.546) * (-3206.122) [-3209.424] (-3211.977) (-3201.474) -- 0:01:18 Average standard deviation of split frequencies: 0.007850 750500 -- [-3205.732] (-3211.198) (-3212.807) (-3209.864) * (-3213.965) (-3204.355) [-3210.243] (-3204.373) -- 0:01:17 751000 -- (-3207.827) [-3209.534] (-3209.811) (-3207.693) * (-3202.078) (-3214.624) (-3204.907) [-3208.077] -- 0:01:17 751500 -- (-3204.589) (-3204.330) (-3211.003) [-3207.469] * [-3204.179] (-3212.821) (-3209.607) (-3206.930) -- 0:01:17 752000 -- (-3206.634) [-3204.678] (-3214.123) (-3211.185) * (-3209.346) (-3204.476) [-3206.997] (-3205.832) -- 0:01:17 752500 -- (-3212.796) (-3209.886) (-3210.479) [-3206.223] * (-3205.575) (-3212.876) [-3201.772] (-3216.631) -- 0:01:17 753000 -- (-3208.245) (-3205.805) [-3204.489] (-3209.622) * [-3206.454] (-3206.114) (-3207.454) (-3209.941) -- 0:01:17 753500 -- (-3208.090) (-3208.247) (-3210.540) [-3205.091] * [-3208.411] (-3210.515) (-3209.804) (-3207.393) -- 0:01:16 754000 -- (-3210.328) (-3200.957) (-3209.620) [-3209.018] * (-3213.051) (-3206.399) (-3202.331) [-3204.478] -- 0:01:16 754500 -- [-3205.772] (-3208.112) (-3204.623) (-3206.776) * (-3212.209) [-3213.482] (-3213.670) (-3212.740) -- 0:01:16 755000 -- (-3210.444) (-3203.577) (-3209.645) [-3212.532] * (-3204.365) (-3206.333) (-3214.608) [-3208.991] -- 0:01:16 Average standard deviation of split frequencies: 0.007794 755500 -- (-3207.700) (-3207.008) [-3205.132] (-3208.193) * (-3211.831) (-3215.092) (-3213.162) [-3208.935] -- 0:01:16 756000 -- [-3208.507] (-3213.861) (-3202.229) (-3207.977) * [-3209.005] (-3205.736) (-3213.169) (-3211.361) -- 0:01:16 756500 -- [-3209.997] (-3215.607) (-3210.725) (-3211.920) * (-3206.392) [-3207.322] (-3211.097) (-3208.169) -- 0:01:15 757000 -- [-3203.967] (-3202.515) (-3213.858) (-3222.726) * [-3201.393] (-3208.382) (-3212.769) (-3206.235) -- 0:01:15 757500 -- (-3209.832) [-3205.361] (-3206.474) (-3204.090) * (-3208.912) (-3205.284) (-3207.165) [-3206.401] -- 0:01:15 758000 -- [-3206.925] (-3214.076) (-3206.229) (-3205.216) * (-3209.553) (-3209.697) (-3215.288) [-3207.537] -- 0:01:15 758500 -- (-3214.452) (-3210.974) (-3212.005) [-3206.046] * [-3204.931] (-3211.355) (-3206.519) (-3207.854) -- 0:01:15 759000 -- (-3204.837) [-3205.342] (-3207.869) (-3204.823) * [-3205.404] (-3214.504) (-3212.322) (-3207.473) -- 0:01:15 759500 -- (-3209.916) (-3203.393) [-3207.310] (-3208.012) * (-3209.043) (-3206.534) [-3210.757] (-3212.304) -- 0:01:15 760000 -- [-3208.346] (-3209.555) (-3207.183) (-3205.230) * [-3208.321] (-3207.906) (-3205.010) (-3216.405) -- 0:01:14 Average standard deviation of split frequencies: 0.006507 760500 -- (-3210.935) (-3209.620) [-3212.059] (-3212.485) * (-3210.116) (-3213.457) [-3208.590] (-3209.308) -- 0:01:14 761000 -- (-3210.942) [-3208.256] (-3217.222) (-3209.674) * (-3209.125) [-3205.852] (-3208.946) (-3212.829) -- 0:01:14 761500 -- (-3203.966) (-3205.722) (-3209.898) [-3204.439] * (-3208.707) (-3210.744) (-3211.865) [-3210.098] -- 0:01:14 762000 -- (-3209.742) [-3205.322] (-3209.706) (-3214.079) * (-3210.619) (-3213.998) [-3207.742] (-3207.278) -- 0:01:14 762500 -- (-3205.190) [-3207.902] (-3203.922) (-3211.707) * [-3204.277] (-3209.802) (-3206.468) (-3210.896) -- 0:01:14 763000 -- (-3205.964) [-3215.018] (-3209.735) (-3216.572) * (-3206.142) (-3206.984) (-3205.224) [-3205.851] -- 0:01:13 763500 -- (-3209.065) (-3206.320) (-3204.867) [-3205.750] * (-3214.241) (-3213.224) [-3210.407] (-3214.684) -- 0:01:13 764000 -- (-3216.868) (-3214.301) (-3201.618) [-3206.645] * [-3206.558] (-3207.657) (-3208.011) (-3210.279) -- 0:01:13 764500 -- (-3212.661) [-3211.232] (-3207.578) (-3203.972) * [-3204.425] (-3212.986) (-3206.546) (-3209.042) -- 0:01:13 765000 -- (-3210.032) (-3206.600) [-3208.637] (-3207.116) * [-3203.989] (-3210.933) (-3207.832) (-3209.594) -- 0:01:13 Average standard deviation of split frequencies: 0.006462 765500 -- [-3204.455] (-3207.837) (-3215.874) (-3206.956) * (-3210.057) [-3207.901] (-3207.043) (-3211.806) -- 0:01:13 766000 -- [-3203.750] (-3205.534) (-3214.029) (-3207.867) * (-3206.168) (-3216.066) (-3212.171) [-3210.621] -- 0:01:13 766500 -- (-3212.459) (-3203.579) (-3213.221) [-3204.727] * [-3204.655] (-3208.675) (-3214.209) (-3211.134) -- 0:01:12 767000 -- (-3205.654) (-3210.072) (-3212.547) [-3210.433] * (-3202.707) (-3206.877) (-3211.213) [-3206.843] -- 0:01:12 767500 -- (-3208.545) (-3203.585) (-3206.310) [-3213.152] * (-3207.972) (-3211.978) [-3214.121] (-3207.059) -- 0:01:12 768000 -- (-3212.800) (-3205.419) [-3212.537] (-3205.926) * (-3214.544) (-3208.010) (-3207.902) [-3210.187] -- 0:01:12 768500 -- (-3212.507) (-3202.477) [-3204.825] (-3214.611) * [-3209.794] (-3206.356) (-3208.226) (-3210.537) -- 0:01:12 769000 -- (-3209.255) (-3206.476) (-3213.168) [-3213.039] * [-3209.459] (-3214.328) (-3207.257) (-3204.534) -- 0:01:12 769500 -- (-3211.965) (-3206.276) [-3213.344] (-3215.224) * (-3222.325) (-3210.258) [-3208.644] (-3209.086) -- 0:01:11 770000 -- [-3208.442] (-3208.048) (-3208.303) (-3224.775) * (-3213.101) (-3214.207) (-3208.386) [-3210.459] -- 0:01:11 Average standard deviation of split frequencies: 0.005811 770500 -- (-3212.390) (-3206.963) [-3209.417] (-3210.013) * (-3208.374) [-3212.207] (-3209.806) (-3205.642) -- 0:01:11 771000 -- (-3212.065) (-3209.546) [-3204.600] (-3216.879) * (-3206.321) [-3207.320] (-3216.912) (-3203.420) -- 0:01:11 771500 -- [-3208.168] (-3211.786) (-3211.164) (-3209.942) * (-3215.275) (-3210.804) [-3211.323] (-3207.968) -- 0:01:11 772000 -- [-3205.738] (-3210.590) (-3205.250) (-3206.063) * (-3204.300) (-3219.028) [-3206.481] (-3206.734) -- 0:01:11 772500 -- (-3209.793) (-3207.784) (-3209.550) [-3202.707] * (-3210.328) [-3215.861] (-3208.313) (-3208.570) -- 0:01:10 773000 -- (-3203.837) [-3201.063] (-3201.876) (-3209.995) * (-3204.179) (-3207.438) [-3208.948] (-3205.330) -- 0:01:10 773500 -- (-3206.659) (-3205.725) [-3210.040] (-3214.703) * [-3207.081] (-3204.963) (-3217.855) (-3212.792) -- 0:01:10 774000 -- (-3212.316) (-3207.003) [-3205.246] (-3215.110) * (-3206.778) (-3213.705) (-3211.376) [-3214.181] -- 0:01:10 774500 -- (-3209.799) (-3219.831) (-3204.506) [-3207.400] * [-3201.489] (-3210.520) (-3212.269) (-3208.124) -- 0:01:10 775000 -- [-3209.072] (-3207.513) (-3203.836) (-3210.834) * [-3206.219] (-3208.917) (-3203.280) (-3203.768) -- 0:01:10 Average standard deviation of split frequencies: 0.005771 775500 -- [-3207.431] (-3211.140) (-3206.538) (-3204.157) * (-3208.524) (-3213.078) [-3203.342] (-3206.077) -- 0:01:10 776000 -- (-3210.602) [-3207.275] (-3211.682) (-3208.397) * (-3212.236) [-3210.010] (-3208.165) (-3206.757) -- 0:01:09 776500 -- (-3201.682) [-3206.512] (-3207.210) (-3211.954) * (-3209.641) (-3211.292) [-3206.894] (-3202.201) -- 0:01:09 777000 -- (-3205.775) [-3201.492] (-3210.578) (-3218.432) * (-3210.297) (-3208.097) [-3203.233] (-3206.908) -- 0:01:09 777500 -- [-3204.207] (-3203.631) (-3212.579) (-3208.454) * (-3208.131) [-3207.442] (-3217.535) (-3209.905) -- 0:01:09 778000 -- (-3209.133) (-3207.819) [-3208.994] (-3212.194) * (-3205.951) (-3209.176) [-3210.643] (-3208.960) -- 0:01:09 778500 -- (-3212.861) (-3208.979) [-3205.311] (-3207.686) * (-3206.871) (-3206.292) (-3215.850) [-3212.163] -- 0:01:09 779000 -- (-3206.436) (-3207.002) [-3206.093] (-3211.846) * (-3210.737) (-3211.958) (-3208.872) [-3211.808] -- 0:01:08 779500 -- (-3220.896) [-3207.807] (-3206.582) (-3207.897) * [-3205.727] (-3209.348) (-3205.836) (-3211.161) -- 0:01:08 780000 -- (-3209.620) [-3204.983] (-3205.083) (-3209.876) * (-3208.557) (-3210.266) [-3208.233] (-3213.823) -- 0:01:08 Average standard deviation of split frequencies: 0.004831 780500 -- (-3213.228) (-3209.525) (-3214.846) [-3209.568] * (-3205.373) [-3207.214] (-3202.509) (-3209.723) -- 0:01:08 781000 -- (-3213.962) (-3206.357) (-3206.944) [-3208.130] * (-3205.537) (-3211.764) (-3217.160) [-3204.674] -- 0:01:08 781500 -- (-3205.777) [-3200.928] (-3206.671) (-3218.077) * (-3213.644) (-3208.564) (-3209.141) [-3202.281] -- 0:01:08 782000 -- (-3204.528) [-3203.513] (-3214.149) (-3215.352) * (-3213.889) [-3208.164] (-3207.595) (-3209.084) -- 0:01:08 782500 -- [-3206.764] (-3209.481) (-3204.012) (-3214.467) * (-3215.651) (-3216.352) (-3204.330) [-3208.629] -- 0:01:07 783000 -- (-3211.260) (-3208.559) (-3212.454) [-3204.864] * [-3209.054] (-3216.175) (-3204.584) (-3207.059) -- 0:01:07 783500 -- [-3209.958] (-3207.303) (-3206.227) (-3204.126) * (-3205.895) (-3213.814) (-3204.892) [-3208.006] -- 0:01:07 784000 -- (-3204.595) [-3209.828] (-3205.711) (-3206.099) * [-3210.727] (-3206.028) (-3205.494) (-3206.261) -- 0:01:07 784500 -- [-3215.409] (-3210.304) (-3210.080) (-3211.852) * [-3206.238] (-3207.956) (-3208.408) (-3208.072) -- 0:01:07 785000 -- (-3210.943) (-3212.409) [-3209.242] (-3206.711) * (-3203.574) (-3204.011) [-3206.088] (-3209.847) -- 0:01:07 Average standard deviation of split frequencies: 0.005998 785500 -- (-3208.009) (-3204.983) [-3208.334] (-3210.637) * [-3201.755] (-3209.935) (-3206.036) (-3211.972) -- 0:01:06 786000 -- (-3206.539) (-3208.544) (-3211.117) [-3206.188] * (-3213.297) (-3212.150) (-3203.594) [-3210.154] -- 0:01:06 786500 -- (-3217.811) (-3211.504) (-3210.569) [-3206.781] * [-3210.272] (-3209.172) (-3205.099) (-3213.069) -- 0:01:06 787000 -- (-3208.618) (-3205.475) [-3209.971] (-3210.832) * (-3203.997) [-3206.876] (-3206.230) (-3210.694) -- 0:01:06 787500 -- (-3206.741) (-3210.647) (-3207.918) [-3207.000] * (-3206.152) (-3207.991) [-3207.902] (-3212.138) -- 0:01:06 788000 -- (-3207.970) [-3210.646] (-3207.253) (-3209.001) * (-3204.283) (-3206.849) (-3210.151) [-3206.997] -- 0:01:06 788500 -- (-3212.505) [-3203.098] (-3213.345) (-3217.043) * (-3205.369) [-3210.025] (-3206.147) (-3204.818) -- 0:01:05 789000 -- [-3203.968] (-3207.656) (-3213.754) (-3205.311) * (-3205.718) (-3209.229) (-3206.886) [-3207.088] -- 0:01:05 789500 -- (-3208.629) [-3207.923] (-3210.719) (-3207.437) * (-3212.119) (-3207.861) [-3205.514] (-3207.517) -- 0:01:05 790000 -- [-3204.346] (-3206.847) (-3204.528) (-3220.462) * (-3204.772) (-3212.953) [-3205.791] (-3215.429) -- 0:01:05 Average standard deviation of split frequencies: 0.005664 790500 -- (-3206.879) (-3206.748) [-3204.711] (-3205.618) * (-3210.805) (-3209.486) [-3202.208] (-3211.488) -- 0:01:05 791000 -- [-3204.942] (-3207.788) (-3211.113) (-3209.679) * (-3207.041) [-3204.623] (-3211.741) (-3217.905) -- 0:01:05 791500 -- (-3208.136) (-3210.413) (-3207.293) [-3212.060] * (-3213.929) (-3206.624) [-3207.160] (-3208.597) -- 0:01:05 792000 -- [-3206.795] (-3212.814) (-3209.181) (-3208.588) * (-3205.240) [-3209.360] (-3215.838) (-3211.564) -- 0:01:04 792500 -- (-3217.068) (-3208.497) (-3207.120) [-3205.268] * [-3210.076] (-3204.707) (-3209.070) (-3221.068) -- 0:01:04 793000 -- (-3216.288) (-3206.545) (-3205.361) [-3208.235] * (-3209.068) (-3211.531) (-3209.273) [-3213.403] -- 0:01:04 793500 -- (-3211.192) [-3203.927] (-3207.632) (-3216.919) * (-3203.863) (-3207.182) (-3210.215) [-3209.486] -- 0:01:04 794000 -- (-3218.227) (-3207.971) [-3204.863] (-3210.101) * (-3209.303) (-3207.599) (-3210.023) [-3209.307] -- 0:01:04 794500 -- (-3205.396) [-3205.780] (-3206.235) (-3210.165) * (-3210.454) (-3208.470) (-3209.094) [-3205.978] -- 0:01:04 795000 -- (-3206.154) [-3203.851] (-3207.391) (-3208.419) * (-3209.582) (-3215.342) [-3207.433] (-3206.264) -- 0:01:03 Average standard deviation of split frequencies: 0.005034 795500 -- [-3202.827] (-3211.284) (-3212.195) (-3203.426) * (-3205.302) [-3204.555] (-3209.250) (-3213.307) -- 0:01:03 796000 -- [-3205.480] (-3216.526) (-3208.217) (-3203.816) * (-3202.077) (-3208.462) (-3206.213) [-3205.145] -- 0:01:03 796500 -- (-3210.795) [-3207.106] (-3209.744) (-3210.559) * (-3214.303) (-3212.122) [-3204.428] (-3210.782) -- 0:01:03 797000 -- [-3207.336] (-3208.683) (-3206.540) (-3208.254) * (-3210.374) (-3205.884) [-3212.461] (-3212.674) -- 0:01:03 797500 -- (-3212.251) (-3213.777) (-3207.112) [-3203.099] * (-3203.982) (-3206.392) (-3209.100) [-3211.531] -- 0:01:03 798000 -- [-3223.354] (-3213.225) (-3209.293) (-3207.775) * (-3205.228) (-3208.659) [-3209.881] (-3214.598) -- 0:01:03 798500 -- (-3208.348) [-3215.812] (-3208.797) (-3211.581) * [-3206.653] (-3213.950) (-3206.553) (-3206.773) -- 0:01:02 799000 -- (-3208.238) [-3215.881] (-3210.491) (-3205.284) * (-3205.329) (-3203.339) (-3206.103) [-3209.398] -- 0:01:02 799500 -- [-3211.455] (-3214.114) (-3207.278) (-3210.957) * (-3210.322) (-3208.003) (-3203.564) [-3214.368] -- 0:01:02 800000 -- (-3208.707) (-3210.950) [-3206.012] (-3206.420) * (-3205.540) (-3203.941) (-3208.762) [-3206.072] -- 0:01:02 Average standard deviation of split frequencies: 0.005005 800500 -- (-3214.620) (-3208.903) (-3210.621) [-3207.075] * (-3204.000) [-3206.938] (-3211.788) (-3208.688) -- 0:01:02 801000 -- (-3205.741) [-3213.428] (-3206.593) (-3205.213) * [-3210.468] (-3211.298) (-3221.588) (-3210.284) -- 0:01:02 801500 -- (-3212.631) (-3204.868) (-3207.518) [-3206.472] * (-3204.307) [-3204.661] (-3209.420) (-3214.286) -- 0:01:01 802000 -- [-3215.624] (-3212.368) (-3219.309) (-3205.927) * [-3204.156] (-3210.621) (-3213.620) (-3210.671) -- 0:01:01 802500 -- (-3207.728) (-3211.465) [-3207.686] (-3211.368) * (-3209.379) [-3209.012] (-3205.727) (-3203.519) -- 0:01:01 803000 -- (-3210.267) (-3208.909) [-3206.471] (-3206.763) * [-3202.178] (-3208.103) (-3205.823) (-3216.248) -- 0:01:01 803500 -- (-3214.714) (-3205.426) (-3209.267) [-3213.813] * [-3205.463] (-3204.962) (-3206.377) (-3208.389) -- 0:01:01 804000 -- [-3210.531] (-3206.121) (-3205.428) (-3213.614) * [-3211.334] (-3214.725) (-3206.161) (-3207.463) -- 0:01:01 804500 -- [-3203.408] (-3213.591) (-3208.998) (-3208.026) * (-3207.682) [-3212.906] (-3211.536) (-3213.026) -- 0:01:00 805000 -- [-3205.878] (-3213.539) (-3213.011) (-3204.947) * (-3208.218) (-3205.281) [-3207.951] (-3208.485) -- 0:01:00 Average standard deviation of split frequencies: 0.005264 805500 -- (-3216.090) [-3210.499] (-3209.891) (-3209.839) * (-3212.791) (-3205.391) [-3210.300] (-3211.958) -- 0:01:00 806000 -- (-3206.676) [-3204.784] (-3214.061) (-3214.191) * (-3215.023) [-3209.669] (-3213.000) (-3202.012) -- 0:01:00 806500 -- (-3207.669) (-3212.642) [-3211.681] (-3212.410) * (-3214.124) (-3219.176) (-3215.621) [-3205.681] -- 0:01:00 807000 -- (-3210.192) (-3211.691) (-3211.089) [-3215.048] * (-3219.287) (-3209.193) (-3213.664) [-3206.448] -- 0:01:00 807500 -- (-3210.195) [-3205.030] (-3210.726) (-3208.715) * [-3212.906] (-3211.647) (-3201.456) (-3202.090) -- 0:01:00 808000 -- (-3211.967) (-3207.361) (-3206.064) [-3210.301] * (-3209.383) (-3204.139) (-3202.634) [-3210.157] -- 0:00:59 808500 -- (-3208.730) (-3212.992) (-3213.861) [-3203.419] * (-3212.727) (-3207.478) [-3206.215] (-3207.437) -- 0:00:59 809000 -- (-3210.544) (-3212.951) (-3210.077) [-3210.882] * (-3205.301) (-3208.608) (-3206.555) [-3218.136] -- 0:00:59 809500 -- [-3212.372] (-3204.486) (-3206.704) (-3213.106) * (-3214.945) (-3206.898) [-3206.084] (-3214.317) -- 0:00:59 810000 -- (-3207.547) [-3215.840] (-3207.269) (-3205.839) * (-3209.884) [-3205.617] (-3207.422) (-3208.081) -- 0:00:59 Average standard deviation of split frequencies: 0.005815 810500 -- (-3209.803) (-3209.505) [-3209.291] (-3206.668) * (-3220.040) [-3208.020] (-3205.941) (-3204.639) -- 0:00:59 811000 -- [-3205.149] (-3206.963) (-3211.346) (-3210.372) * (-3210.527) [-3203.324] (-3206.128) (-3207.374) -- 0:00:58 811500 -- (-3206.056) (-3204.748) (-3209.223) [-3205.035] * (-3215.963) (-3207.606) [-3207.477] (-3212.300) -- 0:00:58 812000 -- (-3208.300) (-3201.474) [-3209.381] (-3208.863) * [-3208.565] (-3212.814) (-3209.172) (-3216.257) -- 0:00:58 812500 -- [-3205.622] (-3207.208) (-3203.954) (-3206.673) * (-3210.680) (-3218.064) (-3211.053) [-3204.870] -- 0:00:58 813000 -- [-3202.293] (-3208.448) (-3203.215) (-3211.865) * (-3223.434) [-3205.994] (-3205.327) (-3207.703) -- 0:00:58 813500 -- (-3208.093) [-3207.397] (-3208.698) (-3207.042) * (-3221.323) (-3207.374) (-3208.541) [-3206.255] -- 0:00:58 814000 -- (-3208.048) (-3206.823) [-3210.389] (-3211.083) * (-3218.803) (-3211.585) (-3209.585) [-3201.999] -- 0:00:58 814500 -- (-3212.700) [-3205.300] (-3210.794) (-3206.534) * (-3204.131) (-3208.012) (-3210.954) [-3200.537] -- 0:00:57 815000 -- (-3211.314) (-3206.532) [-3202.669] (-3210.882) * [-3204.182] (-3209.323) (-3206.226) (-3206.269) -- 0:00:57 Average standard deviation of split frequencies: 0.006355 815500 -- (-3211.734) [-3203.271] (-3206.639) (-3204.763) * (-3210.539) (-3220.204) [-3212.772] (-3211.139) -- 0:00:57 816000 -- (-3207.479) (-3199.566) (-3206.367) [-3203.545] * [-3208.824] (-3211.378) (-3214.357) (-3212.220) -- 0:00:57 816500 -- (-3204.855) [-3208.652] (-3207.369) (-3215.261) * (-3213.591) (-3210.534) [-3207.823] (-3204.666) -- 0:00:57 817000 -- (-3208.698) [-3205.543] (-3209.007) (-3208.524) * (-3206.970) (-3219.013) [-3208.386] (-3207.150) -- 0:00:57 817500 -- (-3212.153) [-3207.781] (-3203.997) (-3207.518) * (-3208.487) [-3211.938] (-3211.935) (-3207.854) -- 0:00:56 818000 -- (-3212.158) (-3208.369) (-3210.823) [-3205.898] * (-3211.532) [-3207.345] (-3210.731) (-3211.344) -- 0:00:56 818500 -- [-3206.173] (-3207.605) (-3214.364) (-3206.573) * (-3206.999) [-3202.168] (-3209.236) (-3206.596) -- 0:00:56 819000 -- (-3212.954) [-3207.816] (-3209.634) (-3208.450) * (-3210.862) (-3210.031) (-3208.369) [-3208.568] -- 0:00:56 819500 -- [-3214.471] (-3214.803) (-3209.379) (-3205.596) * (-3214.377) (-3213.246) (-3215.358) [-3206.233] -- 0:00:56 820000 -- (-3208.379) (-3206.083) [-3211.861] (-3206.797) * (-3204.412) (-3210.629) (-3212.217) [-3215.997] -- 0:00:56 Average standard deviation of split frequencies: 0.005457 820500 -- [-3201.948] (-3205.235) (-3207.652) (-3210.924) * (-3213.418) [-3202.306] (-3205.232) (-3207.349) -- 0:00:56 821000 -- [-3204.639] (-3205.916) (-3209.668) (-3209.313) * (-3207.655) [-3206.798] (-3202.823) (-3206.878) -- 0:00:55 821500 -- (-3208.241) (-3208.192) (-3209.944) [-3209.330] * (-3203.181) (-3209.883) [-3209.067] (-3218.456) -- 0:00:55 822000 -- (-3206.827) (-3205.488) (-3205.909) [-3203.984] * (-3207.998) (-3206.691) (-3210.004) [-3206.001] -- 0:00:55 822500 -- (-3209.257) (-3211.173) (-3212.351) [-3210.951] * (-3206.065) (-3205.626) [-3202.742] (-3210.441) -- 0:00:55 823000 -- (-3208.955) (-3207.452) [-3205.925] (-3214.009) * [-3209.849] (-3204.898) (-3212.217) (-3213.294) -- 0:00:55 823500 -- (-3209.975) [-3210.266] (-3215.420) (-3217.724) * (-3205.501) (-3212.949) [-3208.423] (-3211.929) -- 0:00:55 824000 -- [-3207.615] (-3208.181) (-3207.215) (-3210.497) * (-3211.206) (-3209.918) (-3207.345) [-3213.889] -- 0:00:54 824500 -- (-3208.804) (-3205.813) (-3206.314) [-3208.580] * (-3208.067) (-3210.741) (-3209.324) [-3211.528] -- 0:00:54 825000 -- (-3210.218) [-3212.082] (-3208.792) (-3205.061) * (-3216.188) (-3203.266) [-3204.205] (-3204.803) -- 0:00:54 Average standard deviation of split frequencies: 0.004280 825500 -- (-3214.516) (-3210.448) (-3205.926) [-3210.303] * (-3202.246) (-3208.847) (-3207.912) [-3206.981] -- 0:00:54 826000 -- (-3206.904) (-3214.170) [-3208.131] (-3209.601) * (-3205.709) (-3208.482) [-3206.152] (-3205.663) -- 0:00:54 826500 -- [-3205.917] (-3207.580) (-3210.519) (-3209.146) * (-3207.385) (-3207.675) [-3213.192] (-3204.236) -- 0:00:54 827000 -- (-3207.322) (-3209.988) [-3216.340] (-3208.614) * (-3204.239) (-3208.470) [-3208.099] (-3211.223) -- 0:00:53 827500 -- (-3206.126) (-3214.818) [-3203.655] (-3208.523) * (-3202.772) (-3210.672) [-3202.539] (-3209.021) -- 0:00:53 828000 -- (-3214.991) (-3207.390) (-3204.860) [-3208.506] * (-3207.098) (-3207.478) (-3206.796) [-3205.921] -- 0:00:53 828500 -- (-3207.654) (-3207.297) (-3207.507) [-3206.687] * (-3208.120) (-3207.027) [-3207.085] (-3207.863) -- 0:00:53 829000 -- (-3218.312) (-3205.220) [-3210.495] (-3207.029) * [-3206.585] (-3215.498) (-3213.555) (-3210.653) -- 0:00:53 829500 -- [-3201.548] (-3206.056) (-3209.657) (-3207.492) * (-3206.887) [-3207.163] (-3207.728) (-3213.554) -- 0:00:53 830000 -- [-3205.041] (-3211.837) (-3204.373) (-3220.125) * (-3205.788) (-3206.562) (-3210.290) [-3209.895] -- 0:00:53 Average standard deviation of split frequencies: 0.005391 830500 -- (-3209.138) (-3206.505) [-3211.062] (-3210.235) * (-3207.674) (-3213.131) [-3205.262] (-3207.938) -- 0:00:52 831000 -- (-3207.330) [-3208.790] (-3207.346) (-3206.613) * (-3208.052) (-3214.241) [-3209.360] (-3204.616) -- 0:00:52 831500 -- (-3212.893) (-3207.620) (-3207.350) [-3204.914] * [-3205.864] (-3215.898) (-3207.517) (-3207.961) -- 0:00:52 832000 -- (-3218.261) (-3213.678) [-3206.514] (-3211.967) * (-3205.362) [-3204.831] (-3208.741) (-3203.431) -- 0:00:52 832500 -- (-3201.156) (-3207.809) (-3207.060) [-3212.644] * (-3211.650) (-3206.020) (-3211.801) [-3211.141] -- 0:00:52 833000 -- (-3207.127) (-3210.458) [-3211.543] (-3212.274) * (-3212.676) [-3206.516] (-3211.696) (-3209.763) -- 0:00:52 833500 -- (-3206.425) (-3203.599) [-3206.947] (-3212.555) * (-3208.762) (-3218.972) [-3206.446] (-3209.849) -- 0:00:51 834000 -- [-3206.224] (-3206.528) (-3208.152) (-3207.797) * (-3208.078) (-3206.622) [-3200.777] (-3208.996) -- 0:00:51 834500 -- (-3212.579) (-3213.390) (-3208.200) [-3206.873] * (-3217.587) (-3205.069) [-3205.301] (-3220.259) -- 0:00:51 835000 -- (-3204.737) (-3206.999) (-3202.082) [-3211.353] * (-3211.954) [-3205.439] (-3206.226) (-3210.248) -- 0:00:51 Average standard deviation of split frequencies: 0.005639 835500 -- (-3205.400) [-3209.295] (-3205.812) (-3214.850) * (-3213.822) (-3206.440) [-3206.299] (-3205.740) -- 0:00:51 836000 -- [-3207.471] (-3206.018) (-3209.267) (-3208.907) * (-3211.166) [-3207.650] (-3205.577) (-3203.969) -- 0:00:51 836500 -- (-3205.890) (-3206.681) [-3211.616] (-3208.393) * (-3207.091) [-3205.220] (-3209.176) (-3207.538) -- 0:00:51 837000 -- [-3209.486] (-3208.782) (-3206.089) (-3205.377) * [-3203.386] (-3208.668) (-3211.156) (-3214.653) -- 0:00:50 837500 -- [-3208.974] (-3214.344) (-3211.957) (-3203.171) * (-3207.623) (-3211.151) (-3206.896) [-3212.525] -- 0:00:50 838000 -- (-3206.435) [-3206.373] (-3216.284) (-3206.522) * [-3205.079] (-3209.153) (-3208.072) (-3206.831) -- 0:00:50 838500 -- (-3211.902) (-3208.953) (-3209.675) [-3208.281] * [-3206.069] (-3209.305) (-3209.772) (-3203.454) -- 0:00:50 839000 -- [-3207.265] (-3211.412) (-3211.243) (-3207.085) * (-3204.952) (-3209.240) (-3205.562) [-3209.054] -- 0:00:50 839500 -- (-3208.104) (-3213.787) (-3205.678) [-3203.960] * [-3206.732] (-3209.087) (-3205.665) (-3204.507) -- 0:00:50 840000 -- (-3205.767) (-3210.296) (-3209.153) [-3205.964] * (-3204.985) [-3210.071] (-3211.981) (-3209.240) -- 0:00:49 Average standard deviation of split frequencies: 0.005608 840500 -- (-3204.505) (-3209.885) [-3207.119] (-3207.203) * (-3205.415) (-3208.089) (-3214.189) [-3204.555] -- 0:00:49 841000 -- (-3209.641) [-3210.062] (-3206.721) (-3210.769) * (-3210.024) (-3210.483) [-3208.198] (-3208.323) -- 0:00:49 841500 -- (-3214.346) [-3208.924] (-3203.773) (-3209.147) * (-3216.469) [-3208.421] (-3212.342) (-3213.662) -- 0:00:49 842000 -- (-3211.324) (-3204.791) [-3207.295] (-3210.634) * [-3207.131] (-3207.830) (-3216.905) (-3206.903) -- 0:00:49 842500 -- (-3209.680) (-3208.607) [-3203.329] (-3210.539) * (-3205.249) [-3209.827] (-3207.450) (-3215.668) -- 0:00:49 843000 -- (-3213.374) (-3209.306) [-3208.555] (-3206.457) * (-3209.090) [-3212.589] (-3216.446) (-3204.491) -- 0:00:48 843500 -- [-3210.327] (-3211.887) (-3211.535) (-3208.345) * (-3209.531) (-3210.077) (-3202.655) [-3202.551] -- 0:00:48 844000 -- [-3207.509] (-3210.619) (-3207.739) (-3206.420) * [-3208.294] (-3212.141) (-3207.638) (-3211.511) -- 0:00:48 844500 -- (-3205.414) (-3206.340) (-3215.003) [-3212.138] * (-3204.577) [-3211.541] (-3209.440) (-3203.284) -- 0:00:48 845000 -- [-3205.134] (-3216.967) (-3213.243) (-3215.305) * (-3204.653) [-3209.375] (-3216.961) (-3204.109) -- 0:00:48 Average standard deviation of split frequencies: 0.005572 845500 -- (-3207.029) [-3204.259] (-3207.757) (-3209.839) * (-3207.515) (-3206.606) (-3209.284) [-3209.251] -- 0:00:48 846000 -- (-3203.897) [-3206.974] (-3207.742) (-3206.380) * [-3201.676] (-3212.034) (-3215.106) (-3217.340) -- 0:00:48 846500 -- (-3208.133) (-3203.929) (-3212.336) [-3208.854] * (-3203.307) [-3213.176] (-3209.290) (-3209.707) -- 0:00:47 847000 -- (-3205.771) (-3205.503) (-3204.183) [-3208.064] * (-3206.132) (-3211.979) [-3205.819] (-3208.091) -- 0:00:47 847500 -- (-3206.674) [-3206.251] (-3209.535) (-3219.599) * (-3208.655) (-3207.078) [-3207.551] (-3210.518) -- 0:00:47 848000 -- (-3213.798) (-3209.756) [-3206.813] (-3211.042) * (-3209.157) [-3202.893] (-3204.874) (-3208.850) -- 0:00:47 848500 -- (-3211.056) (-3204.239) [-3208.992] (-3208.671) * (-3212.249) (-3208.392) (-3211.377) [-3206.159] -- 0:00:47 849000 -- (-3208.385) (-3202.520) [-3205.850] (-3208.996) * (-3212.045) (-3213.555) [-3209.676] (-3205.579) -- 0:00:47 849500 -- (-3206.062) (-3202.356) (-3212.350) [-3206.762] * (-3214.397) [-3209.186] (-3208.293) (-3208.806) -- 0:00:46 850000 -- (-3206.418) (-3207.751) (-3206.451) [-3205.933] * (-3202.276) (-3211.835) [-3201.791] (-3206.760) -- 0:00:46 Average standard deviation of split frequencies: 0.006096 850500 -- (-3212.066) [-3203.595] (-3206.866) (-3209.064) * (-3211.462) (-3215.381) [-3205.484] (-3208.407) -- 0:00:46 851000 -- (-3210.375) [-3202.606] (-3212.069) (-3209.024) * (-3206.974) (-3210.865) (-3208.229) [-3203.391] -- 0:00:46 851500 -- (-3208.305) [-3207.562] (-3213.309) (-3204.528) * (-3213.693) (-3207.800) [-3212.897] (-3209.605) -- 0:00:46 852000 -- (-3208.672) (-3207.877) [-3209.726] (-3208.841) * [-3206.342] (-3207.228) (-3207.276) (-3212.038) -- 0:00:46 852500 -- (-3205.374) (-3210.806) [-3204.404] (-3211.679) * (-3213.257) (-3207.456) (-3208.422) [-3209.603] -- 0:00:46 853000 -- [-3205.374] (-3213.422) (-3208.334) (-3204.855) * (-3205.135) (-3213.991) [-3206.516] (-3202.757) -- 0:00:45 853500 -- (-3205.685) (-3206.325) [-3203.458] (-3208.106) * (-3209.001) [-3209.903] (-3206.555) (-3208.357) -- 0:00:45 854000 -- (-3202.183) (-3214.032) [-3206.560] (-3209.760) * (-3204.446) (-3207.866) (-3203.500) [-3212.963] -- 0:00:45 854500 -- (-3208.184) [-3205.158] (-3203.370) (-3218.679) * (-3210.770) (-3203.878) (-3205.217) [-3206.565] -- 0:00:45 855000 -- (-3204.741) (-3208.872) [-3203.103] (-3209.455) * (-3210.111) [-3201.529] (-3208.178) (-3207.697) -- 0:00:45 Average standard deviation of split frequencies: 0.006058 855500 -- (-3214.063) (-3207.452) (-3209.874) [-3207.448] * (-3211.131) [-3205.951] (-3205.233) (-3212.830) -- 0:00:45 856000 -- (-3207.532) (-3214.168) [-3207.407] (-3213.738) * [-3209.608] (-3203.979) (-3206.155) (-3207.202) -- 0:00:44 856500 -- (-3205.043) [-3210.221] (-3210.148) (-3206.142) * (-3208.717) (-3204.105) (-3206.720) [-3210.828] -- 0:00:44 857000 -- (-3205.356) (-3210.393) [-3211.011] (-3211.203) * [-3203.766] (-3211.280) (-3202.361) (-3211.320) -- 0:00:44 857500 -- (-3213.335) [-3206.204] (-3214.104) (-3213.315) * (-3204.364) (-3209.985) (-3207.706) [-3206.823] -- 0:00:44 858000 -- (-3211.685) (-3211.562) (-3220.204) [-3219.060] * [-3204.859] (-3208.740) (-3211.405) (-3208.900) -- 0:00:44 858500 -- [-3208.864] (-3208.266) (-3207.275) (-3216.242) * (-3208.871) (-3207.517) [-3206.592] (-3210.718) -- 0:00:44 859000 -- (-3216.201) (-3209.100) [-3206.768] (-3218.992) * (-3209.515) (-3204.432) (-3208.823) [-3202.935] -- 0:00:43 859500 -- (-3205.012) (-3211.345) [-3204.114] (-3208.577) * [-3205.319] (-3207.195) (-3208.413) (-3204.303) -- 0:00:43 860000 -- [-3210.200] (-3206.384) (-3205.869) (-3214.309) * [-3201.462] (-3204.869) (-3215.642) (-3209.198) -- 0:00:43 Average standard deviation of split frequencies: 0.006573 860500 -- [-3205.576] (-3215.331) (-3215.735) (-3212.790) * (-3210.852) (-3209.464) [-3208.564] (-3203.905) -- 0:00:43 861000 -- (-3208.753) (-3211.518) [-3205.651] (-3207.967) * [-3210.814] (-3211.862) (-3212.855) (-3212.515) -- 0:00:43 861500 -- [-3205.170] (-3211.365) (-3211.549) (-3212.097) * [-3208.744] (-3202.334) (-3210.480) (-3208.344) -- 0:00:43 862000 -- (-3209.037) (-3210.460) [-3206.184] (-3207.903) * (-3208.868) (-3203.790) [-3207.624] (-3212.872) -- 0:00:43 862500 -- (-3209.804) (-3210.298) [-3208.346] (-3206.362) * (-3205.503) (-3211.445) (-3206.874) [-3211.379] -- 0:00:42 863000 -- (-3209.085) (-3218.583) [-3206.199] (-3209.783) * [-3205.695] (-3217.367) (-3207.443) (-3211.849) -- 0:00:42 863500 -- [-3208.394] (-3211.232) (-3208.820) (-3204.774) * (-3211.065) [-3206.540] (-3211.906) (-3210.414) -- 0:00:42 864000 -- (-3207.075) (-3208.308) [-3207.963] (-3211.880) * [-3206.068] (-3206.634) (-3207.108) (-3209.268) -- 0:00:42 864500 -- (-3213.036) (-3205.883) [-3205.463] (-3210.714) * (-3207.425) (-3202.706) (-3204.171) [-3206.856] -- 0:00:42 865000 -- (-3210.238) [-3209.135] (-3211.783) (-3207.830) * (-3208.864) (-3208.003) [-3205.173] (-3208.707) -- 0:00:42 Average standard deviation of split frequencies: 0.006260 865500 -- (-3204.906) (-3206.004) [-3207.749] (-3215.790) * [-3207.009] (-3204.394) (-3219.447) (-3212.186) -- 0:00:41 866000 -- [-3211.714] (-3211.019) (-3210.674) (-3210.159) * [-3204.872] (-3204.774) (-3209.914) (-3209.278) -- 0:00:41 866500 -- (-3202.539) (-3213.316) [-3209.220] (-3202.667) * (-3207.853) [-3204.200] (-3204.631) (-3211.692) -- 0:00:41 867000 -- [-3212.712] (-3207.965) (-3207.113) (-3203.862) * (-3208.278) [-3210.452] (-3207.858) (-3206.291) -- 0:00:41 867500 -- (-3209.235) (-3205.603) (-3212.435) [-3208.196] * (-3206.836) [-3207.221] (-3213.890) (-3205.065) -- 0:00:41 868000 -- (-3209.087) (-3209.425) (-3210.180) [-3205.582] * (-3219.059) (-3207.658) [-3207.836] (-3212.728) -- 0:00:41 868500 -- (-3207.826) [-3206.731] (-3214.882) (-3204.626) * (-3206.700) (-3211.574) [-3209.888] (-3210.436) -- 0:00:41 869000 -- (-3207.584) (-3205.430) [-3207.116] (-3204.746) * [-3211.393] (-3210.006) (-3208.319) (-3206.215) -- 0:00:40 869500 -- [-3206.713] (-3205.527) (-3211.996) (-3206.009) * [-3204.986] (-3206.517) (-3210.475) (-3208.200) -- 0:00:40 870000 -- (-3204.633) (-3208.313) (-3208.834) [-3201.384] * (-3204.957) [-3203.983] (-3206.429) (-3208.900) -- 0:00:40 Average standard deviation of split frequencies: 0.007309 870500 -- (-3212.641) (-3207.409) (-3214.232) [-3202.504] * (-3209.260) (-3213.196) [-3205.954] (-3212.234) -- 0:00:40 871000 -- [-3208.258] (-3210.356) (-3208.928) (-3208.206) * (-3206.130) (-3214.214) [-3205.797] (-3210.472) -- 