--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 22:33:31 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/a5-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2201.90 -2213.60
2 -2201.35 -2213.73
--------------------------------------
TOTAL -2201.59 -2213.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.040635 0.011452 0.840110 1.246018 1.033238 1372.71 1436.86 1.000
r(A<->C){all} 0.101926 0.000595 0.055820 0.149099 0.100420 877.08 911.30 1.000
r(A<->G){all} 0.194201 0.001132 0.134537 0.264303 0.192478 967.17 1008.60 1.000
r(A<->T){all} 0.057923 0.000319 0.025407 0.093423 0.055980 1070.98 1126.08 1.000
r(C<->G){all} 0.118431 0.000568 0.074782 0.165582 0.117221 1016.93 1045.20 1.000
r(C<->T){all} 0.482484 0.002146 0.393977 0.574789 0.482622 572.70 760.02 1.000
r(G<->T){all} 0.045036 0.000219 0.018194 0.074494 0.043798 1111.89 1188.38 1.000
pi(A){all} 0.270153 0.000268 0.241047 0.304931 0.270064 1182.04 1213.37 1.001
pi(C){all} 0.205427 0.000196 0.180047 0.233705 0.205243 1215.79 1228.38 1.000
pi(G){all} 0.266255 0.000260 0.235363 0.297851 0.266014 874.08 879.19 1.000
pi(T){all} 0.258166 0.000238 0.228124 0.288573 0.257535 761.97 957.31 1.000
alpha{1,2} 0.144688 0.000617 0.099034 0.195907 0.142201 1254.30 1288.64 1.000
alpha{3} 2.647721 0.749523 1.149993 4.329523 2.529012 1370.19 1410.54 1.000
pinvar{all} 0.206694 0.004824 0.066039 0.338086 0.209481 1267.55 1284.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2063.616043
Model 2: PositiveSelection -2063.616045
Model 0: one-ratio -2075.259669
Model 3: discrete -2057.33257
Model 7: beta -2057.836061
Model 8: beta&w>1 -2057.836428
Model 0 vs 1 23.28725200000008
Model 2 vs 1 4.000000444648322E-6
Model 8 vs 7 7.340000001931912E-4
>C1
MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C2
MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C3
MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C4
MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C5
MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
LMKTLYGVSE
>C6
MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C7
MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVNE
>C8
MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVDE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=210
C1 MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
C2 MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
C3 MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
C4 MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
C5 MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
C6 MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
C7 MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
C8 MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
** :** : * ***:.::******** * *:**:***.:***:
C1 KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C2 KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C3 KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C4 KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C5 KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C6 KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
C7 KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
C8 KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
**:**:******:***.***************:****:*********:**
C1 MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
C2 MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
C3 MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
C4 MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
C5 MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
C6 MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
C7 MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
C8 MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
************:****:*****:*:******.**** ****:***:***
C1 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
C2 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
C3 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
C4 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
C5 KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
C6 KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
C7 KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
C8 KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
********:************* **:******.*****:*********.*
C1 LMKTLYGVSE
C2 LMKTLYGVSE
C3 LMKTLYGVSE
C4 LMKTLYGVSE
C5 LMKTLYGVSE
C6 LMKTLYGVSE
C7 LMKTLYGVNE
C8 LMKTLYGVDE
********.*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 210 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 210 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [11760]--->[11760]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/a5-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.431 Mb, Max= 30.801 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C2
MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C3
MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C4
MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C5
MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
LMKTLYGVSE
>C6
MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C7
MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVNE
>C8
MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVDE
CLUSTAL W (1.83) multiple sequence alignment
C1 MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
C2 MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
C3 MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
C4 MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
C5 MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
C6 MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
C7 MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
C8 MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
** :** : * ***:.::******** * *:**:***.:***:
C1 KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C2 KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C3 KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C4 KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C5 KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
C6 KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
C7 KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
C8 KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
**:**:******:***.***************:****:*********:**
C1 MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
C2 MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
C3 MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
C4 MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
C5 MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
C6 MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
C7 MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
C8 MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
************:****:*****:*:******.**** ****:***:***
C1 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
C2 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
C3 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
C4 KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
C5 KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
C6 KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
C7 KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
C8 KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
********:************* **:******.*****:*********.*
C1 LMKTLYGVSE
C2 LMKTLYGVSE
C3 LMKTLYGVSE
C4 LMKTLYGVSE
C5 LMKTLYGVSE
C6 LMKTLYGVSE
C7 LMKTLYGVNE
C8 LMKTLYGVDE
********.*
>C1
MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C2
MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C3
MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C4
MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C5
MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
LMKTLYGVSE
>C6
MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C7
MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVNE
>C8
MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVDE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:210 S:100 BS:210