0:00:40 871500 -- [-3206.494] (-3211.680) (-3209.546) (-3214.280) * (-3205.684) (-3220.062) [-3213.249] (-3208.956) -- 0:00:40 872000 -- (-3211.593) (-3204.215) [-3209.927] (-3217.823) * [-3210.469] (-3208.784) (-3211.175) (-3206.500) -- 0:00:39 872500 -- (-3209.725) (-3207.332) (-3204.838) [-3206.999] * [-3204.070] (-3208.103) (-3206.457) (-3205.948) -- 0:00:39 873000 -- (-3209.131) [-3206.486] (-3203.847) (-3205.374) * (-3205.167) (-3214.541) [-3205.051] (-3208.127) -- 0:00:39 873500 -- (-3214.778) [-3207.446] (-3210.884) (-3206.824) * (-3206.291) (-3205.255) (-3207.751) [-3205.108] -- 0:00:39 874000 -- (-3206.939) [-3205.557] (-3210.029) (-3207.805) * [-3204.838] (-3207.787) (-3209.720) (-3207.346) -- 0:00:39 874500 -- (-3208.421) (-3219.031) [-3210.603] (-3208.984) * (-3206.839) (-3203.385) (-3212.380) [-3208.588] -- 0:00:39 875000 -- (-3207.181) [-3206.178] (-3206.832) (-3210.594) * (-3211.165) (-3206.127) [-3210.376] (-3204.321) -- 0:00:39 Average standard deviation of split frequencies: 0.007265 875500 -- (-3200.883) [-3210.490] (-3205.806) (-3204.284) * (-3208.647) [-3207.348] (-3222.076) (-3204.389) -- 0:00:38 876000 -- [-3205.603] (-3211.499) (-3209.613) (-3204.037) * [-3208.187] (-3209.714) (-3209.564) (-3206.730) -- 0:00:38 876500 -- (-3207.512) (-3212.649) [-3206.046] (-3205.398) * (-3207.693) (-3206.978) (-3207.986) [-3207.571] -- 0:00:38 877000 -- (-3208.803) (-3213.667) [-3210.775] (-3208.445) * [-3208.097] (-3207.189) (-3205.141) (-3207.725) -- 0:00:38 877500 -- (-3211.182) (-3218.219) [-3205.951] (-3208.332) * (-3207.825) (-3204.089) (-3215.525) [-3205.675] -- 0:00:38 878000 -- (-3209.207) (-3205.489) [-3207.994] (-3202.278) * (-3201.876) [-3204.288] (-3208.325) (-3213.320) -- 0:00:38 878500 -- [-3216.707] (-3213.499) (-3208.654) (-3206.686) * [-3209.583] (-3204.180) (-3210.553) (-3208.807) -- 0:00:37 879000 -- (-3215.384) (-3211.672) (-3207.568) [-3210.550] * (-3214.371) (-3211.603) [-3214.012] (-3213.272) -- 0:00:37 879500 -- (-3210.273) (-3214.240) [-3208.456] (-3215.528) * (-3221.800) (-3208.336) [-3206.727] (-3208.036) -- 0:00:37 880000 -- (-3205.725) [-3207.448] (-3210.467) (-3213.341) * [-3208.233] (-3201.245) (-3204.831) (-3209.425) -- 0:00:37 Average standard deviation of split frequencies: 0.006691 880500 -- (-3207.246) (-3211.339) [-3205.594] (-3209.819) * (-3207.412) (-3207.726) [-3208.985] (-3209.711) -- 0:00:37 881000 -- (-3214.494) [-3216.142] (-3206.948) (-3209.275) * [-3208.115] (-3212.691) (-3219.418) (-3208.569) -- 0:00:37 881500 -- (-3207.191) (-3211.200) [-3206.684] (-3204.470) * (-3210.040) (-3215.341) (-3208.567) [-3203.884] -- 0:00:36 882000 -- (-3211.262) (-3211.231) [-3210.766] (-3208.191) * (-3206.228) (-3201.682) (-3206.012) [-3203.028] -- 0:00:36 882500 -- (-3213.885) (-3205.164) (-3208.722) [-3204.695] * (-3208.311) (-3206.456) (-3207.118) [-3207.571] -- 0:00:36 883000 -- (-3209.833) (-3212.109) (-3211.751) [-3208.467] * (-3209.464) [-3209.445] (-3205.009) (-3208.281) -- 0:00:36 883500 -- (-3204.580) [-3212.131] (-3205.124) (-3205.603) * (-3207.535) (-3209.685) (-3209.114) [-3206.036] -- 0:00:36 884000 -- (-3213.050) (-3206.122) (-3207.445) [-3206.278] * (-3206.642) [-3208.409] (-3209.013) (-3211.926) -- 0:00:36 884500 -- (-3207.200) (-3209.113) (-3213.753) [-3205.368] * [-3205.243] (-3212.461) (-3203.073) (-3206.325) -- 0:00:36 885000 -- [-3206.598] (-3214.949) (-3209.933) (-3205.431) * (-3207.036) (-3213.389) (-3200.610) [-3206.351] -- 0:00:35 Average standard deviation of split frequencies: 0.006385 885500 -- [-3206.301] (-3206.463) (-3212.627) (-3206.885) * [-3204.830] (-3205.083) (-3208.067) (-3209.920) -- 0:00:35 886000 -- [-3202.687] (-3206.158) (-3215.430) (-3213.403) * [-3209.489] (-3206.600) (-3200.600) (-3206.607) -- 0:00:35 886500 -- (-3203.236) (-3207.836) [-3204.840] (-3210.844) * [-3205.164] (-3211.868) (-3201.724) (-3207.229) -- 0:00:35 887000 -- [-3208.666] (-3207.807) (-3213.547) (-3207.056) * [-3208.413] (-3223.322) (-3205.849) (-3209.252) -- 0:00:35 887500 -- (-3207.091) (-3206.304) (-3219.180) [-3203.231] * (-3208.965) (-3205.310) [-3207.481] (-3202.400) -- 0:00:35 888000 -- [-3207.758] (-3206.537) (-3210.404) (-3209.043) * (-3203.822) (-3211.130) [-3205.548] (-3209.257) -- 0:00:34 888500 -- (-3204.265) (-3211.739) (-3211.411) [-3205.572] * (-3202.102) (-3212.898) [-3205.074] (-3205.930) -- 0:00:34 889000 -- (-3205.170) (-3217.727) (-3210.642) [-3205.517] * (-3215.312) (-3212.309) [-3208.259] (-3208.711) -- 0:00:34 889500 -- (-3212.047) (-3217.406) (-3211.813) [-3208.795] * (-3209.923) (-3213.197) (-3209.092) [-3209.797] -- 0:00:34 890000 -- (-3210.827) (-3208.832) [-3206.015] (-3212.806) * (-3205.074) (-3207.868) (-3206.260) [-3206.214] -- 0:00:34 Average standard deviation of split frequencies: 0.007410 890500 -- (-3207.674) [-3207.318] (-3211.581) (-3211.157) * [-3208.217] (-3206.342) (-3204.309) (-3212.501) -- 0:00:34 891000 -- (-3212.859) (-3206.631) [-3203.962] (-3207.047) * (-3216.546) (-3213.296) (-3211.350) [-3209.012] -- 0:00:34 891500 -- (-3210.341) [-3206.161] (-3207.677) (-3206.033) * [-3209.271] (-3203.823) (-3210.718) (-3207.506) -- 0:00:33 892000 -- [-3208.604] (-3209.753) (-3209.300) (-3206.181) * (-3202.914) (-3214.025) (-3208.983) [-3205.363] -- 0:00:33 892500 -- (-3213.810) (-3206.020) [-3211.887] (-3212.804) * [-3202.193] (-3207.792) (-3210.361) (-3210.178) -- 0:00:33 893000 -- (-3209.828) (-3209.670) [-3208.820] (-3205.760) * (-3205.930) (-3206.388) [-3203.820] (-3206.990) -- 0:00:33 893500 -- (-3212.229) (-3211.188) (-3210.633) [-3202.623] * (-3210.800) [-3205.394] (-3214.955) (-3206.101) -- 0:00:33 894000 -- (-3204.677) (-3205.135) (-3204.964) [-3209.992] * (-3213.402) [-3210.507] (-3207.174) (-3209.674) -- 0:00:33 894500 -- (-3206.991) (-3206.092) [-3205.268] (-3208.648) * (-3206.629) (-3214.172) (-3204.072) [-3208.068] -- 0:00:32 895000 -- (-3212.980) (-3211.477) [-3204.565] (-3205.583) * [-3205.461] (-3205.682) (-3204.993) (-3208.951) -- 0:00:32 Average standard deviation of split frequencies: 0.007892 895500 -- (-3208.442) (-3208.762) [-3210.596] (-3203.660) * [-3205.427] (-3211.386) (-3206.732) (-3207.038) -- 0:00:32 896000 -- (-3206.915) [-3207.815] (-3206.260) (-3203.850) * [-3205.044] (-3218.072) (-3205.868) (-3215.746) -- 0:00:32 896500 -- (-3210.050) (-3206.168) (-3214.346) [-3211.602] * (-3209.760) (-3207.164) [-3206.810] (-3206.349) -- 0:00:32 897000 -- (-3213.187) (-3208.820) (-3224.977) [-3207.013] * [-3204.848] (-3208.778) (-3211.233) (-3210.594) -- 0:00:32 897500 -- (-3209.156) (-3205.390) [-3218.141] (-3216.349) * (-3201.353) (-3218.775) [-3205.655] (-3213.967) -- 0:00:31 898000 -- (-3203.378) [-3209.069] (-3210.295) (-3209.431) * (-3205.900) (-3211.821) (-3207.175) [-3205.380] -- 0:00:31 898500 -- [-3213.030] (-3213.065) (-3203.947) (-3212.682) * (-3207.247) (-3210.059) [-3205.870] (-3202.523) -- 0:00:31 899000 -- [-3207.955] (-3206.104) (-3206.822) (-3213.293) * (-3207.955) (-3205.633) [-3204.644] (-3210.360) -- 0:00:31 899500 -- (-3206.884) (-3210.294) [-3201.049] (-3212.338) * [-3211.522] (-3213.845) (-3207.862) (-3207.965) -- 0:00:31 900000 -- [-3209.769] (-3207.994) (-3209.046) (-3215.129) * (-3205.379) (-3213.805) (-3208.972) [-3209.709] -- 0:00:31 Average standard deviation of split frequencies: 0.007328 900500 -- (-3213.254) [-3209.916] (-3209.165) (-3207.444) * (-3207.436) [-3208.500] (-3214.374) (-3206.198) -- 0:00:31 901000 -- [-3214.372] (-3208.942) (-3206.556) (-3204.184) * (-3203.901) (-3207.663) (-3205.858) [-3204.309] -- 0:00:30 901500 -- (-3203.243) (-3209.896) (-3209.131) [-3206.589] * (-3209.364) (-3207.366) [-3205.246] (-3205.077) -- 0:00:30 902000 -- (-3209.047) (-3203.938) (-3202.841) [-3205.989] * (-3206.418) (-3211.552) (-3203.816) [-3213.403] -- 0:00:30 902500 -- [-3205.950] (-3207.030) (-3205.986) (-3205.422) * (-3212.293) (-3206.798) [-3203.734] (-3218.106) -- 0:00:30 903000 -- (-3205.743) (-3211.975) [-3207.788] (-3208.111) * (-3208.183) (-3211.974) (-3208.469) [-3212.792] -- 0:00:30 903500 -- (-3214.559) (-3210.729) [-3204.304] (-3202.013) * (-3213.059) (-3210.935) (-3208.882) [-3207.552] -- 0:00:30 904000 -- [-3211.004] (-3209.313) (-3208.889) (-3207.983) * [-3205.120] (-3210.855) (-3212.860) (-3208.362) -- 0:00:29 904500 -- [-3204.274] (-3210.025) (-3205.999) (-3207.175) * (-3207.495) (-3214.472) (-3210.262) [-3205.007] -- 0:00:29 905000 -- (-3207.585) (-3213.433) [-3204.535] (-3209.581) * (-3207.836) (-3207.937) [-3212.648] (-3206.992) -- 0:00:29 Average standard deviation of split frequencies: 0.007284 905500 -- (-3211.621) [-3209.835] (-3205.989) (-3209.601) * [-3208.390] (-3207.637) (-3208.914) (-3211.172) -- 0:00:29 906000 -- (-3206.315) (-3209.421) (-3213.979) [-3203.368] * (-3211.991) (-3212.737) (-3208.573) [-3215.648] -- 0:00:29 906500 -- (-3205.729) (-3212.518) [-3217.900] (-3206.465) * (-3204.560) (-3206.285) [-3210.136] (-3214.090) -- 0:00:29 907000 -- [-3208.331] (-3210.174) (-3212.771) (-3207.711) * [-3206.579] (-3206.898) (-3201.580) (-3213.426) -- 0:00:29 907500 -- (-3210.805) (-3208.737) [-3209.486] (-3210.471) * (-3208.967) [-3208.504] (-3209.672) (-3207.292) -- 0:00:28 908000 -- (-3208.189) (-3209.915) (-3208.737) [-3212.104] * (-3207.473) [-3206.480] (-3209.398) (-3209.793) -- 0:00:28 908500 -- (-3208.468) [-3211.024] (-3208.847) (-3210.631) * (-3205.756) (-3210.550) (-3209.352) [-3203.037] -- 0:00:28 909000 -- (-3208.101) [-3206.903] (-3212.713) (-3211.938) * [-3204.678] (-3211.045) (-3210.723) (-3204.907) -- 0:00:28 909500 -- (-3208.954) (-3208.217) [-3205.040] (-3208.891) * (-3206.426) [-3205.429] (-3208.017) (-3204.008) -- 0:00:28 910000 -- (-3207.543) (-3210.692) (-3205.148) [-3208.056] * [-3204.848] (-3203.631) (-3206.254) (-3205.330) -- 0:00:28 Average standard deviation of split frequencies: 0.006988 910500 -- (-3207.829) (-3209.246) (-3204.432) [-3205.766] * [-3206.663] (-3208.497) (-3215.764) (-3204.303) -- 0:00:27 911000 -- (-3206.797) [-3210.696] (-3206.592) (-3212.816) * [-3204.124] (-3210.502) (-3207.896) (-3206.573) -- 0:00:27 911500 -- (-3210.547) [-3205.737] (-3213.474) (-3205.077) * [-3208.640] (-3209.074) (-3205.401) (-3210.190) -- 0:00:27 912000 -- (-3212.384) (-3211.350) (-3212.307) [-3204.822] * (-3212.273) [-3209.068] (-3207.994) (-3209.259) -- 0:00:27 912500 -- (-3210.457) (-3209.032) [-3200.457] (-3205.612) * (-3213.732) [-3209.419] (-3206.013) (-3206.870) -- 0:00:27 913000 -- (-3208.497) (-3206.085) [-3216.003] (-3206.782) * [-3204.446] (-3203.814) (-3209.332) (-3211.724) -- 0:00:27 913500 -- [-3209.969] (-3208.682) (-3215.278) (-3207.729) * (-3204.686) (-3210.387) (-3210.806) [-3208.643] -- 0:00:26 914000 -- (-3216.920) [-3206.201] (-3206.523) (-3207.239) * (-3215.982) [-3208.215] (-3208.944) (-3212.765) -- 0:00:26 914500 -- (-3206.778) (-3209.501) [-3212.443] (-3207.550) * [-3207.657] (-3204.870) (-3206.998) (-3209.554) -- 0:00:26 915000 -- (-3212.311) (-3211.762) [-3203.234] (-3210.133) * [-3207.400] (-3209.021) (-3204.252) (-3207.607) -- 0:00:26 Average standard deviation of split frequencies: 0.006948 915500 -- (-3211.337) (-3207.654) (-3207.624) [-3210.565] * (-3206.813) [-3207.622] (-3209.248) (-3209.880) -- 0:00:26 916000 -- (-3212.095) (-3210.074) [-3207.190] (-3211.929) * (-3207.902) (-3208.113) [-3208.676] (-3210.573) -- 0:00:26 916500 -- (-3211.329) (-3208.355) (-3209.512) [-3207.028] * (-3208.589) (-3203.755) (-3203.349) [-3205.002] -- 0:00:26 917000 -- (-3209.042) (-3205.609) [-3208.110] (-3210.256) * [-3208.023] (-3204.304) (-3207.930) (-3204.873) -- 0:00:25 917500 -- (-3215.445) (-3211.240) (-3212.784) [-3211.858] * (-3211.375) (-3212.968) (-3205.613) [-3209.576] -- 0:00:25 918000 -- (-3206.438) [-3215.156] (-3205.813) (-3206.652) * [-3214.028] (-3201.853) (-3205.048) (-3214.554) -- 0:00:25 918500 -- (-3206.494) (-3206.740) [-3205.256] (-3205.792) * [-3205.537] (-3202.289) (-3208.474) (-3213.166) -- 0:00:25 919000 -- (-3209.233) (-3209.464) (-3217.170) [-3212.008] * (-3206.052) (-3209.458) (-3218.966) [-3201.249] -- 0:00:25 919500 -- [-3206.314] (-3204.347) (-3206.101) (-3212.936) * [-3202.167] (-3215.592) (-3208.952) (-3208.637) -- 0:00:25 920000 -- (-3203.816) [-3207.586] (-3208.511) (-3218.405) * [-3204.373] (-3206.600) (-3209.400) (-3211.304) -- 0:00:24 Average standard deviation of split frequencies: 0.007680 920500 -- (-3205.974) (-3202.364) [-3206.026] (-3208.118) * (-3209.244) [-3204.984] (-3212.271) (-3207.389) -- 0:00:24 921000 -- (-3219.614) (-3208.425) (-3210.455) [-3209.920] * (-3212.271) [-3205.822] (-3210.246) (-3205.937) -- 0:00:24 921500 -- (-3208.653) (-3210.276) [-3213.884] (-3213.721) * (-3207.898) (-3215.329) (-3207.676) [-3213.250] -- 0:00:24 922000 -- [-3207.028] (-3204.703) (-3204.284) (-3206.780) * [-3211.633] (-3208.408) (-3214.821) (-3206.323) -- 0:00:24 922500 -- (-3212.104) (-3217.663) [-3207.730] (-3205.642) * (-3211.778) (-3209.057) [-3207.567] (-3207.636) -- 0:00:24 923000 -- (-3205.193) [-3205.678] (-3213.270) (-3206.927) * (-3208.531) [-3210.657] (-3211.555) (-3205.366) -- 0:00:24 923500 -- (-3202.602) (-3210.490) [-3211.731] (-3208.643) * (-3210.296) (-3210.712) (-3205.344) [-3207.483] -- 0:00:23 924000 -- (-3213.406) (-3212.882) [-3207.843] (-3205.812) * (-3206.071) (-3210.177) [-3203.654] (-3206.771) -- 0:00:23 924500 -- (-3210.455) [-3206.208] (-3214.549) (-3209.915) * (-3207.135) (-3205.472) [-3205.620] (-3206.550) -- 0:00:23 925000 -- [-3204.848] (-3207.410) (-3208.515) (-3206.855) * (-3207.178) (-3208.870) (-3202.893) [-3205.966] -- 0:00:23 Average standard deviation of split frequencies: 0.008145 925500 -- (-3205.162) (-3207.613) (-3207.691) [-3208.270] * (-3205.717) (-3206.046) [-3205.948] (-3215.993) -- 0:00:23 926000 -- [-3206.367] (-3207.822) (-3210.994) (-3209.302) * (-3212.401) (-3218.048) [-3206.614] (-3210.118) -- 0:00:23 926500 -- (-3205.572) (-3208.129) (-3209.626) [-3205.204] * (-3207.457) [-3204.047] (-3205.982) (-3221.665) -- 0:00:22 927000 -- [-3203.043] (-3206.890) (-3209.822) (-3212.791) * (-3209.560) (-3206.600) [-3206.341] (-3215.171) -- 0:00:22 927500 -- (-3207.685) (-3205.654) (-3210.001) [-3205.687] * (-3216.027) [-3203.916] (-3205.206) (-3230.086) -- 0:00:22 928000 -- [-3210.760] (-3203.631) (-3204.695) (-3206.738) * (-3211.238) (-3205.265) [-3208.000] (-3208.687) -- 0:00:22 928500 -- (-3212.062) (-3203.488) (-3205.338) [-3209.977] * (-3212.541) (-3210.530) [-3205.562] (-3209.577) -- 0:00:22 929000 -- [-3209.572] (-3207.795) (-3214.443) (-3209.000) * (-3204.431) (-3208.556) [-3212.217] (-3207.085) -- 0:00:22 929500 -- [-3210.117] (-3205.434) (-3218.951) (-3209.503) * (-3211.209) (-3211.840) [-3205.263] (-3216.630) -- 0:00:21 930000 -- (-3207.425) [-3205.124] (-3211.014) (-3207.946) * (-3208.936) (-3212.979) (-3212.197) [-3209.821] -- 0:00:21 Average standard deviation of split frequencies: 0.008864 930500 -- [-3213.289] (-3215.053) (-3209.849) (-3211.068) * [-3201.926] (-3218.523) (-3213.387) (-3208.513) -- 0:00:21 931000 -- (-3210.494) (-3212.069) (-3208.990) [-3209.331] * (-3204.571) (-3208.802) (-3217.262) [-3209.199] -- 0:00:21 931500 -- (-3210.579) [-3206.019] (-3206.353) (-3209.128) * (-3207.620) (-3215.125) [-3211.796] (-3205.234) -- 0:00:21 932000 -- (-3207.385) (-3211.780) (-3210.747) [-3207.987] * (-3214.679) (-3203.769) [-3205.995] (-3206.011) -- 0:00:21 932500 -- (-3202.759) (-3206.805) [-3212.214] (-3208.157) * [-3209.958] (-3207.794) (-3203.633) (-3207.488) -- 0:00:21 933000 -- (-3210.326) [-3209.308] (-3210.614) (-3208.821) * [-3207.404] (-3212.845) (-3205.046) (-3210.853) -- 0:00:20 933500 -- (-3217.470) (-3206.477) [-3208.531] (-3220.341) * [-3213.530] (-3211.472) (-3209.116) (-3204.119) -- 0:00:20 934000 -- (-3215.836) [-3207.987] (-3211.512) (-3206.965) * (-3209.303) (-3211.382) [-3204.195] (-3215.075) -- 0:00:20 934500 -- (-3211.199) [-3207.650] (-3216.691) (-3212.100) * [-3209.786] (-3204.400) (-3207.155) (-3207.786) -- 0:00:20 935000 -- [-3210.188] (-3211.541) (-3211.025) (-3207.478) * (-3212.559) [-3203.623] (-3204.562) (-3203.153) -- 0:00:20 Average standard deviation of split frequencies: 0.008310 935500 -- (-3208.248) (-3206.294) (-3208.206) [-3206.493] * (-3213.234) (-3211.872) [-3206.986] (-3205.012) -- 0:00:20 936000 -- [-3213.575] (-3209.859) (-3207.969) (-3209.445) * (-3211.599) (-3207.037) (-3209.997) [-3205.898] -- 0:00:19 936500 -- (-3208.085) (-3210.480) [-3203.048] (-3210.187) * (-3210.115) (-3204.876) (-3202.464) [-3207.473] -- 0:00:19 937000 -- (-3202.811) [-3203.677] (-3217.541) (-3211.554) * (-3209.026) (-3211.788) (-3202.294) [-3204.061] -- 0:00:19 937500 -- (-3200.548) [-3208.156] (-3216.123) (-3206.680) * (-3207.693) (-3207.097) [-3208.496] (-3209.139) -- 0:00:19 938000 -- (-3202.016) (-3216.759) [-3213.312] (-3210.699) * (-3211.354) (-3205.642) [-3202.917] (-3207.436) -- 0:00:19 938500 -- (-3211.479) (-3212.894) (-3211.105) [-3207.526] * [-3207.220] (-3210.976) (-3207.599) (-3203.649) -- 0:00:19 939000 -- (-3218.081) [-3209.860] (-3210.035) (-3203.917) * (-3204.038) (-3208.968) (-3210.550) [-3206.290] -- 0:00:19 939500 -- (-3210.889) (-3209.824) (-3211.634) [-3209.431] * (-3212.696) (-3209.418) (-3206.255) [-3208.030] -- 0:00:18 940000 -- (-3209.970) (-3214.290) [-3208.109] (-3205.637) * [-3211.770] (-3213.602) (-3202.278) (-3208.812) -- 0:00:18 Average standard deviation of split frequencies: 0.007517 940500 -- [-3203.956] (-3208.886) (-3204.559) (-3206.825) * (-3213.444) (-3209.073) [-3206.112] (-3206.302) -- 0:00:18 941000 -- [-3206.540] (-3208.956) (-3206.546) (-3207.104) * [-3215.949] (-3210.506) (-3219.950) (-3210.384) -- 0:00:18 941500 -- (-3203.569) (-3212.446) (-3205.830) [-3208.630] * (-3210.450) [-3207.116] (-3218.856) (-3205.540) -- 0:00:18 942000 -- (-3211.839) [-3208.498] (-3208.631) (-3211.553) * (-3213.696) (-3208.117) (-3214.933) [-3206.980] -- 0:00:18 942500 -- (-3213.979) (-3215.361) (-3208.940) [-3209.482] * [-3206.798] (-3207.643) (-3220.950) (-3207.014) -- 0:00:17 943000 -- (-3206.378) [-3211.465] (-3215.034) (-3211.207) * (-3211.870) (-3216.431) (-3213.816) [-3205.920] -- 0:00:17 943500 -- (-3207.608) (-3213.190) [-3208.532] (-3212.244) * [-3211.069] (-3207.216) (-3215.538) (-3204.335) -- 0:00:17 944000 -- (-3209.035) (-3206.256) [-3206.422] (-3210.182) * (-3209.462) [-3210.701] (-3205.401) (-3211.287) -- 0:00:17 944500 -- [-3206.632] (-3208.576) (-3211.791) (-3213.966) * (-3213.017) [-3206.038] (-3214.102) (-3210.905) -- 0:00:17 945000 -- (-3209.409) (-3205.462) (-3208.173) [-3207.658] * (-3207.445) (-3204.657) (-3205.776) [-3204.116] -- 0:00:17 Average standard deviation of split frequencies: 0.006727 945500 -- (-3203.009) [-3204.534] (-3203.100) (-3218.038) * [-3206.864] (-3204.226) (-3208.381) (-3208.826) -- 0:00:17 946000 -- (-3211.620) [-3204.887] (-3209.465) (-3213.545) * [-3212.075] (-3208.758) (-3207.397) (-3216.486) -- 0:00:16 946500 -- (-3207.811) (-3207.275) (-3207.995) [-3203.951] * (-3209.130) [-3203.440] (-3213.793) (-3209.868) -- 0:00:16 947000 -- [-3206.153] (-3206.990) (-3207.040) (-3209.638) * [-3209.818] (-3212.293) (-3201.896) (-3205.040) -- 0:00:16 947500 -- [-3207.235] (-3210.132) (-3213.909) (-3212.655) * (-3205.830) [-3205.984] (-3207.780) (-3213.573) -- 0:00:16 948000 -- (-3208.798) [-3207.026] (-3208.732) (-3212.446) * (-3211.718) (-3213.886) [-3205.645] (-3212.903) -- 0:00:16 948500 -- (-3207.459) (-3206.973) (-3210.287) [-3210.847] * (-3214.597) [-3205.571] (-3213.066) (-3210.566) -- 0:00:16 949000 -- (-3204.617) (-3209.960) [-3203.799] (-3206.251) * (-3206.534) (-3210.818) [-3207.635] (-3209.084) -- 0:00:15 949500 -- [-3206.068] (-3207.401) (-3210.990) (-3207.925) * (-3207.560) (-3212.420) [-3206.789] (-3214.640) -- 0:00:15 950000 -- (-3216.360) (-3214.788) [-3204.445] (-3206.515) * (-3207.575) (-3223.000) (-3204.381) [-3216.327] -- 0:00:15 Average standard deviation of split frequencies: 0.006942 950500 -- (-3209.794) [-3207.507] (-3203.790) (-3213.070) * [-3209.776] (-3211.789) (-3209.389) (-3215.163) -- 0:00:15 951000 -- [-3205.046] (-3208.671) (-3212.549) (-3207.558) * (-3208.336) [-3213.059] (-3215.629) (-3207.489) -- 0:00:15 951500 -- (-3202.777) (-3203.800) [-3212.961] (-3217.049) * (-3207.047) (-3211.622) [-3211.591] (-3211.081) -- 0:00:15 952000 -- (-3209.696) [-3204.687] (-3212.737) (-3207.502) * (-3210.656) (-3209.411) [-3217.134] (-3208.891) -- 0:00:14 952500 -- (-3216.522) (-3206.405) [-3218.652] (-3208.632) * (-3209.433) (-3211.781) (-3218.740) [-3212.271] -- 0:00:14 953000 -- (-3208.015) (-3205.347) (-3208.494) [-3205.788] * (-3208.156) (-3212.507) (-3216.653) [-3204.507] -- 0:00:14 953500 -- (-3210.640) (-3206.220) [-3212.193] (-3217.611) * (-3218.311) [-3204.683] (-3216.562) (-3209.460) -- 0:00:14 954000 -- (-3208.077) (-3210.331) (-3221.635) [-3211.695] * (-3207.516) (-3205.615) [-3213.186] (-3208.084) -- 0:00:14 954500 -- (-3217.140) [-3208.462] (-3215.719) (-3210.095) * (-3209.161) (-3208.433) (-3211.411) [-3208.546] -- 0:00:14 955000 -- (-3204.402) (-3208.503) (-3206.548) [-3205.378] * [-3209.920] (-3213.582) (-3204.572) (-3211.269) -- 0:00:14 Average standard deviation of split frequencies: 0.005917 955500 -- (-3206.276) [-3208.885] (-3210.824) (-3207.480) * (-3205.552) (-3210.314) (-3209.621) [-3207.496] -- 0:00:13 956000 -- (-3214.355) (-3207.310) (-3206.063) [-3205.537] * [-3213.355] (-3221.898) (-3207.775) (-3214.150) -- 0:00:13 956500 -- [-3206.285] (-3210.063) (-3203.759) (-3209.491) * (-3211.661) [-3211.034] (-3205.710) (-3207.261) -- 0:00:13 957000 -- (-3214.949) (-3211.381) (-3208.462) [-3204.696] * (-3203.739) [-3206.903] (-3216.971) (-3213.401) -- 0:00:13 957500 -- (-3213.519) (-3210.801) (-3211.329) [-3207.142] * (-3205.537) (-3214.592) [-3204.955] (-3210.878) -- 0:00:13 958000 -- (-3208.824) (-3210.855) [-3206.662] (-3205.598) * (-3206.922) (-3214.950) [-3205.658] (-3211.762) -- 0:00:13 958500 -- (-3212.845) (-3209.009) (-3209.423) [-3205.309] * (-3217.513) (-3212.440) (-3205.536) [-3208.460] -- 0:00:12 959000 -- (-3207.704) [-3209.599] (-3205.280) (-3206.361) * (-3204.169) [-3211.370] (-3206.012) (-3210.154) -- 0:00:12 959500 -- [-3213.217] (-3211.117) (-3209.687) (-3205.210) * [-3208.437] (-3215.099) (-3205.085) (-3206.699) -- 0:00:12 960000 -- (-3212.751) (-3210.895) [-3207.365] (-3216.765) * [-3201.528] (-3207.537) (-3209.060) (-3208.500) -- 0:00:12 Average standard deviation of split frequencies: 0.005398 960500 -- (-3208.571) (-3207.706) (-3206.746) [-3208.387] * (-3202.638) (-3211.900) (-3212.866) [-3203.277] -- 0:00:12 961000 -- (-3213.120) [-3212.254] (-3213.355) (-3202.779) * (-3206.763) (-3205.385) (-3221.194) [-3206.869] -- 0:00:12 961500 -- (-3207.935) (-3208.447) [-3207.679] (-3208.055) * (-3205.215) (-3208.941) [-3206.300] (-3214.900) -- 0:00:12 962000 -- (-3206.129) [-3207.108] (-3211.238) (-3209.379) * [-3204.057] (-3206.096) (-3208.200) (-3216.380) -- 0:00:11 962500 -- [-3203.975] (-3207.237) (-3209.407) (-3206.246) * [-3206.816] (-3201.374) (-3212.741) (-3216.458) -- 0:00:11 963000 -- [-3209.876] (-3211.717) (-3216.634) (-3211.415) * (-3205.292) (-3215.138) [-3208.288] (-3219.056) -- 0:00:11 963500 -- (-3203.999) (-3218.270) (-3214.042) [-3208.312] * (-3211.896) (-3206.618) [-3208.945] (-3210.367) -- 0:00:11 964000 -- [-3204.414] (-3209.600) (-3207.288) (-3206.512) * [-3210.776] (-3216.562) (-3208.218) (-3207.285) -- 0:00:11 964500 -- [-3212.502] (-3207.729) (-3210.652) (-3207.357) * (-3207.219) (-3209.615) (-3213.092) [-3204.830] -- 0:00:11 965000 -- (-3214.070) (-3206.830) [-3205.836] (-3212.795) * (-3209.477) [-3207.835] (-3208.091) (-3214.221) -- 0:00:10 Average standard deviation of split frequencies: 0.004392 965500 -- (-3215.849) (-3204.873) (-3209.479) [-3206.612] * (-3204.259) [-3202.299] (-3210.519) (-3208.390) -- 0:00:10 966000 -- (-3209.512) (-3205.038) [-3210.967] (-3205.336) * (-3207.164) (-3215.205) (-3213.004) [-3205.193] -- 0:00:10 966500 -- (-3207.805) [-3206.825] (-3207.135) (-3211.525) * (-3206.895) [-3218.270] (-3207.796) (-3210.657) -- 0:00:10 967000 -- (-3213.733) [-3211.436] (-3209.686) (-3209.757) * (-3208.216) (-3213.549) (-3213.235) [-3209.056] -- 0:00:10 967500 -- [-3211.436] (-3210.461) (-3210.890) (-3209.975) * [-3209.830] (-3206.568) (-3212.800) (-3211.371) -- 0:00:10 968000 -- (-3204.632) (-3211.594) (-3210.411) [-3205.544] * (-3202.345) [-3205.568] (-3205.571) (-3207.291) -- 0:00:09 968500 -- (-3205.724) [-3209.467] (-3209.745) (-3208.551) * [-3204.103] (-3205.945) (-3217.178) (-3206.026) -- 0:00:09 969000 -- (-3218.153) (-3209.967) (-3202.649) [-3211.966] * (-3210.310) [-3214.430] (-3209.104) (-3208.277) -- 0:00:09 969500 -- [-3203.522] (-3211.548) (-3203.824) (-3205.685) * (-3212.180) [-3207.227] (-3204.353) (-3208.384) -- 0:00:09 970000 -- (-3205.375) (-3208.133) (-3207.107) [-3206.807] * [-3207.386] (-3214.404) (-3209.976) (-3206.846) -- 0:00:09 Average standard deviation of split frequencies: 0.004128 970500 -- (-3205.618) [-3205.790] (-3204.857) (-3206.293) * (-3212.801) (-3207.828) [-3208.382] (-3204.101) -- 0:00:09 971000 -- (-3209.081) (-3206.476) [-3204.726] (-3203.991) * (-3206.511) [-3208.318] (-3212.503) (-3207.492) -- 0:00:09 971500 -- (-3207.420) (-3202.326) (-3201.948) [-3205.283] * (-3206.446) [-3205.185] (-3205.628) (-3202.700) -- 0:00:08 972000 -- (-3211.058) [-3206.009] (-3211.038) (-3205.195) * (-3209.540) (-3209.509) [-3204.872] (-3202.476) -- 0:00:08 972500 -- (-3208.220) (-3208.246) [-3206.442] (-3209.035) * (-3208.036) (-3209.994) (-3204.543) [-3205.660] -- 0:00:08 973000 -- (-3206.325) [-3203.002] (-3208.089) (-3210.272) * (-3207.908) [-3207.206] (-3202.547) (-3206.333) -- 0:00:08 973500 -- (-3207.269) [-3209.912] (-3206.646) (-3205.625) * (-3208.466) [-3208.646] (-3205.266) (-3205.516) -- 0:00:08 974000 -- (-3208.159) (-3205.056) (-3205.549) [-3202.955] * [-3205.761] (-3212.716) (-3213.724) (-3202.725) -- 0:00:08 974500 -- (-3207.431) [-3205.534] (-3210.640) (-3211.516) * (-3206.993) [-3212.325] (-3204.367) (-3206.771) -- 0:00:07 975000 -- (-3208.098) (-3205.106) [-3215.377] (-3204.754) * (-3209.177) (-3208.946) [-3208.765] (-3209.994) -- 0:00:07 Average standard deviation of split frequencies: 0.004105 975500 -- (-3210.027) (-3207.711) [-3204.502] (-3213.320) * [-3211.171] (-3210.679) (-3212.184) (-3212.496) -- 0:00:07 976000 -- (-3204.592) (-3214.797) (-3203.339) [-3216.167] * (-3208.231) [-3208.225] (-3208.471) (-3205.015) -- 0:00:07 976500 -- (-3208.271) (-3206.203) (-3215.834) [-3207.829] * [-3203.450] (-3204.732) (-3209.855) (-3214.335) -- 0:00:07 977000 -- (-3212.598) [-3206.521] (-3205.503) (-3203.654) * (-3206.546) [-3206.606] (-3215.193) (-3209.222) -- 0:00:07 977500 -- (-3203.921) [-3204.709] (-3209.983) (-3214.190) * (-3208.338) (-3215.201) [-3213.654] (-3207.059) -- 0:00:07 978000 -- (-3210.734) (-3213.439) (-3205.439) [-3210.286] * [-3213.907] (-3202.809) (-3209.340) (-3208.888) -- 0:00:06 978500 -- [-3207.035] (-3207.932) (-3206.758) (-3209.362) * (-3206.468) [-3207.034] (-3220.990) (-3209.616) -- 0:00:06 979000 -- [-3211.747] (-3214.184) (-3214.483) (-3209.247) * (-3206.527) [-3214.570] (-3213.471) (-3215.583) -- 0:00:06 979500 -- (-3211.209) (-3209.645) (-3212.387) [-3212.121] * [-3206.571] (-3211.815) (-3205.775) (-3205.634) -- 0:00:06 980000 -- [-3211.208] (-3210.501) (-3211.242) (-3209.738) * (-3212.153) [-3204.931] (-3208.410) (-3207.680) -- 0:00:06 Average standard deviation of split frequencies: 0.004567 980500 -- (-3209.517) (-3206.396) (-3210.245) [-3210.404] * (-3213.879) (-3203.240) (-3213.014) [-3208.450] -- 0:00:06 981000 -- (-3213.415) [-3206.953] (-3208.299) (-3209.768) * [-3212.790] (-3210.876) (-3213.711) (-3212.462) -- 0:00:05 981500 -- (-3202.137) (-3205.003) (-3210.860) [-3204.027] * (-3203.161) (-3209.905) (-3203.471) [-3219.806] -- 0:00:05 982000 -- (-3204.424) (-3206.204) (-3205.797) [-3210.213] * (-3211.683) [-3207.684] (-3206.000) (-3209.101) -- 0:00:05 982500 -- (-3203.249) [-3204.765] (-3202.728) (-3207.954) * (-3213.116) (-3210.683) [-3205.071] (-3210.620) -- 0:00:05 983000 -- (-3210.557) [-3204.917] (-3210.072) (-3207.624) * (-3206.210) (-3207.286) [-3205.075] (-3211.015) -- 0:00:05 983500 -- (-3208.895) (-3213.968) (-3210.055) [-3204.083] * (-3206.031) [-3204.482] (-3203.800) (-3204.134) -- 0:00:05 984000 -- (-3212.027) [-3207.693] (-3211.236) (-3211.734) * [-3206.232] (-3206.792) (-3203.020) (-3210.060) -- 0:00:04 984500 -- [-3208.387] (-3209.232) (-3203.081) (-3213.426) * [-3205.820] (-3211.309) (-3206.027) (-3211.375) -- 0:00:04 985000 -- (-3207.537) [-3207.642] (-3205.593) (-3207.564) * (-3206.832) (-3209.901) [-3207.921] (-3206.863) -- 0:00:04 Average standard deviation of split frequencies: 0.004303 985500 -- (-3205.770) (-3215.665) (-3213.490) [-3209.067] * (-3207.382) (-3210.018) (-3210.905) [-3212.807] -- 0:00:04 986000 -- [-3203.468] (-3207.782) (-3207.719) (-3212.070) * (-3206.792) (-3221.573) [-3214.376] (-3211.113) -- 0:00:04 986500 -- [-3206.959] (-3205.651) (-3214.508) (-3211.158) * (-3216.025) (-3214.168) (-3207.391) [-3214.029] -- 0:00:04 987000 -- (-3209.179) [-3207.482] (-3207.452) (-3207.110) * [-3209.777] (-3208.958) (-3206.867) (-3207.078) -- 0:00:04 987500 -- (-3207.771) [-3214.944] (-3205.013) (-3214.744) * (-3209.845) [-3209.097] (-3212.692) (-3206.789) -- 0:00:03 988000 -- (-3204.315) (-3213.776) [-3208.141] (-3204.092) * (-3205.745) (-3211.219) (-3202.688) [-3204.236] -- 0:00:03 988500 -- (-3206.848) [-3209.545] (-3209.617) (-3204.570) * (-3209.228) (-3209.349) [-3212.875] (-3211.514) -- 0:00:03 989000 -- (-3208.948) [-3203.318] (-3207.316) (-3205.106) * (-3209.710) (-3217.773) [-3204.861] (-3210.163) -- 0:00:03 989500 -- [-3211.108] (-3202.808) (-3214.437) (-3210.989) * [-3204.817] (-3206.491) (-3205.134) (-3213.240) -- 0:00:03 990000 -- (-3206.600) (-3211.023) [-3206.664] (-3210.697) * (-3204.713) [-3205.612] (-3209.343) (-3210.297) -- 0:00:03 Average standard deviation of split frequencies: 0.004283 990500 -- (-3205.855) (-3211.549) (-3206.260) [-3207.886] * (-3205.253) [-3208.860] (-3204.934) (-3203.392) -- 0:00:02 991000 -- (-3214.033) (-3210.138) (-3205.459) [-3207.050] * (-3221.163) (-3207.949) [-3206.723] (-3207.222) -- 0:00:02 991500 -- (-3210.500) [-3205.739] (-3216.996) (-3210.053) * (-3211.311) [-3204.281] (-3203.845) (-3207.962) -- 0:00:02 992000 -- (-3207.147) [-3206.467] (-3204.864) (-3202.154) * (-3212.157) [-3210.434] (-3209.234) (-3205.025) -- 0:00:02 992500 -- (-3208.559) (-3211.458) (-3204.888) [-3207.250] * (-3213.121) (-3211.073) [-3207.365] (-3219.242) -- 0:00:02 993000 -- (-3210.464) (-3210.652) [-3204.636] (-3210.064) * (-3208.717) (-3215.947) (-3210.286) [-3207.873] -- 0:00:02 993500 -- [-3208.472] (-3209.141) (-3205.449) (-3207.987) * [-3210.837] (-3215.201) (-3205.820) (-3210.738) -- 0:00:02 994000 -- (-3208.225) (-3210.164) [-3211.642] (-3207.647) * [-3205.635] (-3213.646) (-3208.670) (-3207.410) -- 0:00:01 994500 -- (-3210.219) (-3212.676) (-3205.390) [-3207.261] * (-3207.849) (-3204.635) [-3203.805] (-3205.394) -- 0:00:01 995000 -- [-3205.721] (-3206.643) (-3207.418) (-3209.608) * (-3209.743) [-3207.544] (-3202.843) (-3209.695) -- 0:00:01 Average standard deviation of split frequencies: 0.004496 995500 -- [-3208.838] (-3209.483) (-3205.948) (-3205.337) * [-3208.238] (-3205.384) (-3217.387) (-3207.243) -- 0:00:01 996000 -- (-3207.487) (-3213.290) (-3215.361) [-3210.930] * (-3212.719) (-3209.995) [-3206.652] (-3211.345) -- 0:00:01 996500 -- [-3208.230] (-3210.845) (-3208.379) (-3207.109) * (-3210.755) (-3208.839) [-3209.261] (-3205.821) -- 0:00:01 997000 -- (-3204.738) (-3209.873) [-3207.215] (-3208.088) * (-3216.804) [-3206.691] (-3207.480) (-3210.154) -- 0:00:00 997500 -- (-3205.813) (-3210.896) (-3208.191) [-3211.936] * (-3207.577) (-3210.576) [-3207.641] (-3216.227) -- 0:00:00 998000 -- (-3204.922) [-3204.749] (-3203.116) (-3215.369) * (-3211.602) [-3209.356] (-3213.885) (-3206.825) -- 0:00:00 998500 -- (-3211.617) (-3209.955) (-3207.385) [-3204.331] * [-3210.140] (-3209.907) (-3212.969) (-3207.238) -- 0:00:00 999000 -- [-3208.304] (-3209.781) (-3202.856) (-3208.307) * (-3212.463) [-3207.762] (-3212.863) (-3206.509) -- 0:00:00 999500 -- (-3207.713) (-3207.829) [-3206.762] (-3205.320) * (-3203.862) [-3207.623] (-3209.976) (-3206.177) -- 0:00:00 1000000 -- [-3207.471] (-3209.292) (-3202.148) (-3208.678) * (-3209.150) (-3206.642) [-3204.777] (-3206.010) -- 0:00:00 Average standard deviation of split frequencies: 0.004711 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3207.470747 -- 12.210508 Chain 1 -- -3207.470740 -- 12.210508 Chain 2 -- -3209.292269 -- 12.150441 Chain 2 -- -3209.292272 -- 12.150441 Chain 3 -- -3202.148067 -- 10.290018 Chain 3 -- -3202.148081 -- 10.290018 Chain 4 -- -3208.677715 -- 10.971375 Chain 4 -- -3208.677714 -- 10.971375 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3209.150173 -- 10.603690 Chain 1 -- -3209.150177 -- 10.603690 Chain 2 -- -3206.641780 -- 12.163134 Chain 2 -- -3206.641774 -- 12.163134 Chain 3 -- -3204.776570 -- 10.338027 Chain 3 -- -3204.776582 -- 10.338027 Chain 4 -- -3206.010038 -- 11.059264 Chain 4 -- -3206.010041 -- 11.059264 Analysis completed in 5 mins 12 seconds Analysis used 312.12 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3198.90 Likelihood of best state for "cold" chain of run 2 was -3198.91 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 41.1 % ( 26 %) Dirichlet(Revmat{all}) 56.6 % ( 33 %) Slider(Revmat{all}) 23.0 % ( 32 %) Dirichlet(Pi{all}) 25.8 % ( 27 %) Slider(Pi{all}) 43.8 % ( 30 %) Multiplier(Alpha{1,2}) 45.3 % ( 20 %) Multiplier(Alpha{3}) 62.7 % ( 36 %) Slider(Pinvar{all}) 26.9 % ( 28 %) ExtSPR(Tau{all},V{all}) 26.9 % ( 27 %) ExtTBR(Tau{all},V{all}) 27.4 % ( 33 %) NNI(Tau{all},V{all}) 20.9 % ( 22 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 23 %) Multiplier(V{all}) 21.8 % ( 17 %) Nodeslider(V{all}) 25.0 % ( 31 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 40.8 % ( 29 %) Dirichlet(Revmat{all}) 55.7 % ( 36 %) Slider(Revmat{all}) 23.1 % ( 24 %) Dirichlet(Pi{all}) 25.9 % ( 20 %) Slider(Pi{all}) 43.3 % ( 31 %) Multiplier(Alpha{1,2}) 45.7 % ( 22 %) Multiplier(Alpha{3}) 63.5 % ( 39 %) Slider(Pinvar{all}) 26.9 % ( 24 %) ExtSPR(Tau{all},V{all}) 26.9 % ( 32 %) ExtTBR(Tau{all},V{all}) 27.0 % ( 36 %) NNI(Tau{all},V{all}) 20.4 % ( 21 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 29 %) Multiplier(V{all}) 21.9 % ( 25 %) Nodeslider(V{all}) 25.3 % ( 32 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.84 0.70 0.58 2 | 166945 0.85 0.73 3 | 166916 166926 0.87 4 | 166227 166357 166629 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.84 0.69 0.57 2 | 166588 0.85 0.72 3 | 166653 166727 0.86 4 | 165840 166939 167253 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3206.13 | 2 2 2 | | 2 2 | | 2 2 1 2 | | 1 12 1 1 1 1 * | |2 2 2 22 1 1 2 2 1 | | 2 2 2 1 2 * 1 22 1 2 2 1 2 2 | |1 1 1 21 1*2 2 1 1 21 1 2 * 2| | 1 1 1 12 11 2 22 1 1 | | * 12 12 2 1 1 22 2 1 2 1| | 1 1 1 2 1 1 2 1 1 1 | | 1 2 1 21 1 | | 1 2 2 1 2 1 1 | | 1 2 2 | | 2 1 | | 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3209.33 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3204.57 -3216.25 2 -3204.41 -3214.11 -------------------------------------- TOTAL -3204.49 -3215.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.494469 0.002561 0.403878 0.600146 0.491270 1216.45 1315.94 1.000 r(A<->C){all} 0.083829 0.000354 0.048371 0.121392 0.082910 996.28 1047.77 1.001 r(A<->G){all} 0.231472 0.001178 0.162701 0.296255 0.229995 956.33 970.89 1.000 r(A<->T){all} 0.151369 0.001302 0.082303 0.221194 0.151080 732.33 767.44 1.000 r(C<->G){all} 0.042468 0.000107 0.024430 0.063947 0.041758 1152.53 1211.39 1.000 r(C<->T){all} 0.406973 0.001787 0.326939 0.488716 0.405765 806.64 879.70 1.000 r(G<->T){all} 0.083889 0.000510 0.040000 0.127269 0.082406 835.88 1032.41 1.001 pi(A){all} 0.203510 0.000107 0.183611 0.223294 0.203004 1051.92 1130.14 1.000 pi(C){all} 0.335351 0.000151 0.312895 0.360463 0.335100 1201.42 1243.91 1.000 pi(G){all} 0.305221 0.000143 0.282714 0.328476 0.304922 1245.76 1271.23 1.001 pi(T){all} 0.155918 0.000086 0.137952 0.174301 0.155922 1110.77 1145.84 1.000 alpha{1,2} 0.115273 0.002343 0.001491 0.190624 0.118266 1098.98 1151.26 1.000 alpha{3} 2.424566 0.674350 1.011004 4.030355 2.293460 1501.00 1501.00 1.000 pinvar{all} 0.094230 0.004881 0.000167 0.226638 0.080835 1256.74 1344.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 Key to taxon bipartitions (saved to file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------- 1 -- .**** 2 -- .*... 3 -- ..*.. 4 -- ...*. 5 -- ....* 6 -- ..*** 7 -- ...** 8 -- ..**. 9 -- ..*.* ----------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 6 3002 1.000000 0.000000 1.000000 1.000000 2 7 1656 0.551632 0.007537 0.546302 0.556962 2 8 818 0.272485 0.009422 0.265823 0.279147 2 9 528 0.175883 0.001884 0.174550 0.177215 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.034146 0.000047 0.022096 0.048562 0.033739 1.000 2 length{all}[2] 0.019498 0.000026 0.009456 0.029142 0.019075 1.000 2 length{all}[3] 0.049580 0.000074 0.033148 0.067017 0.049206 1.000 2 length{all}[4] 0.039985 0.000084 0.023728 0.058974 0.039528 1.001 2 length{all}[5] 0.315274 0.001841 0.234411 0.402234 0.312294 1.000 2 length{all}[6] 0.028754 0.000057 0.014426 0.043485 0.028432 1.000 2 length{all}[7] 0.008451 0.000034 0.000045 0.019093 0.007400 1.001 2 length{all}[8] 0.006499 0.000024 0.000033 0.015452 0.005544 0.999 2 length{all}[9] 0.004550 0.000016 0.000002 0.013239 0.003550 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.004711 Maximum standard deviation of split frequencies = 0.009422 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) + | /------------------------------------------------ C3 (3) | | \----------100----------+ /------------------------ C4 (4) \-----------55----------+ \------------------------ C5 (5) Phylogram (based on average branch lengths): /------- C1 (1) | |---- C2 (2) + | /---------- C3 (3) | | \-----+/--------- C4 (4) \+ \----------------------------------------------------------------- C5 (5) |---------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (3 trees sampled): 90 % credible set contains 3 trees 95 % credible set contains 3 trees 99 % credible set contains 3 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 5 ls = 1314 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Sites with gaps or missing data are removed. 87 ambiguity characters in seq. 1 87 ambiguity characters in seq. 2 78 ambiguity characters in seq. 3 78 ambiguity characters in seq. 4 51 ambiguity characters in seq. 5 34 sites are removed. 48 57 58 59 60 85 86 87 88 89 90 112 113 114 227 228 229 230 346 347 348 405 427 428 429 430 431 432 433 434 435 436 437 438 Sequences read.. Counting site patterns.. 0:00 239 patterns at 404 / 404 sites (100.0%), 0:00 Counting codons.. 80 bytes for distance 233264 bytes for conP 32504 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, (3, (4, 5))); MP score: 276 349896 bytes for conP, adjusted 0.078754 0.040212 0.059666 0.124357 0.003841 0.094885 0.461503 0.300000 1.300000 ntime & nrate & np: 7 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 9 lnL0 = -3308.593716 Iterating by ming2 Initial: fx= 3308.593716 x= 0.07875 0.04021 0.05967 0.12436 0.00384 0.09489 0.46150 0.30000 1.30000 1 h-m-p 0.0000 0.0080 629.4721 ++YYCCC 3292.599420 4 0.0002 22 | 0/9 2 h-m-p 0.0003 0.0013 512.9040 +YYYYCCCC 3189.101384 7 0.0011 45 | 0/9 3 h-m-p 0.0000 0.0001 2733.4509 ++ 3143.300507 m 0.0001 57 | 0/9 4 h-m-p -0.0000 -0.0000 153.7753 h-m-p: -1.62646863e-19 -8.13234317e-19 1.53775333e+02 3143.300507 .. | 0/9 5 h-m-p 0.0000 0.0087 1075.1185 YYYYYC 3138.461573 5 0.0000 83 | 0/9 6 h-m-p 0.0001 0.0066 161.2157 +YCCCC 3127.378640 4 0.0011 103 | 0/9 7 h-m-p 0.0002 0.0010 553.7402 +YYCYCCCC 3077.672703 7 0.0009 127 | 0/9 8 h-m-p 0.0000 0.0001 6880.8767 +YCYCCC 3045.100917 5 0.0000 149 | 0/9 9 h-m-p 0.0002 0.0010 136.9099 CCCC 3043.547130 3 0.0003 167 | 0/9 10 h-m-p 0.0003 0.0029 106.1016 YCCC 3041.076582 3 0.0008 184 | 0/9 11 h-m-p 0.0003 0.0048 315.6832 +YCCC 3024.115970 3 0.0022 202 | 0/9 12 h-m-p 0.0009 0.0043 338.9193 YCCCC 3010.223372 4 0.0017 221 | 0/9 13 h-m-p 0.0005 0.0026 554.9397 YCCCC 3006.578796 4 0.0003 240 | 0/9 14 h-m-p 0.3971 1.9854 0.1740 CYCCCC 2999.512560 5 0.5842 261 | 0/9 15 h-m-p 0.4089 2.0444 0.1626 CCCCC 2996.324627 4 0.5427 290 | 0/9 16 h-m-p 0.6997 3.4991 0.1261 CCCCC 2994.630148 4 0.8658 319 | 0/9 17 h-m-p 1.6000 8.0000 0.0092 YCCC 2994.039871 3 2.9846 345 | 0/9 18 h-m-p 0.6322 8.0000 0.0433 YCC 2993.830544 2 0.9914 369 | 0/9 19 h-m-p 1.6000 8.0000 0.0109 YC 2993.811377 1 1.1853 391 | 0/9 20 h-m-p 1.6000 8.0000 0.0060 C 2993.809885 0 1.5344 412 | 0/9 21 h-m-p 1.6000 8.0000 0.0032 C 2993.809597 0 2.0807 433 | 0/9 22 h-m-p 1.6000 8.0000 0.0004 C 2993.809575 0 1.6400 454 | 0/9 23 h-m-p 1.6000 8.0000 0.0002 C 2993.809567 0 2.4862 475 | 0/9 24 h-m-p 1.6000 8.0000 0.0001 C 2993.809564 0 2.3590 496 | 0/9 25 h-m-p 1.6000 8.0000 0.0000 Y 2993.809564 0 1.1267 517 | 0/9 26 h-m-p 1.6000 8.0000 0.0000 ---------------Y 2993.809564 0 0.0000 553 Out.. lnL = -2993.809564 554 lfun, 554 eigenQcodon, 3878 P(t) Time used: 0:02 Model 1: NearlyNeutral TREE # 1 (1, 2, (3, (4, 5))); MP score: 276 0.078754 0.040212 0.059666 0.124357 0.003841 0.094885 0.461503 3.074954 0.573207 0.492243 ntime & nrate & np: 7 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 4.461526 np = 10 lnL0 = -3057.749968 Iterating by ming2 Initial: fx= 3057.749968 x= 0.07875 0.04021 0.05967 0.12436 0.00384 0.09489 0.46150 3.07495 0.57321 0.49224 1 h-m-p 0.0000 0.0047 362.2691 +YYCCC 3055.219667 4 0.0001 22 | 0/10 2 h-m-p 0.0001 0.0029 151.7341 ++YYYYYC 3022.250000 5 0.0022 42 | 0/10 3 h-m-p 0.0000 0.0001 4262.4253 +YCYCCC 3007.761751 5 0.0000 64 | 0/10 4 h-m-p 0.0012 0.0060 64.7342 YCCC 3007.422325 3 0.0002 82 | 0/10 5 h-m-p 0.0003 0.0099 37.3108 CCC 3007.280958 2 0.0003 99 | 0/10 6 h-m-p 0.0006 0.0188 17.1708 YC 3007.080527 1 0.0013 113 | 0/10 7 h-m-p 0.0011 0.0404 20.1219 YCC 3006.973258 2 0.0007 129 | 0/10 8 h-m-p 0.0016 0.0200 8.4558 CCC 3006.798643 2 0.0018 146 | 0/10 9 h-m-p 0.0005 0.0071 29.3562 +CYC 3005.960511 2 0.0019 163 | 0/10 10 h-m-p 0.0026 0.0320 21.1205 +CYYCCC 2993.466977 5 0.0199 186 | 0/10 11 h-m-p 0.5350 2.8391 0.7841 CCCC 2987.173676 3 0.5429 205 | 0/10 12 h-m-p 0.6709 5.8821 0.6345 CYCCC 2983.514227 4 0.5363 235 | 0/10 13 h-m-p 0.2292 2.2067 1.4848 CCCC 2981.713751 3 0.3725 264 | 0/10 14 h-m-p 0.6445 3.2223 0.6317 CCC 2979.166316 2 0.7739 281 | 0/10 15 h-m-p 1.6000 8.0000 0.0854 CYC 2977.542638 2 1.8506 307 | 0/10 16 h-m-p 1.3617 6.8085 0.0565 CCC 2976.868573 2 1.7429 334 | 0/10 17 h-m-p 1.6000 8.0000 0.0308 YCC 2976.752294 2 1.1874 360 | 0/10 18 h-m-p 1.6000 8.0000 0.0198 YC 2976.743224 1 0.8719 384 | 0/10 19 h-m-p 1.6000 8.0000 0.0029 YC 2976.742222 1 1.0726 408 | 0/10 20 h-m-p 1.6000 8.0000 0.0015 C 2976.742058 0 1.4923 431 | 0/10 21 h-m-p 1.6000 8.0000 0.0005 Y 2976.742040 0 1.2179 454 | 0/10 22 h-m-p 1.6000 8.0000 0.0001 C 2976.742037 0 1.5946 477 | 0/10 23 h-m-p 1.6000 8.0000 0.0000 Y 2976.742037 0 1.2168 500 | 0/10 24 h-m-p 1.6000 8.0000 0.0000 Y 2976.742037 0 1.1525 523 | 0/10 25 h-m-p 1.6000 8.0000 0.0000 Y 2976.742037 0 0.7603 546 | 0/10 26 h-m-p 1.6000 8.0000 0.0000 C 2976.742037 0 1.6000 569 | 0/10 27 h-m-p 1.6000 8.0000 0.0000 C 2976.742037 0 0.4000 592 | 0/10 28 h-m-p 0.6569 8.0000 0.0000 Y 2976.742037 0 0.1642 615 Out.. lnL = -2976.742037 616 lfun, 1848 eigenQcodon, 8624 P(t) Time used: 0:06 Model 2: PositiveSelection TREE # 1 (1, 2, (3, (4, 5))); MP score: 276 initial w for M2:NSpselection reset. 