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES
BOT 0 1 98.57 C1 C2 98.57
TOP 1 0 98.57 C2 C1 98.57
BOT 0 2 99.05 C1 C3 99.05
TOP 2 0 99.05 C3 C1 99.05
BOT 0 3 95.71 C1 C4 95.71
TOP 3 0 95.71 C4 C1 95.71
BOT 0 4 92.86 C1 C5 92.86
TOP 4 0 92.86 C5 C1 92.86
BOT 0 5 91.90 C1 C6 91.90
TOP 5 0 91.90 C6 C1 91.90
BOT 0 6 88.57 C1 C7 88.57
TOP 6 0 88.57 C7 C1 88.57
BOT 0 7 90.95 C1 C8 90.95
TOP 7 0 90.95 C8 C1 90.95
BOT 1 2 98.57 C2 C3 98.57
TOP 2 1 98.57 C3 C2 98.57
BOT 1 3 95.24 C2 C4 95.24
TOP 3 1 95.24 C4 C2 95.24
BOT 1 4 92.38 C2 C5 92.38
TOP 4 1 92.38 C5 C2 92.38
BOT 1 5 92.38 C2 C6 92.38
TOP 5 1 92.38 C6 C2 92.38
BOT 1 6 88.57 C2 C7 88.57
TOP 6 1 88.57 C7 C2 88.57
BOT 1 7 90.48 C2 C8 90.48
TOP 7 1 90.48 C8 C2 90.48
BOT 2 3 95.71 C3 C4 95.71
TOP 3 2 95.71 C4 C3 95.71
BOT 2 4 92.86 C3 C5 92.86
TOP 4 2 92.86 C5 C3 92.86
BOT 2 5 91.90 C3 C6 91.90
TOP 5 2 91.90 C6 C3 91.90
BOT 2 6 89.05 C3 C7 89.05
TOP 6 2 89.05 C7 C3 89.05
BOT 2 7 91.43 C3 C8 91.43
TOP 7 2 91.43 C8 C3 91.43
BOT 3 4 92.86 C4 C5 92.86
TOP 4 3 92.86 C5 C4 92.86
BOT 3 5 89.52 C4 C6 89.52
TOP 5 3 89.52 C6 C4 89.52
BOT 3 6 86.19 C4 C7 86.19
TOP 6 3 86.19 C7 C4 86.19
BOT 3 7 88.57 C4 C8 88.57
TOP 7 3 88.57 C8 C4 88.57
BOT 4 5 88.10 C5 C6 88.10
TOP 5 4 88.10 C6 C5 88.10
BOT 4 6 85.71 C5 C7 85.71
TOP 6 4 85.71 C7 C5 85.71
BOT 4 7 87.14 C5 C8 87.14
TOP 7 4 87.14 C8 C5 87.14
BOT 5 6 90.95 C6 C7 90.95
TOP 6 5 90.95 C7 C6 90.95
BOT 5 7 91.43 C6 C8 91.43
TOP 7 5 91.43 C8 C6 91.43
BOT 6 7 89.52 C7 C8 89.52
TOP 7 6 89.52 C8 C7 89.52
AVG 0 C1 * 93.95
AVG 1 C2 * 93.74
AVG 2 C3 * 94.08
AVG 3 C4 * 91.97
AVG 4 C5 * 90.27
AVG 5 C6 * 90.88
AVG 6 C7 * 88.37
AVG 7 C8 * 89.93
TOT TOT * 91.65
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAAATTGCCTGCATTGCATTTGTTATTCCTGGGCTTTATTTGCCTGGC
C2 ATGAAATGGCTTGCATTGCATTTGTTATTCCTGGGCTTTATTTGCCTAGC
C3 ATGAAATTGCTTGCATTGCATTTGTTATTCCTCGGGTTTATTTGCCTGGC
C4 ATGAAATTGCTCGCTTTGCATTTGTTATTCCTGTGCTTTGTGGGCCTGGC
C5 ATGAAATTGCTTGCATTGCATTTGTTATTCCTGGCTTCCATTTGCCTCGT
C6 ATGAAATTGCTGGTCTGTCATTTGCTATTCCTGGGCTTTATTTGCCTAGG
C7 ATGAAATTGATAGTATGTCATTGGATATTCCTGGGCTTTATTTGCCTAAG
C8 ATGAAATTGCATGGGTTACTTTTGCTATTCCTGGGCTTCATTTGCCTGAG
******* *. * * *:** * ******* * .* **** .
C1 TCGCAGCCAGGATAACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG
C2 TCGCAGCCAGGATGACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG
C3 TCGCAGCCAGGATAACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG
C4 TTGCAGTCAGGATAATGACGAGAATGTCAGAAGGATAATGAAAGAAATGG
C5 TCGCAGTCAGGACAACGACGAGGATGTCCGGAGGATCATGAAGGAAATGG
C6 TCGCAGTCAGGACGATAGCGAGAATGTCAGAAGGATAATGAAGGAAATGG
C7 TCGAAGTCAGGACGACAATGATAATGTTAGAAGGATAATGAAGGAAATGG
C8 TCGCAGTCAGGACGAAAATGAGAATGTTCGCAGGATAATGAAGGAAATGG
* *.** ***** .* .. ** .**** .* *****.*****.*******
C1 AGGTGATCCCAGAAATTTTGGATGAGCCTCCGAGGGAGTTACTTAGGATC
C2 AGGTGATCCCCGAAATTTTGGACGAGCCTCCGAGGGAGTTACTCAGGATC
C3 AGGTGATCCCCGAAATTTTGGACGAGCCTCCGAGGGAGTTACTCAGGATC
C4 CGGTGATACCCGAAATTTTGGACGAGCCTCCGAGGGAGTTGCTTAGGATC
C5 CGGTGATCCCCGACATTCTGGACGAGCCCCCGAGGCAGTTGCTTAGGGTC
C6 AGGTGATCCCGGAAATTTTAGACGAGCCTCCCAGGGAATTACTTAGGATA
C7 AGGTAACCCCAGATATCTTAGAGGAGCCTCCAAGGGAGTTACTTAGGATA
C8 AGGTGATCCCTGAAATTTTAGATGAACCGCCCAACGAATTACTCAGGATT
.***.* .** ** ** *.** **.** ** *. *.**.** ***.*
C1 AAGTACGACAACACCATTGACATAGAGGAGGGCAAGACCTATACTCCGAC
C2 AAGTACGACAACACCATTGACATCGAGGAGGGCAAGACCTATACTCCGAC
C3 AAGTACGACAACACCATTGACATCGAGGAGGGCAAGACCTATACTCCGAC
C4 AAGTACGACAACACCTTCGATATAGAGGAGGGCAAGACCTATACTCCCAC
C5 AAGTACGACAACACCTTTGATATCGAGGAGGGCAAGACCTATACTCCCAC
C6 AAATATGACAACACCTTTGACATTGAGGAGGGCAAGTCCTATACTCCGAG
C7 AAATATGAGAACACCTTTGACATTGAGGAGGGCAAGACCTATACTCCTAC
C8 AAATATGACAACACCTTTGACATCGAAGAGGGCAAGTCCTATACTCCAAA
**.** ** ******:* ** ** **.*********:********** *
C1 GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT
C2 GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT
C3 GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT
C4 GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAATGCGGATCCCGAGTCCT
C5 GGAGCTGAAGTTCCAGCCGCGACTCGACTGGAATGCGGATCCCGAGTCCT
C6 TGAGCTCAAGTTCCAACCCAGGCTCGATTGGAATGCGGATCCCGAGTCCT
C7 AGAGCTGAAATTCCAACCCAGACTGGATTGGAATGCGGATCCTGAGTCCT
C8 AGAACTTAAATTCCAACCCAGACTTGATTGGAACGCGGATCCTGAGACAT
**.** **.*****.** .*.** ** ***** ******** ***:*.*
C1 TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAACCGAGAGAATCCC
C2 TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAATCGAGAGAATCCC
C3 TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAACCGAGAGAATCCC
C4 TCTACACCGTGCTCATGATTTGTCCCGATGCTCCGAACCGAGAGAATCCC
C5 TCTACACCGTGCTCATGATTTGTCCCGATGCGCCGAACCGGGAGAATCCC
C6 TTTACACCGTGGTAATGATTTGTCCCGATGCTCCGAATCGCGATAATCCC
C7 TTTACACGGTGGTTATGATCTGCCCCGATGCTCCGAATCGTGAGAATCCG
C8 TTTACACTGTGGTTATGATTTGTCCCGATGCTCCGAATCGTGAGAATCCC
* ***** *** * ***** ** ******** ***** ** ** *****
C1 ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