0.078754 0.040212 0.059666 0.124357 0.003841 0.094885 0.461503 3.193030 0.986220 0.117156 0.463564 2.408838 ntime & nrate & np: 7 3 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 3.446439 np = 12 lnL0 = -3076.036592 Iterating by ming2 Initial: fx= 3076.036592 x= 0.07875 0.04021 0.05967 0.12436 0.00384 0.09489 0.46150 3.19303 0.98622 0.11716 0.46356 2.40884 1 h-m-p 0.0000 0.0047 369.4181 +YYCCC 3072.937910 4 0.0001 24 | 0/12 2 h-m-p 0.0002 0.0040 140.6818 ++CCYCC 3041.714535 4 0.0035 49 | 0/12 3 h-m-p 0.0000 0.0001 735.9166 +CYCC 3038.254147 3 0.0001 70 | 0/12 4 h-m-p 0.0009 0.0073 57.6362 +YCCC 3034.748625 3 0.0024 91 | 0/12 5 h-m-p 0.0003 0.0017 282.4761 YCCC 3030.246211 3 0.0008 111 | 0/12 6 h-m-p 0.0063 0.0339 33.7566 CCCC 3026.756410 3 0.0082 132 | 0/12 7 h-m-p 0.0034 0.0206 80.4328 CCC 3024.017192 2 0.0031 151 | 0/12 8 h-m-p 0.0021 0.0104 44.6173 YYCC 3023.389315 3 0.0015 170 | 0/12 9 h-m-p 0.0058 0.1010 11.3065 +CYCCCC 3019.060513 5 0.0434 195 | 0/12 10 h-m-p 0.0009 0.0044 357.9964 +CYCC 3006.400113 3 0.0037 216 | 0/12 11 h-m-p 0.0147 0.0734 1.8658 ++ 2999.134798 m 0.0734 231 | 1/12 12 h-m-p 0.0359 0.3870 1.7219 +CYCCCC 2984.862661 5 0.2307 257 | 1/12 13 h-m-p 0.1755 1.0743 2.2641 YCCCCC 2979.051628 5 0.3486 281 | 1/12 14 h-m-p 0.2935 2.8628 2.6896 CYCCC 2977.673913 4 0.2262 303 | 1/12 15 h-m-p 0.4681 2.3404 0.5241 YYCC 2977.154582 3 0.3406 322 | 1/12 16 h-m-p 0.3949 2.3649 0.4521 YCCC 2976.922581 3 0.2097 353 | 1/12 17 h-m-p 0.8456 4.2282 0.1118 YC 2976.812034 1 0.5156 380 | 0/12 18 h-m-p 0.4006 4.4037 0.1439 CCC 2976.757416 2 0.4665 410 | 0/12 19 h-m-p 0.2424 1.2119 0.0557 YC 2976.743278 1 0.4833 438 | 0/12 20 h-m-p 0.2450 8.0000 0.1099 YC 2976.736855 1 0.4746 466 | 0/12 21 h-m-p 1.6000 8.0000 0.0314 YC 2976.732306 1 0.7648 494 | 0/12 22 h-m-p 1.6000 8.0000 0.0121 CC 2976.730890 1 1.3502 523 | 0/12 23 h-m-p 0.9788 8.0000 0.0167 YC 2976.729683 1 2.0288 551 | 0/12 24 h-m-p 1.6000 8.0000 0.0074 C 2976.729384 0 1.6313 578 | 0/12 25 h-m-p 1.6000 8.0000 0.0020 Y 2976.729360 0 1.2118 605 | 0/12 26 h-m-p 1.6000 8.0000 0.0005 +Y 2976.729358 0 4.5291 633 | 0/12 27 h-m-p 0.8543 8.0000 0.0024 ++ 2976.729327 m 8.0000 660 | 0/12 28 h-m-p 0.0343 6.2972 0.5622 +C 2976.729198 0 0.1731 688 | 0/12 29 h-m-p 0.5341 8.0000 0.1822 Y 2976.729141 0 0.5341 715 | 0/12 30 h-m-p 1.6000 8.0000 0.0182 YC 2976.728959 1 3.5739 743 | 0/12 31 h-m-p 0.3858 8.0000 0.1687 CY 2976.728812 1 0.7600 772 | 0/12 32 h-m-p 1.4452 8.0000 0.0887 YC 2976.728738 1 0.8315 800 | 0/12 33 h-m-p 1.6000 8.0000 0.0110 Y 2976.728669 0 0.7358 827 | 0/12 34 h-m-p 0.0823 8.0000 0.0987 ++Y 2976.728542 0 1.3163 856 | 0/12 35 h-m-p 1.6000 8.0000 0.0766 Y 2976.728420 0 1.6000 883 | 0/12 36 h-m-p 1.6000 8.0000 0.0118 C 2976.728362 0 0.4901 910 | 0/12 37 h-m-p 0.0538 8.0000 0.1077 ++C 2976.728259 0 0.8602 939 | 0/12 38 h-m-p 0.4927 8.0000 0.1880 Y 2976.728215 0 0.4927 966 | 0/12 39 h-m-p 1.6000 8.0000 0.0248 C 2976.728126 0 1.6000 993 | 0/12 40 h-m-p 0.3966 8.0000 0.1002 YC 2976.728059 1 0.9807 1021 | 0/12 41 h-m-p 1.2198 8.0000 0.0806 Y 2976.727988 0 1.2198 1048 | 0/12 42 h-m-p 1.6000 8.0000 0.0103 C 2976.727955 0 0.6173 1075 | 0/12 43 h-m-p 0.0811 8.0000 0.0780 ++Y 2976.727876 0 1.2980 1104 | 0/12 44 h-m-p 0.8276 8.0000 0.1223 Y 2976.727842 0 0.8276 1131 | 0/12 45 h-m-p 1.6000 8.0000 0.0153 Y 2976.727786 0 1.0144 1158 | 0/12 46 h-m-p 0.1966 8.0000 0.0790 +C 2976.727719 0 1.1950 1186 | 0/12 47 h-m-p 0.6635 8.0000 0.1423 Y 2976.727689 0 0.6635 1213 | 0/12 48 h-m-p 1.6000 8.0000 0.0191 Y 2976.727655 0 0.8866 1240 | 0/12 49 h-m-p 0.2502 8.0000 0.0678 +C 2976.727600 0 1.3309 1268 | 0/12 50 h-m-p 0.7599 8.0000 0.1187 Y 2976.727563 0 0.7599 1295 | 0/12 51 h-m-p 1.6000 8.0000 0.0293 Y 2976.727541 0 0.6690 1322 | 0/12 52 h-m-p 0.1893 8.0000 0.1037 +C 2976.727504 0 0.7570 1350 | 0/12 53 h-m-p 0.5143 8.0000 0.1527 Y 2976.727478 0 0.5143 1377 | 0/12 54 h-m-p 1.6000 8.0000 0.0373 C 2976.727448 0 1.3049 1404 | 0/12 55 h-m-p 0.5595 8.0000 0.0870 C 2976.727425 0 0.7310 1431 | 0/12 56 h-m-p 0.7520 8.0000 0.0845 C 2976.727394 0 0.8724 1458 | 0/12 57 h-m-p 1.6000 8.0000 0.0281 C 2976.727370 0 1.6000 1485 | 0/12 58 h-m-p 0.2208 8.0000 0.2040 Y 2976.727348 0 0.3712 1512 | 0/12 59 h-m-p 0.5635 8.0000 0.1344 Y 2976.727332 0 0.5635 1539 | 0/12 60 h-m-p 1.6000 8.0000 0.0279 C 2976.727308 0 1.4424 1566 | 0/12 61 h-m-p 0.6404 8.0000 0.0629 Y 2976.727289 0 1.3464 1593 | 0/12 62 h-m-p 1.2284 8.0000 0.0690 C 2976.727261 0 1.3204 1620 | 0/12 63 h-m-p 1.6000 8.0000 0.0525 C 2976.727228 0 2.2204 1647 | 0/12 64 h-m-p 1.5402 8.0000 0.0757 C 2976.727216 0 0.3851 1674 | 0/12 65 h-m-p 0.1154 8.0000 0.2527 +Y 2976.727195 0 0.4618 1702 | 0/12 66 h-m-p 0.7761 8.0000 0.1503 Y 2976.727189 0 0.3939 1729 | 0/12 67 h-m-p 1.0088 8.0000 0.0587 Y 2976.727166 0 2.4439 1756 | 0/12 68 h-m-p 1.6000 8.0000 0.0174 Y 2976.727154 0 0.8877 1783 | 0/12 69 h-m-p 0.1183 8.0000 0.1303 +Y 2976.727134 0 1.0406 1811 | 0/12 70 h-m-p 0.9987 8.0000 0.1358 Y 2976.727128 0 0.5199 1838 | 0/12 71 h-m-p 0.9871 8.0000 0.0715 +Y 2976.727110 0 2.4791 1866 | 0/12 72 h-m-p 1.6000 8.0000 0.0614 C 2976.727092 0 1.6918 1893 | 0/12 73 h-m-p 1.6000 8.0000 0.0260 C 2976.727088 0 0.3457 1920 | 0/12 74 h-m-p 0.0526 8.0000 0.1711 ++Y 2976.727079 0 0.8420 1949 | 0/12 75 h-m-p 1.6000 8.0000 0.0762 C 2976.727070 0 1.6000 1976 | 0/12 76 h-m-p 1.6000 8.0000 0.0630 Y 2976.727062 0 0.7763 2003 | 0/12 77 h-m-p 0.2869 8.0000 0.1706 +Y 2976.727054 0 0.7602 2031 | 0/12 78 h-m-p 0.8698 8.0000 0.1491 Y 2976.727050 0 0.8698 2058 | 0/12 79 h-m-p 1.6000 8.0000 0.0307 C 2976.727043 0 1.2827 2085 | 0/12 80 h-m-p 0.3603 8.0000 0.1092 +Y 2976.727036 0 1.4411 2113 | 0/12 81 h-m-p 1.3785 8.0000 0.1142 C 2976.727030 0 1.3785 2140 | 0/12 82 h-m-p 1.6000 8.0000 0.0299 Y 2976.727026 0 0.9304 2167 | 0/12 83 h-m-p 0.1185 8.0000 0.2344 +C 2976.727020 0 0.7458 2195 | 0/12 84 h-m-p 0.6977 8.0000 0.2506 Y 2976.727018 0 0.4151 2222 | 0/12 85 h-m-p 0.9021 8.0000 0.1153 Y 2976.727013 0 1.8048 2249 | 0/12 86 h-m-p 1.6000 8.0000 0.0506 Y 2976.727008 0 3.3502 2276 | 0/12 87 h-m-p 0.2905 8.0000 0.5840 C 2976.727004 0 0.2905 2303 | 0/12 88 h-m-p 0.7250 8.0000 0.2340 Y 2976.727003 0 0.4586 2330 | 0/12 89 h-m-p 1.0872 8.0000 0.0987 C 2976.727001 0 1.4578 2357 | 0/12 90 h-m-p 1.6000 8.0000 0.0483 Y 2976.726998 0 3.8461 2384 | 0/12 91 h-m-p 0.3724 8.0000 0.4986 C 2976.726995 0 0.4313 2411 | 0/12 92 h-m-p 0.5065 8.0000 0.4246 Y 2976.726994 0 0.5065 2438 | 0/12 93 h-m-p 1.6000 8.0000 0.0036 C 2976.726994 0 1.3969 2465 | 0/12 94 h-m-p 0.0453 8.0000 0.1121 +++C 2976.726992 0 2.9937 2495 | 0/12 95 h-m-p 1.4888 8.0000 0.2255 C 2976.726990 0 1.8890 2522 | 0/12 96 h-m-p 1.6000 8.0000 0.1158 C 2976.726989 0 1.6000 2549 | 0/12 97 h-m-p 0.2514 8.0000 0.7366 Y 2976.726988 0 0.4109 2576 | 0/12 98 h-m-p 0.8966 8.0000 0.3375 C 2976.726988 0 0.8966 2603 | 0/12 99 h-m-p 1.6000 8.0000 0.1850 Y 2976.726987 0 3.7431 2630 | 0/12 100 h-m-p 1.6000 8.0000 0.1320 C 2976.726987 0 2.0453 2657 | 0/12 101 h-m-p 0.7580 8.0000 0.3563 C 2976.726987 0 0.7787 2684 | 0/12 102 h-m-p 0.7890 8.0000 0.3516 +Y 2976.726986 0 2.1075 2712 | 0/12 103 h-m-p 1.6000 8.0000 0.2051 C 2976.726986 0 2.3648 2739 | 0/12 104 h-m-p 1.1505 8.0000 0.4216 C 2976.726986 0 1.2259 2766 | 0/12 105 h-m-p 1.1924 8.0000 0.4335 C 2976.726986 0 1.8801 2793 | 0/12 106 h-m-p 1.6000 8.0000 0.2307 C 2976.726986 0 1.9698 2820 | 0/12 107 h-m-p 1.2672 8.0000 0.3587 +C 2976.726986 0 4.3907 2848 | 0/12 108 h-m-p 1.6000 8.0000 0.6750 C 2976.726986 0 2.1072 2875 | 0/12 109 h-m-p 1.3517 8.0000 1.0523 Y 2976.726986 0 2.4851 2902 | 0/12 110 h-m-p 1.0414 8.0000 2.5110 C 2976.726986 0 0.2604 2917 | 0/12 111 h-m-p 1.6000 8.0000 0.3329 -C 2976.726986 0 0.1000 2933 | 0/12 112 h-m-p 1.6000 8.0000 0.0070 Y 2976.726986 0 0.6879 2960 | 0/12 113 h-m-p 1.6000 8.0000 0.0021 Y 2976.726986 0 0.6943 2987 | 0/12 114 h-m-p 1.6000 8.0000 0.0006 Y 2976.726986 0 0.1842 3014 | 0/12 115 h-m-p 0.0160 8.0000 0.2183 -Y 2976.726986 0 0.0010 3042 | 0/12 116 h-m-p 1.6000 8.0000 0.0000 ---------------Y 2976.726986 0 0.0000 3084 | 0/12 117 h-m-p 0.0160 8.0000 0.0000 ---Y 2976.726986 0 0.0001 3114 Out.. lnL = -2976.726986 3115 lfun, 12460 eigenQcodon, 65415 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2986.988776 S = -2805.142212 -173.152489 Calculating f(w|X), posterior probabilities of site classes. did 10 / 239 patterns 0:37 did 20 / 239 patterns 0:37 did 30 / 239 patterns 0:37 did 40 / 239 patterns 0:37 did 50 / 239 patterns 0:37 did 60 / 239 patterns 0:37 did 70 / 239 patterns 0:37 did 80 / 239 patterns 0:37 did 90 / 239 patterns 0:37 did 100 / 239 patterns 0:37 did 110 / 239 patterns 0:37 did 120 / 239 patterns 0:38 did 130 / 239 patterns 0:38 did 140 / 239 patterns 0:38 did 150 / 239 patterns 0:38 did 160 / 239 patterns 0:38 did 170 / 239 patterns 0:38 did 180 / 239 patterns 0:38 did 190 / 239 patterns 0:38 did 200 / 239 patterns 0:38 did 210 / 239 patterns 0:38 did 220 / 239 patterns 0:38 did 230 / 239 patterns 0:38 did 239 / 239 patterns 0:38 Time used: 0:38 Model 3: discrete TREE # 1 (1, 2, (3, (4, 5))); MP score: 276 0.078754 0.040212 0.059666 0.124357 0.003841 0.094885 0.461503 3.199325 0.331355 0.382499 0.087636 0.218776 0.366316 ntime & nrate & np: 7 4 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 8.158907 np = 13 lnL0 = -2991.694436 Iterating by ming2 Initial: fx= 2991.694436 x= 0.07875 0.04021 0.05967 0.12436 0.00384 0.09489 0.46150 3.19933 0.33136 0.38250 0.08764 0.21878 0.36632 1 h-m-p 0.0000 0.0013 327.6217 +YYCCC 2989.817000 4 0.0001 25 | 0/13 2 h-m-p 0.0002 0.0012 90.0490 ++ 2984.767706 m 0.0012 41 | 1/13 3 h-m-p 0.0007 0.0034 91.6939 CCCCC 2982.791851 4 0.0010 65 | 1/13 4 h-m-p 0.0002 0.0011 195.1078 CCCC 2981.639626 3 0.0003 87 | 1/13 5 h-m-p 0.0011 0.0053 43.4564 YCC 2981.198060 2 0.0008 106 | 1/13 6 h-m-p 0.0005 0.0043 68.6428 YCCC 2980.466238 3 0.0010 127 | 1/13 7 h-m-p 0.0016 0.0080 20.2835 CCC 2980.408614 2 0.0004 147 | 0/13 8 h-m-p 0.0002 0.0442 36.4874 YCCC 2980.115453 3 0.0005 168 | 0/13 9 h-m-p 0.0009 0.0063 19.1971 +YC 2979.893181 1 0.0025 186 | 0/13 10 h-m-p 0.0016 0.0079 12.6025 YC 2979.881421 1 0.0003 203 | 0/13 11 h-m-p 0.0020 0.5676 1.7162 ++++YCC 2978.530000 2 0.3746 226 | 0/13 12 h-m-p 0.2239 1.1197 0.4465 +CCC 2977.737439 2 0.7587 247 | 0/13 13 h-m-p 0.2629 1.3143 0.8526 CCC 2977.613964 2 0.2822 280 | 0/13 14 h-m-p 0.4186 8.0000 0.5747 YCCC 2977.355229 3 0.8162 314 | 0/13 15 h-m-p 1.6000 8.0000 0.2270 CCCC 2977.131311 3 1.9376 349 | 0/13 16 h-m-p 1.6000 8.0000 0.1048 YCC 2976.986991 2 1.0607 381 | 0/13 17 h-m-p 0.3309 8.0000 0.3360 YC 2976.900678 1 0.7062 411 | 0/13 18 h-m-p 0.3174 8.0000 0.7477 CCCC 2976.787338 3 0.4749 446 | 0/13 19 h-m-p 1.6000 8.0000 0.0848 YCCC 2976.753647 3 0.7179 480 | 0/13 20 h-m-p 1.6000 8.0000 0.0370 CCC 2976.738539 2 1.4413 513 | 0/13 21 h-m-p 1.2382 8.0000 0.0431 C 2976.735155 0 1.2382 542 | 0/13 22 h-m-p 1.6000 8.0000 0.0131 YC 2976.734737 1 1.0130 572 | 0/13 23 h-m-p 1.6000 8.0000 0.0014 +C 2976.733519 0 6.6413 602 | 0/13 24 h-m-p 0.8116 8.0000 0.0113 +YC 2976.729855 1 4.8536 633 | 0/13 25 h-m-p 1.6000 8.0000 0.0184 C 2976.727933 0 1.3923 662 | 0/13 26 h-m-p 1.6000 8.0000 0.0148 YC 2976.727151 1 1.1823 692 | 0/13 27 h-m-p 1.6000 8.0000 0.0075 YC 2976.727007 1 0.9737 722 | 0/13 28 h-m-p 1.6000 8.0000 0.0026 Y 2976.726989 0 0.9025 751 | 0/13 29 h-m-p 1.6000 8.0000 0.0006 Y 2976.726986 0 0.9730 780 | 0/13 30 h-m-p 1.6000 8.0000 0.0002 C 2976.726986 0 1.3721 809 | 0/13 31 h-m-p 1.6000 8.0000 0.0001 Y 2976.726986 0 1.0506 838 | 0/13 32 h-m-p 1.6000 8.0000 0.0000 Y 2976.726986 0 1.2700 867 | 0/13 33 h-m-p 1.6000 8.0000 0.0000 ----Y 2976.726986 0 0.0016 900 Out.. lnL = -2976.726986 901 lfun, 3604 eigenQcodon, 18921 P(t) Time used: 0:47 Model 7: beta TREE # 1 (1, 2, (3, (4, 5))); MP score: 276 0.078754 0.040212 0.059666 0.124357 0.003841 0.094885 0.461503 3.199325 0.665673 1.549129 ntime & nrate & np: 7 1 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 7.059802 np = 10 lnL0 = -2991.720518 Iterating by ming2 Initial: fx= 2991.720518 x= 0.07875 0.04021 0.05967 0.12436 0.00384 0.09489 0.46150 3.19932 0.66567 1.54913 1 h-m-p 0.0000 0.0147 276.7728 +YYCCC 2990.088511 4 0.0001 22 | 0/10 2 h-m-p 0.0002 0.0056 67.8000 +CCC 2988.260527 2 0.0009 40 | 0/10 3 h-m-p 0.0003 0.0019 224.8667 +YCCCC 2982.974349 4 0.0008 61 | 0/10 4 h-m-p 0.0003 0.0017 346.6646 YYYC 2980.156567 3 0.0003 77 | 0/10 5 h-m-p 0.0021 0.0105 44.5388 CCC 2979.756257 2 0.0006 94 | 0/10 6 h-m-p 0.0005 0.0074 51.1469 CCCC 2979.330574 3 0.0007 113 | 0/10 7 h-m-p 0.0023 0.0114 14.8974 YC 2979.299836 1 0.0004 127 | 0/10 8 h-m-p 0.0031 0.1501 1.7373 YC 2979.298772 1 0.0005 141 | 0/10 9 h-m-p 0.0049 2.4269 1.0876 ++YCC 2978.984666 2 0.1656 159 | 0/10 10 h-m-p 0.2435 2.5101 0.7393 +YYYYYCYCCC 2977.656343 10 1.2275 186 | 0/10 11 h-m-p 0.2034 1.0168 1.5077 YYC 2977.474310 2 0.1512 211 | 0/10 12 h-m-p 1.6000 8.0000 0.0898 YCC 2977.389871 2 0.7574 227 | 0/10 13 h-m-p 1.5173 8.0000 0.0448 YC 2977.368652 1 0.6214 251 | 0/10 14 h-m-p 1.1877 8.0000 0.0234 YC 2977.367797 1 0.5172 275 | 0/10 15 h-m-p 1.4347 8.0000 0.0085 YC 2977.367318 1 0.5911 299 | 0/10 16 h-m-p 1.6000 8.0000 0.0003 C 2977.367254 0 1.7047 322 | 0/10 17 h-m-p 1.6000 8.0000 0.0002 Y 2977.367252 0 1.0448 345 | 0/10 18 h-m-p 1.6000 8.0000 0.0000 Y 2977.367252 0 0.9451 368 | 0/10 19 h-m-p 1.6000 8.0000 0.0000 Y 2977.367252 0 1.0010 391 | 0/10 20 h-m-p 1.6000 8.0000 0.0000 --Y 2977.367252 0 0.0250 416 Out.. lnL = -2977.367252 417 lfun, 4587 eigenQcodon, 29190 P(t) Time used: 1:00 Model 8: beta&w>1 TREE # 1 (1, 2, (3, (4, 5))); MP score: 276 initial w for M8:NSbetaw>1 reset. 0.078754 0.040212 0.059666 0.124357 0.003841 0.094885 0.461503 3.173961 0.900000 0.401601 1.403915 2.022819 ntime & nrate & np: 7 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.148966 np = 12 lnL0 = -2993.287503 Iterating by ming2 Initial: fx= 2993.287503 x= 0.07875 0.04021 0.05967 0.12436 0.00384 0.09489 0.46150 3.17396 0.90000 0.40160 1.40392 2.02282 1 h-m-p 0.0000 0.0006 299.0823 ++CYC 2987.519408 2 0.0002 22 | 0/12 2 h-m-p 0.0001 0.0003 223.5454 ++ 2980.767915 m 0.0003 37 | 0/12 3 h-m-p 0.0009 0.0043 57.7126 YYCC 2979.765395 3 0.0007 56 | 0/12 4 h-m-p 0.0003 0.0049 114.3835 CYCC 2978.769733 3 0.0005 76 | 0/12 5 h-m-p 0.0005 0.0025 85.9228 YCC 2978.271055 2 0.0004 94 | 0/12 6 h-m-p 0.0015 0.0105 20.3836 CY 2978.209017 1 0.0004 111 | 0/12 7 h-m-p 0.0027 0.1516 2.9821 CC 2978.197016 1 0.0024 128 | 0/12 8 h-m-p 0.0011 0.0339 6.5908 CC 2978.193062 1 0.0004 145 | 0/12 9 h-m-p 0.0010 0.4048 2.7092 ++++YCCC 2977.429195 3 0.2186 169 | 0/12 10 h-m-p 0.0072 0.0362 7.0919 -C 2977.425737 0 0.0004 185 | 0/12 11 h-m-p 0.0042 1.2055 0.7375 +++CCCC 2977.191686 3 0.3060 209 | 0/12 12 h-m-p 0.5364 2.7469 0.4208 CC 2977.039667 1 0.4594 238 | 0/12 13 h-m-p 0.5880 8.0000 0.3288 CCC 2976.975793 2 0.6554 269 | 0/12 14 h-m-p 1.6000 8.0000 0.0748 C 2976.965363 0 1.5085 296 | 0/12 15 h-m-p 1.4972 8.0000 0.0753 YCCC 2976.943574 3 3.4778 328 | 0/12 16 h-m-p 1.0353 7.1456 0.2531 YCCC 2976.908015 3 2.0447 360 | 0/12 17 h-m-p 1.6000 8.0000 0.0922 YC 2976.900001 1 0.6500 388 | 0/12 18 h-m-p 0.4439 8.0000 0.1350 +CCC 2976.885166 2 2.3405 420 | 0/12 19 h-m-p 1.6000 8.0000 0.1591 CC 2976.873314 1 2.3784 449 | 0/12 20 h-m-p 1.6000 8.0000 0.0927 YCC 2976.865175 2 2.6831 479 | 0/12 21 h-m-p 0.5035 3.7911 0.4938 YCC 2976.858001 2 0.9223 509 | 0/12 22 h-m-p 1.2213 8.0000 0.3729 CYC 2976.849066 2 1.0992 539 | 0/12 23 h-m-p 1.4881 8.0000 0.2754 YCC 2976.827730 2 2.9694 569 | 0/12 24 h-m-p 0.9566 8.0000 0.8550 YCC 2976.807026 2 1.7034 599 | 0/12 25 h-m-p 1.6000 8.0000 0.5370 YC 2976.796699 1 0.7589 627 | 0/12 26 h-m-p 0.4779 8.0000 0.8529 +YC 2976.780910 1 3.0490 656 | 0/12 27 h-m-p 1.6000 8.0000 0.8795 CC 2976.775181 1 1.4103 685 | 0/12 28 h-m-p 1.5035 8.0000 0.8250 YC 2976.771252 1 3.1270 713 | 0/12 29 h-m-p 1.6000 8.0000 0.9036 CC 2976.769344 1 1.9280 742 | 0/12 30 h-m-p 1.6000 8.0000 0.6679 C 2976.768411 0 1.4575 769 | 0/12 31 h-m-p 0.4514 8.0000 2.1566 +Y 2976.766182 0 1.5289 797 | 0/12 32 h-m-p 1.6000 8.0000 1.5701 +YC 2976.762738 1 4.2008 814 | 0/12 33 h-m-p 1.6000 8.0000 1.0582 YC 2976.757769 1 2.6379 830 | 0/12 34 h-m-p 0.4093 8.0000 6.8199 +YY 2976.752693 1 1.4770 847 | 0/12 35 h-m-p 1.6000 8.0000 4.1337 YC 2976.746611 1 3.8703 863 | 0/12 36 h-m-p 1.6000 8.0000 2.1194 C 2976.741670 0 1.6000 878 | 0/12 37 h-m-p 0.3087 3.7418 10.9842 +C 2976.738641 0 1.3164 894 | 0/12 38 h-m-p 0.5742 2.8710 9.2780 +YC 2976.735702 1 1.8460 911 | 0/12 39 h-m-p 0.2050 1.0248 9.2792 ++ 2976.733678 m 1.0248 926 | 1/12 40 h-m-p 0.2818 3.1833 2.7454 -C 2976.733301 0 0.0147 942 | 1/12 41 h-m-p 0.2928 8.0000 0.1380 --------------C 2976.733301 0 0.0000 971 | 1/12 42 h-m-p 0.0000 0.0090 85.2351 ++C 2976.732833 0 0.0003 999 | 1/12 43 h-m-p 1.4395 8.0000 0.0199 C 2976.732522 0 1.7654 1014 | 1/12 44 h-m-p 1.6000 8.0000 0.0115 C 2976.732430 0 1.7370 1040 | 1/12 45 h-m-p 1.6000 8.0000 0.0004 Y 2976.732429 0 0.9895 1066 | 1/12 46 h-m-p 1.6000 8.0000 0.0000 Y 2976.732429 0 0.9753 1092 | 1/12 47 h-m-p 1.6000 8.0000 0.0000 C 2976.732429 0 1.3774 1118 Out.. lnL = -2976.732429 1119 lfun, 13428 eigenQcodon, 86163 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2984.555293 S = -2805.169358 -171.832087 Calculating f(w|X), posterior probabilities of site classes. did 10 / 239 patterns 1:41 did 20 / 239 patterns 1:41 did 30 / 239 patterns 1:41 did 40 / 239 patterns 1:41 did 50 / 239 patterns 1:42 did 60 / 239 patterns 1:42 did 70 / 239 patterns 1:42 did 80 / 239 patterns 1:42 did 90 / 239 patterns 1:42 did 100 / 239 patterns 1:43 did 110 / 239 patterns 1:43 did 120 / 239 patterns 1:43 did 130 / 239 patterns 1:43 did 140 / 239 patterns 1:43 did 150 / 239 patterns 1:44 did 160 / 239 patterns 1:44 did 170 / 239 patterns 1:44 did 180 / 239 patterns 1:44 did 190 / 239 patterns 1:44 did 200 / 239 patterns 1:45 did 210 / 239 patterns 1:45 did 220 / 239 patterns 1:45 did 230 / 239 patterns 1:45 did 239 / 239 patterns 1:45 Time used: 1:45 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=5, Len=438 D_melanogaster_a6-PB MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQV-AL D_sechellia_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQA-AL D_yakuba_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQA-AF D_erecta_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQA-TL D_suzukii_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQATVI ***:********************* ****** *:******:** *. .: D_melanogaster_a6-PB ASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDE------TPSAGQPAAA D_sechellia_a6-PB ASKTDRQLSHLQRRHVAATLQADVTIDLLSDDDE------TPSAGQSAAA D_yakuba_a6-PB ASKTDRQLSQLQRRHVAATLQADVTIDLLSDDDD------TPSAGQSTAA D_erecta_a6-PB ASKTDRQLSHLQRRHAAATLQADVTIDLLSDDDD------TPSAGQSTAA D_suzukii_a6-PB ASKTDR----LQRRHVAATLPADVTIDLLSDDDDDEREEAGPGPGPSTAA ****** *****.*:** .***********: *..* .:** D_melanogaster_a6-PB GHNRLLIPAPG---HRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNE D_sechellia_a6-PB GHNRLLIPAPG---HRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSE D_yakuba_a6-PB GHNRLLIPVPRHSLHRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNE D_erecta_a6-PB GHNRLLIPAPRHSLHRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNE D_suzukii_a6-PB SHNRLLIPAPFAVGQRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYND .*******.* :* *.****. :. ** :*:*********:.: D_melanogaster_a6-PB QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR D_sechellia_a6-PB QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR D_yakuba_a6-PB QKPSSTLRVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTR D_erecta_a6-PB QEPCSTARVRSQLSMRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKL D_suzukii_a6-PB QEGSSGAMARPQLSMRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTR *: .* .*.************** ***:**********.****.* . D_melanogaster_a6-PB VSGHPKPCRASTAASNGFATAEGGEG----GNETGCFLEVDVGGGITATL D_sechellia_a6-PB VSGNPKPCRASTAATNGFATAEGGEG----GNETGCFLEVDVGGGITARL D_yakuba_a6-PB VSGHAKPCRASTVASNGFVIAEGGEG----GNETGCFLEVDVGGGITATL D_erecta_a6-PB VSGHAKPCQASIAASNGIVTADGGEG----GNETGCFLEVDVGGGITATL D_suzukii_a6-PB LSGHLKPCRASTAASNGMVMAGGGGGDGGGGNDTSCFLEVDVGGGITATL :**: ***:** .*:**:. * ** * **:*.************* * D_melanogaster_a6-PB PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPAL D_sechellia_a6-PB PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL D_yakuba_a6-PB PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHELMPEQLQKLSPAL D_erecta_a6-PB PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL D_suzukii_a6-PB PDETTVHTVIANRIYELSLSKLREGLAFSGAPEYTTDLLPEQLQKLSPAL ******************************.**** :*:*********** D_melanogaster_a6-PB RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGG---VG D_sechellia_a6-PB RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDECESTGPHANGG---VG D_yakuba_a6-PB RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGTHANGG---DG D_erecta_a6-PB RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHANGG---VG D_suzukii_a6-PB RAKVAPLVAPSPPTPISLKLSSDLSISLISDDDDCESTGQHANGGGGGVG *******************************:*:***** *.*** * D_melanogaster_a6-PB TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP D_sechellia_a6-PB TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP D_yakuba_a6-PB TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLATPVALALP D_erecta_a6-PB TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP D_suzukii_a6-PB TELAHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLASPVALALP ** .**************************************:******* D_melanogaster_a6-PB VMAANPTSSASVVALPLQLPRRRKLGoooooooooooo D_sechellia_a6-PB VMAANPTSSASVVALPLQLPRRRKLGoooooooooooo D_yakuba_a6-PB VMAANPTSSASVVALPLQLPRRRKLGooooooooo--- D_erecta_a6-PB VMAANPTSSASVVALPLQLPRRRKLGooooooooo--- D_suzukii_a6-PB VMAT-ASSSASVVALPLQLPRRRKLG------------ ***: .:*******************
>D_melanogaster_a6-PB ATGAACCAGAAACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA CAACCGTCGTCTCAAGCGGCGCCGCTGTCGGTGGATGGAACGCCTGCTTG AGCACCAGCGGATCTGCATGGCCCGGATGCGCGACCAAGTG---GCTCTC GCCTCCAAGACTGACCGGCAGCTGTCCCATCTGCAGCGGCGCCATGTCGC CTCCACTTTGCAGCCGGACGTGACCATCGACCTGCTGTCGGATGACGATG AG------------------ACCCCATCGGCCGGACAGCCCGCTGCAGCT GGCCACAATCGCCTCCTGATTCCTGCCCCAGGG---------CACCGAGC ACATAGAACGGGCAGAAGGCAGGCGCCGCGCAGAGCTGCCACCCACTCAT ACCCAGTGACCGACAGCATCCTGATAACCAGCGATGACGAGCACAACGAG CAGGAACCCAGCAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC ACCGCCACCGCTCGCACCGCTCACACAGTCGGAGACCATCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAACTGCCTGACGCGG GTGTCAGGTCACCCCAAGCCGTGTCGAGCGTCGACGGCGGCCAGCAATGG ATTCGCCACCGCCGAAGGCGGAGAGGGC------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGAGGCATCACAGCCACGCTG CCGGACGAGACGACCGTTCACACGGTCATCGCAAACCGTATTTACGAACT CTCGCTGAGCAAACTACGCGAAGGCCTGGCTTTTAGTGGAGTGCCGGAAT ACACGAACGACCTGATGCCGGAGCAGCTGCAGAAACTGTCACCGGCATTG CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC CCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG ATTGCGAAAGCACCGGTCCACATGTCAACGGAGGA---------GTCGGC ACCGAACCGGTGCACCCCGTCGTGGTGGCTGCGGCGGAGGCACACGCTGC CGCCAAGCTGCTCAAGCAGCAGCAGCCACAGCTCTCGGTGGTGCAGCATC TGCAGTACGTCGGCGGCGGACTCGCAGCTCCAGTGGCTCTTGCCCTTCCG GTGATGGCAGCAAATCCGACCTCGTCTGCTTCCGTTGTTGCCTTGCCGCT GCAGCTGCCGCGGCGCCGAAAACTGGGA---------------------- -------------- >D_sechellia_a6-PB ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA CAACCGTCGTCTCAAGCGGCGCCGCTGTCGTTGGATGGAACGCCTGCTTG AGCACCAGCGGATCTGCATGGCCCGGATGCGCGCCCAAGCG---GCCCTC GCCTCCAAGACTGACCGGCAGCTATCCCATCTGCAGCGGCGCCATGTGGC CGCCACTTTGCAGGCCGACGTGACTATCGACTTGCTGTCGGACGACGATG AG------------------ACCCCATCGGCCGGACAGTCCGCTGCAGCT GGCCACAATCGCCTCCTGATACCTGCCCCAGGG---------CACCGAGC ACCTAGAGTGGGCAGAAGGCAGGCGCCGCGCAGAGTTGCCACCCACTCAT ACCCCGTGACCGACAGCATCCTGATAACCAGCGACGACGAGCACAGCGAG CAGGAACCCAGTAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC ACCGCCACCGCTCGCACCGCTCACACAGTCGGAGACCATCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAATTGCCTGACGCGA GTGTCAGGCAACCCCAAGCCGTGTCGAGCGTCCACGGCGGCCACCAATGG ATTCGCCACCGCCGAAGGCGGAGAGGGC------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGAGGCATCACAGCCAGGCTG CCGGACGAGACGACTGTTCACACGGTCATCGCCAACCGTATTTACGAACT CTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCGGAAT ACACGCACGACCTGATGCCGGAGCAGCTGCAGAAACTGTCGCCGGCATTG CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC CCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG AATGCGAAAGCACCGGTCCACATGCCAACGGAGGA---------GTCGGC ACCGAGCCAGTACACCCCGTCGTGGTGGCTGCGGCGGAGGCACACGCTGC CGCTAAGCTGCTCAAGCAGCAGCAGCCACAGCTCTCGGTGGTGCAGCATC TGCAGTACGTGGGCGGCGGACTCGCAGCTCCAGTGGCTCTGGCCCTTCCG GTGATGGCAGCGAATCCGACCTCGTCTGCTTCCGTCGTTGCCTTGCCGCT GCAGCTGCCGCGACGCCGAAAGCTGGGA---------------------- -------------- >D_yakuba_a6-PB ATGAACCAGAGACATTCCGAACCATTCTACATATCACCCCGGCTGTTCGA CAACCGGCGTCTTAAGCGGCGTCGCGGTCGGTGGATGGAACGCCTGCTTG AGCACCAGCGTATCTGCATGGCACGGATGCGCGCCCAAGCG---GCTTTC GCCTCCAAGACTGACCGGCAGCTGTCCCAACTGCAGCGGCGCCATGTGGC TGCCACTTTGCAGGCGGACGTGACCATCGACCTGCTGTCGGACGACGATG AC------------------ACTCCATCGGCTGGACAGTCCACGGCAGCT GGCCACAATCGCCTCCTGATTCCTGTCCCTAGGCACAGCTTGCACCGAGC ACCCAGAGTGGGCAGAAGACAGGCGCCGCGCAAAGCTGTCATCCACTCAT ACCCCGTGACCGAGAGCATCCTGATAACCAGCGACGACGAGCACAACGAG CAGAAACCCAGCAGCACGCTAAGAGTGCGCTCCCAGCTCTCCATGCGTTC GCCGCCACCACTTGCACCGCTCACACAATCGGAGACCATCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAGCTGCCAGACGCGA GTGTCAGGCCACGCCAAACCCTGTCGAGCATCCACGGTGGCCAGCAATGG GTTCGTCATCGCCGAAGGCGGGGAGGGT------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTGGGCGGGGGCATCACAGCCACTTTG CCGGACGAGACGACCGTTCACACGGTCATCGCCAACCGTATTTATGAACT TTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCAGAAT ACACGCACGAACTGATGCCGGAACAGCTGCAGAAACTGTCGCCGGCATTG CGCGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCTATCTC CCTGAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG ACTGCGAAAGCACCGGTACACATGCCAACGGAGGA---------GACGGC ACCGAACCAGTACACCCTGTCGTGGTCGCTGCAGCGGAGGCGCACGCTGC CGCCAAGCTGCTCAAGCAGCAGCAGCCACAACTCTCGGTGGTGCAACATC TGCAGTATGTGGGCGGCGGACTCGCAACACCAGTGGCTCTGGCCCTTCCG GTGATGGCAGCGAATCCGACCTCGTCCGCTTCCGTCGTTGCCTTGCCGCT GCAGCTGCCGCGACGCCGGAAGCTGGGA---------------------- -------------- >D_erecta_a6-PB ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCCCGGCTGTTCGA CAACCGGCGTCTTAAGCGGCGTCGCGGTCGGTGGATGGAACGCCTGCTCG AGCACCAGCGGATCTGCATGGCACGGATGCGTGTCCAAGCG---ACTCTC GCCTCCAAGACTGACCGGCAGCTGTCCCATCTGCAGCGACGCCATGCGGC TGCCACTCTGCAGGCGGACGTGACCATCGACCTGCTGTCGGACGACGATG AC------------------ACCCCATCGGCCGGACAGTCCACTGCAGCT GGCCACAATCGCCTCCTGATTCCTGCCCCTAGGCACAGCTTGCACCGAGC ACCCAGAGTGGGCAGAAGGCAGGCGCCGCGCAGAACTGCCCCACACTCAC TCGCCGTGACCGAGAGCATCCTGATAACCAGCGACGACGAGCACAACGAG CAGGAACCCTGCAGCACGGCAAGAGTGCGCTCCCAGCTCTCCATGCGCTC GCCGCCACCACTCGCACCGCTTACACCGTCGGAGACCGTCGAAGAGGTAA CTGTTTCGTTGGTGCCGCGCACCTCCACCACTGCCAACTGCCACAAGCTA GTGTCAGGCCACGCCAAGCCCTGTCAAGCGTCCATAGCGGCCAGCAATGG GATCGTCACCGCCGATGGAGGAGAGGGC------------GGCAATGAAA CGGGCTGTTTTCTGGAGGTGGACGTTGGCGGCGGCATCACAGCCACGCTG CCGGACGAGACGACCGTACACACGGTCATAGCCAACCGTATTTACGAACT CTCGCTGAGCAAACTACGCGAAGGCCTGGCCTTTAGTGGAGTGCCGGAAT ACACGCACGACCTGATGCCGGAACAGCTGCAGAAGCTGTCGCCGGCATTG CGAGCCAAAGTGGCGCCCTTGGTGGCTCCCTCGCCGCCCACGCCCATCTC GCTAAAACTGTCCAGCGACCTCAGCATATCACTGATCTCAGACGAAGACG ACTGCGAAAGCACCGGTCCACATGCCAACGGAGGA---------GTCGGC ACCGAGCCAGTGCACCCTGTTGTGGTGGCTGCGGCGGAGGCGCACGCTGC CGCCAAGCTGCTTAAGCAACAGCAGCCACAGCTGTCGGTGGTGCAGCATC TGCAGTACGTGGGCGGCGGACTCGCAGCTCCAGTGGCTCTGGCCCTTCCG GTGATGGCAGCGAATCCGACCTCGTCCGCTTCCGTCGTTGCCTTGCCGCT GCAGCTGCCGCGACGCCGAAAGCTGGGA---------------------- -------------- >D_suzukii_a6-PB ATGAACCAGAGACATTCCGAACCATTCTACATATCGCCGCGGTTGTTCGA CAACAGGCGGCTCAAGCGGCGCCGCTGCCGGTGGATGGAACGCCTGCGGG AGCGCCAGCGGATTTGCATGGCCCAGATGCGCGCACAGGCAACAGTGATC GCCTCCAAGACTGACCGG------------TTGCAGCGGCGCCATGTGGC GGCCACCCTGCCGGCGGACGTGACCATTGACCTGCTGTCGGACGACGATG ACGACGAGCGGGAGGAGGCTGGACCTGGACCTGGACCATCCACTGCCGCT AGCCACAATCGCCTTCTGATACCCGCCCCCTTCGCTGTCGGCCAGCGACG TCCTAGAGTGGGCAGAAGGCAGGGTCGAGGCAGAGTCGGCACCCACTCGC ATCTCTTAACCGAGAGCATCCTGATAACCAGCGACGACGAGTACAACGAC CAGGAAGGCAGCAGCGGGGCCATGGCGCGCCCTCAGCTTTCCATGCGCTC GCCACCGCCCCTTGCACCGCTCACCCTGTCGGAGACCATCGAAGAGGTAA CCGTTTCGCTGGTGCCGCGCAACTCCACCACTGCCAACTGCCAGACGCGA TTGTCCGGCCATCTCAAGCCCTGTCGAGCGTCCACGGCGGCCAGCAACGG GATGGTCATGGCCGGCGGAGGAGGAGGAGACGGTGGCGGTGGCAACGATA CGAGCTGCTTCCTGGAGGTGGACGTAGGCGGTGGCATCACAGCCACGCTG CCGGACGAGACCACCGTGCACACGGTCATCGCCAATCGCATTTACGAGCT CTCGCTGAGCAAACTGCGCGAAGGACTGGCCTTCAGTGGAGCCCCGGAAT ACACGACCGACCTGCTGCCGGAACAGCTGCAGAAACTGTCGCCGGCACTG CGGGCCAAGGTGGCACCGCTGGTGGCCCCCTCGCCGCCCACGCCCATCTC CTTGAAACTGTCTAGCGACCTCAGCATATCACTGATCTCAGACGACGACG ACTGCGAGAGCACCGGCCAACATGCCAACGGAGGAGGAGGAGGAGTCGGT ACCGAGCTGGCGCATCCAGTCGTGGTGGCGGCGGCGGAGGCGCACGCTGC CGCCAAGCTGCTAAAGCAACAGCAGCCGCAGCTCTCGGTGGTGCAGCACC TGCAGTACGTGGGCGGAGGACTAGCTTCACCCGTGGCCCTGGCCCTTCCG GTGATGGCGACT---GCGTCCTCGTCCGCTTCCGTTGTGGCTCTGCCGCT GCAGCTGCCGCGACGCCGGAAGTTGGGA---------------------- --------------
>D_melanogaster_a6-PB MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQV-AL ASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDE------TPSAGQPAAA GHNRLLIPAPG---HRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNE QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR VSGHPKPCRASTAASNGFATAEGGEG----GNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGG---VG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLG >D_sechellia_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRAQA-AL ASKTDRQLSHLQRRHVAATLQADVTIDLLSDDDE------TPSAGQSAAA GHNRLLIPAPG---HRAPRVGRRQAPRRVATHSYPVTDSILITSDDEHSE QEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTR VSGNPKPCRASTAATNGFATAEGGEG----GNETGCFLEVDVGGGITARL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDECESTGPHANGG---VG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLG >D_yakuba_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRAQA-AF ASKTDRQLSQLQRRHVAATLQADVTIDLLSDDDD------TPSAGQSTAA GHNRLLIPVPRHSLHRAPRVGRRQAPRKAVIHSYPVTESILITSDDEHNE QKPSSTLRVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTASCQTR VSGHAKPCRASTVASNGFVIAEGGEG----GNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHELMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGTHANGG---DG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLATPVALALP VMAANPTSSASVVALPLQLPRRRKLG >D_erecta_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRGRWMERLLEHQRICMARMRVQA-TL ASKTDRQLSHLQRRHAAATLQADVTIDLLSDDDD------TPSAGQSTAA GHNRLLIPAPRHSLHRAPRVGRRQAPRRTAPHSLAVTESILITSDDEHNE QEPCSTARVRSQLSMRSPPPLAPLTPSETVEEVTVSLVPRTSTTANCHKL VSGHAKPCQASIAASNGIVTADGGEG----GNETGCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTHDLMPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHANGG---VG TEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALP VMAANPTSSASVVALPLQLPRRRKLG >D_suzukii_a6-PB MNQRHSEPFYISPRLFDNRRLKRRRCRWMERLRERQRICMAQMRAQATVI ASKTDR----LQRRHVAATLPADVTIDLLSDDDDDEREEAGPGPGPSTAA SHNRLLIPAPFAVGQRRPRVGRRQGRGRVGTHSHLLTESILITSDDEYND QEGSSGAMARPQLSMRSPPPLAPLTLSETIEEVTVSLVPRNSTTANCQTR LSGHLKPCRASTAASNGMVMAGGGGGDGGGGNDTSCFLEVDVGGGITATL PDETTVHTVIANRIYELSLSKLREGLAFSGAPEYTTDLLPEQLQKLSPAL RAKVAPLVAPSPPTPISLKLSSDLSISLISDDDDCESTGQHANGGGGGVG TELAHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLASPVALALP VMAT-ASSSASVVALPLQLPRRRKLG
#NEXUS [ID: 9812866637] begin taxa; dimensions ntax=5; taxlabels D_melanogaster_a6-PB D_sechellia_a6-PB D_yakuba_a6-PB D_erecta_a6-PB D_suzukii_a6-PB ; end; begin trees; translate 1 D_melanogaster_a6-PB, 2 D_sechellia_a6-PB, 3 D_yakuba_a6-PB, 4 D_erecta_a6-PB, 5 D_suzukii_a6-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03373908,2:0.01907467,(3:0.04920558,(4:0.03952847,5:0.3122938)0.552:0.007400474)1.000:0.02843193); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03373908,2:0.01907467,(3:0.04920558,(4:0.03952847,5:0.3122938):0.007400474):0.02843193); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3204.57 -3216.25 2 -3204.41 -3214.11 -------------------------------------- TOTAL -3204.49 -3215.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/a6-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.494469 0.002561 0.403878 0.600146 0.491270 1216.45 1315.94 1.000 r(A<->C){all} 0.083829 0.000354 0.048371 0.121392 0.082910 996.28 1047.77 1.001 r(A<->G){all} 0.231472 0.001178 0.162701 0.296255 0.229995 956.33 970.89 1.000 r(A<->T){all} 0.151369 0.001302 0.082303 0.221194 0.151080 732.33 767.44 1.000 r(C<->G){all} 0.042468 0.000107 0.024430 0.063947 0.041758 1152.53 1211.39 1.000 r(C<->T){all} 0.406973 0.001787 0.326939 0.488716 0.405765 806.64 879.70 1.000 r(G<->T){all} 0.083889 0.000510 0.040000 0.127269 0.082406 835.88 1032.41 1.001 pi(A){all} 0.203510 0.000107 0.183611 0.223294 0.203004 1051.92 1130.14 1.000 pi(C){all} 0.335351 0.000151 0.312895 0.360463 0.335100 1201.42 1243.91 1.000 pi(G){all} 0.305221 0.000143 0.282714 0.328476 0.304922 1245.76 1271.23 1.001 pi(T){all} 0.155918 0.000086 0.137952 0.174301 0.155922 1110.77 1145.84 1.000 alpha{1,2} 0.115273 0.002343 0.001491 0.190624 0.118266 1098.98 1151.26 1.000 alpha{3} 2.424566 0.674350 1.011004 4.030355 2.293460 1501.00 1501.00 1.000 pinvar{all} 0.094230 0.004881 0.000167 0.226638 0.080835 1256.74 1344.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/a6-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 5 ls = 404 Codon usage in sequences ---------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 0 | Ser TCT 1 1 0 0 1 | Tyr TAT 0 0 2 0 0 | Cys TGT 3 3 2 2 1 TTC 3 3 4 2 5 | TCC 9 10 11 10 11 | TAC 5 5 3 4 5 | TGC 3 3 3 4 5 Leu TTA 0 0 0 0 1 | TCA 6 5 5 4 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 5 6 6 4 5 | TCG 10 10 10 12 11 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 3 2 5 4 4 | Pro CCT 1 2 4 3 4 | His CAT 5 4 4 4 6 | Arg CGT 3 4 5 4 1 CTC 11 11 7 9 7 | CCC 9 9 8 8 8 | CAC 9 9 10 11 5 | CGC 13 13 11 10 13 CTA 2 2 2 3 2 | CCA 8 8 8 9 4 | Gln CAA 1 1 4 3 2 | CGA 3 5 4 5 5 CTG 22 22 22 24 28 | CCG 17 15 12 14 15 | CAG 18 18 16 16 18 | CGG 9 6 8 7 10 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 2 1 2 2 3 | Thr ACT 4 6 6 7 4 | Asn AAT 3 4 3 3 2 | Ser AGT 1 2 1 1 1 ATC 8 8 10 7 7 | ACC 13 12 10 12 14 | AAC 7 5 5 6 8 | AGC 9 8 10 8 11 ATA 3 4 3 5 4 | ACA 2 2 4 2 1 | Lys AAA 6 4 7 3 3 | Arg AGA 4 5 5 5 4 Met ATG 7 7 7 7 9 | ACG 10 8 9 7 7 | AAG 5 6 5 8 7 | AGG 1 2 1 2 2 ---------------------------------------------------------------------------------------------------------------------- Val GTT 4 4 3 4 2 | Ala GCT 11 9 10 8 5 | Asp GAT 4 1 1 2 2 | Gly GGT 2 1 3 2 3 GTC 6 4 7 6 5 | GCC 16 22 16 19 20 | GAC 14 15 16 16 18 | GGC 12 13 12 13 11 GTA 1 2 2 2 2 | GCA 10 8 9 8 5 | Glu GAA 12 12 13 11 7 | GGA 9 9 6 8 14 GTG 18 19 19 18 17 | GCG 6 8 7 11 12 | GAG 11 12 10 11 11 | GGG 1 1 3 1 2 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_a6-PB position 1: T:0.11881 C:0.33168 A:0.21040 G:0.33911 position 2: T:0.24010 C:0.32921 A:0.24752 G:0.18317 position 3: T:0.12129 C:0.36386 A:0.16584 G:0.34901 Average T:0.16007 C:0.34158 A:0.20792 G:0.29043 #2: D_sechellia_a6-PB position 1: T:0.12129 C:0.32426 A:0.20792 G:0.34653 position 2: T:0.24010 C:0.33416 A:0.23762 G:0.18812 position 3: T:0.11386 C:0.37129 A:0.16584 G:0.34901 Average T:0.15842 C:0.34323 A:0.20380 G:0.29455 #3: D_yakuba_a6-PB position 1: T:0.12129 C:0.32178 A:0.21782 G:0.33911 position 2: T:0.25000 C:0.31931 A:0.24505 G:0.18564 position 3: T:0.13119 C:0.35396 A:0.17822 G:0.33663 Average T:0.16749 C:0.33168 A:0.21370 G:0.28713 #4: D_erecta_a6-PB position 1: T:0.11139 C:0.33168 A:0.21040 G:0.34653 position 2: T:0.24505 C:0.33168 A:0.24257 G:0.18069 position 3: T:0.11881 C:0.35891 A:0.16832 G:0.35396 Average T:0.15842 C:0.34076 A:0.20710 G:0.29373 #5: D_suzukii_a6-PB position 1: T:0.12129 C:0.32673 A:0.21535 G:0.33663 position 2: T:0.25000 C:0.30941 A:0.23267 G:0.20792 position 3: T:0.09653 C:0.37871 A:0.14109 G:0.38366 Average T:0.15594 C:0.33828 A:0.19637 G:0.30941 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 8 | Ser S TCT 3 | Tyr Y TAT 2 | Cys C TGT 11 TTC 17 | TCC 51 | TAC 22 | TGC 18 Leu L TTA 1 | TCA 23 | *** * TAA 0 | *** * TGA 0 TTG 26 | TCG 53 | TAG 0 | Trp W TGG 5 ------------------------------------------------------------------------------ Leu L CTT 18 | Pro P CCT 14 | His H CAT 23 | Arg R CGT 17 CTC 45 | CCC 42 | CAC 44 | CGC 60 CTA 11 | CCA 37 | Gln Q CAA 11 | CGA 22 CTG 118 | CCG 73 | CAG 86 | CGG 40 ------------------------------------------------------------------------------ Ile I ATT 10 | Thr T ACT 27 | Asn N AAT 15 | Ser S AGT 6 ATC 40 | ACC 61 | AAC 31 | AGC 46 ATA 19 | ACA 11 | Lys K AAA 23 | Arg R AGA 23 Met M ATG 37 | ACG 41 | AAG 31 | AGG 8 ------------------------------------------------------------------------------ Val V GTT 17 | Ala A GCT 43 | Asp D GAT 10 | Gly G GGT 11 GTC 28 | GCC 93 | GAC 79 | GGC 61 GTA 9 | GCA 40 | Glu E GAA 55 | GGA 46 GTG 91 | GCG 44 | GAG 55 | GGG 8 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11881 C:0.32723 A:0.21238 G:0.34158 position 2: T:0.24505 C:0.32475 A:0.24109 G:0.18911 position 3: T:0.11634 C:0.36535 A:0.16386 G:0.35446 Average T:0.16007 C:0.33911 A:0.20578 G:0.29505 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_a6-PB D_sechellia_a6-PB 0.2096 (0.0195 0.0932) D_yakuba_a6-PB 0.1824 (0.0395 0.2168) 0.1874 (0.0342 0.1826) D_erecta_a6-PB 0.2337 (0.0420 0.1799) 0.2495 (0.0373 0.1494) 0.2446 (0.0390 0.1595) D_suzukii_a6-PB 0.1860 (0.0913 0.4907) 0.1841 (0.0843 0.4580) 0.1777 (0.0880 0.4952) 0.2068 (0.0903 0.4369) Model 0: one-ratio TREE # 1: (1, 2, (3, (4, 5))); MP score: 276 lnL(ntime: 7 np: 9): -2993.809564 +0.000000 6..1 6..2 6..7 7..3 7..8 8..4 8..5 0.079016 0.043126 0.062316 0.119356 0.018310 0.087278 0.518371 3.074954 0.175272 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.92777 (1: 0.079016, 2: 0.043126, (3: 0.119356, (4: 0.087278, 5: 0.518371): 0.018310): 0.062316); (D_melanogaster_a6-PB: 0.079016, D_sechellia_a6-PB: 0.043126, (D_yakuba_a6-PB: 0.119356, (D_erecta_a6-PB: 0.087278, D_suzukii_a6-PB: 0.518371): 0.018310): 0.062316); Detailed output identifying parameters kappa (ts/tv) = 3.07495 omega (dN/dS) = 0.17527 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.079 890.0 322.0 0.1753 0.0117 0.0668 10.4 21.5 6..2 0.043 890.0 322.0 0.1753 0.0064 0.0365 5.7 11.7 6..7 0.062 890.0 322.0 0.1753 0.0092 0.0527 8.2 17.0 7..3 0.119 890.0 322.0 0.1753 0.0177 0.1009 15.7 32.5 7..8 0.018 890.0 322.0 0.1753 0.0027 0.0155 2.4 5.0 8..4 0.087 890.0 322.0 0.1753 0.0129 0.0738 11.5 23.8 8..5 0.518 890.0 322.0 0.1753 0.0768 0.4382 68.4 141.1 tree length for dN: 0.1374 tree length for dS: 0.7842 Time used: 0:02 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, (3, (4, 5))); MP score: 276 lnL(ntime: 7 np: 10): -2976.742037 +0.000000 6..1 6..2 6..7 7..3 7..8 8..4 8..5 0.080391 0.043717 0.064401 0.121752 0.013310 0.094100 0.567321 3.193030 0.858140 0.073640 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.98499 (1: 0.080391, 2: 0.043717, (3: 0.121752, (4: 0.094100, 5: 0.567321): 0.013310): 0.064401); (D_melanogaster_a6-PB: 0.080391, D_sechellia_a6-PB: 0.043717, (D_yakuba_a6-PB: 0.121752, (D_erecta_a6-PB: 0.094100, D_suzukii_a6-PB: 0.567321): 0.013310): 0.064401); Detailed output identifying parameters kappa (ts/tv) = 3.19303 dN/dS (w) for site classes (K=2) p: 0.85814 0.14186 w: 0.07364 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.080 889.4 322.6 0.2051 0.0132 0.0643 11.7 20.7 6..2 0.044 889.4 322.6 0.2051 0.0072 0.0350 6.4 11.3 6..7 0.064 889.4 322.6 0.2051 0.0106 0.0515 9.4 16.6 7..3 0.122 889.4 322.6 0.2051 0.0200 0.0974 17.8 31.4 7..8 0.013 889.4 322.6 0.2051 0.0022 0.0106 1.9 3.4 8..4 0.094 889.4 322.6 0.2051 0.0154 0.0753 13.7 24.3 8..5 0.567 889.4 322.6 0.2051 0.0931 0.4539 82.8 146.4 Time used: 0:06 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, (3, (4, 5))); MP score: 276 lnL(ntime: 7 np: 12): -2976.726986 +0.000000 6..1 6..2 6..7 7..3 7..8 8..4 8..5 0.080487 0.043788 0.064547 0.121970 0.013048 0.094508 0.569522 3.199325 0.868731 0.000000 0.077328 1.072953 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.98787 (1: 0.080487, 2: 0.043788, (3: 0.121970, (4: 0.094508, 5: 0.569522): 0.013048): 0.064547); (D_melanogaster_a6-PB: 0.080487, D_sechellia_a6-PB: 0.043788, (D_yakuba_a6-PB: 0.121970, (D_erecta_a6-PB: 0.094508, D_suzukii_a6-PB: 0.569522): 0.013048): 0.064547); Detailed output identifying parameters kappa (ts/tv) = 3.19933 dN/dS (w) for site classes (K=3) p: 0.86873 0.00000 0.13127 w: 0.07733 1.00000 1.07295 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.080 889.4 322.6 0.2080 0.0133 0.0641 11.9 20.7 6..2 0.044 889.4 322.6 0.2080 0.0072 0.0349 6.4 11.2 6..7 0.065 889.4 322.6 0.2080 0.0107 0.0514 9.5 16.6 7..3 0.122 889.4 322.6 0.2080 0.0202 0.0971 18.0 31.3 7..8 0.013 889.4 322.6 0.2080 0.0022 0.0104 1.9 3.3 8..4 0.095 889.4 322.6 0.2080 0.0156 0.0752 13.9 24.3 8..5 0.570 889.4 322.6 0.2080 0.0943 0.4533 83.9 146.2 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_a6-PB) Pr(w>1) post mean +- SE for w 26 C 0.934 1.007 45 D 0.861 0.934 48 A 0.902 0.976 49 L 0.856 0.930 80 T 0.878 0.951 82 S 0.907 0.980 100 G 0.999** 1.072 103 A 0.933 1.006 106 T 0.815 0.889 115 A 0.993** 1.066 116 A 0.861 0.934 117 T 0.824 0.898 120 Y 0.945 1.018 121 P 0.834 0.908 139 P 0.883 0.956 142 T 0.849 0.923 143 A 0.899 0.972 144 R 0.563 0.638 162 Q 0.890 0.963 184 L 0.860 0.933 186 R 0.521 0.596 191 P 0.986* 1.059 195 R 0.524 0.599 204 F 0.894 0.967 206 T 0.884 0.958 208 E 0.937 1.010 268 N 0.990** 1.063 322 P 0.934 1.007 372 A 0.938 1.011 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_a6-PB) Pr(w>1) post mean +- SE for w 100 G 0.536 1.424 +- 0.613 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.968 0.032 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.826 0.138 0.027 0.006 0.002 0.001 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011 0.749 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.027 0.178 0.031 sum of density on p0-p1 = 1.000000 Time used: 0:38 Model 3: discrete (3 categories) TREE # 1: (1, 2, (3, (4, 5))); MP score: 276 lnL(ntime: 7 np: 13): -2976.726986 +0.000000 6..1 6..2 6..7 7..3 7..8 8..4 8..5 0.080487 0.043788 0.064547 0.121970 0.013048 0.094508 0.569522 3.199325 0.329434 0.539297 0.077328 0.077329 1.072953 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.98787 (1: 0.080487, 2: 0.043788, (3: 0.121970, (4: 0.094508, 5: 0.569522): 0.013048): 0.064547); (D_melanogaster_a6-PB: 0.080487, D_sechellia_a6-PB: 0.043788, (D_yakuba_a6-PB: 0.121970, (D_erecta_a6-PB: 0.094508, D_suzukii_a6-PB: 0.569522): 0.013048): 0.064547); Detailed output identifying parameters kappa (ts/tv) = 3.19932 dN/dS (w) for site classes (K=3) p: 0.32943 0.53930 0.13127 w: 0.07733 0.07733 1.07295 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.080 889.4 322.6 0.2080 0.0133 0.0641 11.9 20.7 6..2 0.044 889.4 322.6 0.2080 0.0072 0.0349 6.4 11.2 6..7 0.065 889.4 322.6 0.2080 0.0107 0.0514 9.5 16.6 7..3 0.122 889.4 322.6 0.2080 0.0202 0.0971 18.0 31.3 7..8 0.013 889.4 322.6 0.2080 0.0022 0.0104 1.9 3.3 8..4 0.095 889.4 322.6 0.2080 0.0156 0.0752 13.9 24.3 8..5 0.570 889.4 322.6 0.2080 0.0943 0.4533 83.9 146.2 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_a6-PB) Pr(w>1) post mean +- SE for w 26 C 0.934 1.007 45 D 0.861 0.934 48 A 0.902 0.976 49 L 0.856 0.930 80 T 0.878 0.951 82 S 0.907 0.980 100 G 0.999** 1.072 103 A 0.933 1.006 106 T 0.815 0.889 115 A 0.993** 1.066 116 A 0.861 0.934 117 T 0.824 0.898 120 Y 0.945 1.018 121 P 0.834 0.908 139 P 0.883 0.956 142 T 0.849 0.923 143 A 0.899 0.972 144 R 0.563 0.638 162 Q 0.890 0.963 184 L 0.860 0.933 186 R 0.521 0.596 191 P 0.986* 1.059 195 R 0.524 0.599 204 F 0.894 0.967 206 T 0.884 0.958 208 E 0.937 1.010 268 N 0.990** 1.063 322 P 0.934 1.007 372 A 0.938 1.011 Time used: 0:47 Model 7: beta (10 categories) TREE # 1: (1, 2, (3, (4, 5))); MP score: 276 lnL(ntime: 7 np: 10): -2977.367252 +0.000000 6..1 6..2 6..7 7..3 7..8 8..4 8..5 0.080010 0.043371 0.063651 0.120791 0.015130 0.091656 0.556860 3.173961 0.203037 0.819456 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.97147 (1: 0.080010, 2: 0.043371, (3: 0.120791, (4: 0.091656, 5: 0.556860): 0.015130): 0.063651); (D_melanogaster_a6-PB: 0.080010, D_sechellia_a6-PB: 0.043371, (D_yakuba_a6-PB: 0.120791, (D_erecta_a6-PB: 0.091656, D_suzukii_a6-PB: 0.556860): 0.015130): 0.063651); Detailed output identifying parameters kappa (ts/tv) = 3.17396 Parameters in M7 (beta): p = 0.20304 q = 0.81946 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00012 0.00146 0.00763 0.02622 0.06998 0.15711 0.30947 0.54554 0.85720 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.080 889.5 322.5 0.1975 0.0128 0.0649 11.4 20.9 6..2 0.043 889.5 322.5 0.1975 0.0069 0.0352 6.2 11.3 6..7 0.064 889.5 322.5 0.1975 0.0102 0.0516 9.1 16.6 7..3 0.121 889.5 322.5 0.1975 0.0193 0.0980 17.2 31.6 7..8 0.015 889.5 322.5 0.1975 0.0024 0.0123 2.2 4.0 8..4 0.092 889.5 322.5 0.1975 0.0147 0.0743 13.1 24.0 8..5 0.557 889.5 322.5 0.1975 0.0892 0.4516 79.3 145.6 Time used: 1:00 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, (3, (4, 5))); MP score: 276 lnL(ntime: 7 np: 12): -2976.732429 +0.000000 6..1 6..2 6..7 7..3 7..8 8..4 8..5 0.080607 0.043897 0.064643 0.122097 0.013171 0.094542 0.569806 3.201153 0.872521 8.585384 99.000000 1.089124 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.98876 (1: 0.080607, 2: 0.043897, (3: 0.122097, (4: 0.094542, 5: 0.569806): 0.013171): 0.064643); (D_melanogaster_a6-PB: 0.080607, D_sechellia_a6-PB: 0.043897, (D_yakuba_a6-PB: 0.122097, (D_erecta_a6-PB: 0.094542, D_suzukii_a6-PB: 0.569806): 0.013171): 0.064643); Detailed output identifying parameters kappa (ts/tv) = 3.20115 Parameters in M8 (beta&w>1): p0 = 0.87252 p = 8.58538 q = 99.00000 (p1 = 0.12748) w = 1.08912 dN/dS (w) for site classes (K=11) p: 0.08725 0.08725 0.08725 0.08725 0.08725 0.08725 0.08725 0.08725 0.08725 0.08725 0.12748 w: 0.04189 0.05334 0.06104 0.06768 0.07401 0.08048 0.08750 0.09575 0.10669 0.12659 1.08912 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.081 889.4 322.6 0.2082 0.0134 0.0641 11.9 20.7 6..2 0.044 889.4 322.6 0.2082 0.0073 0.0349 6.5 11.3 6..7 0.065 889.4 322.6 0.2082 0.0107 0.0514 9.5 16.6 7..3 0.122 889.4 322.6 0.2082 0.0202 0.0971 18.0 31.3 7..8 0.013 889.4 322.6 0.2082 0.0022 0.0105 1.9 3.4 8..4 0.095 889.4 322.6 0.2082 0.0157 0.0752 13.9 24.3 8..5 0.570 889.4 322.6 0.2082 0.0944 0.4534 84.0 146.3 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_a6-PB) Pr(w>1) post mean +- SE for w 26 C 0.924 1.013 45 D 0.843 0.932 48 A 0.889 0.978 49 L 0.837 0.927 80 T 0.861 0.951 82 S 0.894 0.983 100 G 0.998** 1.087 103 A 0.923 1.012 106 T 0.793 0.883 115 A 0.990** 1.080 116 A 0.842 0.932 117 T 0.803 0.893 120 Y 0.935 1.025 121 P 0.813 0.903 139 P 0.866 0.956 142 T 0.829 0.919 143 A 0.885 0.974 144 R 0.550 0.638 162 Q 0.875 0.964 184 L 0.841 0.931 186 R 0.508 0.596 191 P 0.981* 1.070 195 R 0.511 0.599 204 F 0.878 0.968 206 T 0.868 0.957 208 E 0.927 1.017 268 N 0.987* 1.076 322 P 0.924 1.014 372 A 0.929 1.018 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_a6-PB) Pr(w>1) post mean +- SE for w 26 C 0.542 1.207 +- 0.677 100 G 0.813 1.535 +- 0.564 103 A 0.541 1.205 +- 0.676 115 A 0.714 1.430 +- 0.618 120 Y 0.539 1.202 +- 0.660 191 P 0.577 1.263 +- 0.627 208 E 0.512 1.165 +- 0.657 268 N 0.634 1.332 +- 0.621 322 P 0.540 1.204 +- 0.674 372 A 0.556 1.226 +- 0.676 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.010 0.990 p : 0.701 0.299 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.039 0.224 0.218 0.119 0.059 0.055 0.105 0.181 ws: 0.827 0.158 0.013 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:45
Model 1: NearlyNeutral -2976.742037 Model 2: PositiveSelection -2976.726986 Model 0: one-ratio -2993.809564 Model 3: discrete -2976.726986 Model 7: beta -2977.367252 Model 8: beta&w>1 -2976.732429 Model 0 vs 1 34.13505400000031 Model 2 vs 1 0.03010199999971519 Model 8 vs 7 1.2696459999997387