C2 ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
C3 ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
C4 ATGTACCGCTCCTGGCTGCATTGGCTGGTGGTCAATGTTCCCGGACTGGA
C5 ATGTACCGCTCCTGGCTCCACTGGCTGGTGGTCAATGTACCCGGATTGGA
C6 ATGTATCGCTCCTGGCTCCACTGGTTGGTGGTCAATATTCCCGGATTGGA
C7 ATGTATCGTTCTTGGCTTCATTGGTTGGTTGTCAATATCCCCGGTTTGGA
C8 ATGTACCGATCCTGGCTTCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
***** ** ** ***** ** *** **** ******.* *****: ****
C1 TATTATGAAGGGGCAACCGATATCGGAGTACTTCGGTCCTCTGCCTCCAA
C2 TATAATGAAGGGGCAGCCCATATCGGAGTACTTCGGTCCCCTGCCTCCAA
C3 TATAATGAAGGGGCAGCCGATATCGGACTACTTCGGTCCCCTGCCTCCAA
C4 CATAATGAAGGGCCAACCGATATCGGAGTACTTCGGTCCCCTACCGACCA
C5 CGTAATGAAGGGCCAGCCGATATCGGAGTACTTCGGCCCACTGCCTCCAA
C6 TATAATGAAGGGTCAACCGATTTCGGAATACTTTGGTCCTCTTCCGCCAA
C7 TATAATGAAGGGTCAACCGGTATCGGATTACTTTGGTCCTTTACCACCAA
C8 TATAATGAAGGGTCAACCCATATCGGATTACTTTGGTCCTCTGCCACCAA
.*:******** **.** .*:***** ***** ** ** * ** .*.*
C1 AGGATAGTGGTATTCAGCGGTATCTTATTCTTGTGTATCAGCAATCTGAT
C2 AGGATAGTGGCATTCAGCGGTATCTAATTCTGGTGTATCAGCAATCCGAT
C3 AGGATAGTGGCATTCAGCGGTATCTTATTCTGGTGTATCAGCAATCCGAT
C4 AGGATAGTGGCATTCAGCGATATCTTATTCTGGTGTATCAGCAGTCCGAC
C5 AGGATAGTGGCATTCAGCGCTATCTTATTCTGGTGTATCAGCAGTCCGAC
C6 AGGACAGTGGAGTCCAGCGGTATCTCCTTCTCGTGTATCAGCAGTCGGAT
C7 AAGATAGTGGAACTCAGCGTTATCTTATTCTGGTGTATCAGCAATCGGAT
C8 AAGACAGTGGAGTTCAGCGCTATCTTATTCTGGTCTATCGGCAATCGGAT
*.** ***** . ***** ***** .**** ** ****.***.** **
C1 AAGCTGGACTTTGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA
C2 AAGCTGGACTTCGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA
C3 AAGCTGGACTTCGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA
C4 AAACTGGACTTCGACGAGAAGAAAATGGAGCTGAGCAATGCCGACGGTCA
C5 AAACTGGACTTCGACGAGAAGAAAATGGAGCTGAGCAACGCCGATGGTCA
C6 AAACTGGACTTCGATGAGAAGAAAATCGAGCTAAGCAATGCCGATGGTCA
C7 AAACTGGATTTCGATGAGAAGAAAATCGAACTGAGCAATGCCGATGGTCA
C8 AAACTGGATTTTGATGAGAAGAAGATAGAGCTAAGTAATGCCGATGGTCA
**.***** ** ** ********.** **.** ** ** ***** *****
C1 TAGTAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCAC
C2 TAGCAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCTC
C3 CAGCAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCTC
C4 TAGCAACTTTGACGTGATGAAGTTCACCCAGAAGTATGAGATGGGCCCTC
C5 CAGCAATTTCGACGTGATGAAGTTCGCCCAGAAATACGAGATGGGCCCTC
C6 TAGCAATTTTGATGTCAAGAAATTCGCGCAGAAATATGAAATGGGATCGC
C7 TAGCAATTTCGATGTAAAGAAATTTGCGCAGAAATATGAAATGGGAACTC
C8 TAGCAATTTTGATGTGATGAAGTTTGCCCAGAAGTACGAAATGGGAACTC
** ** ** ** ** *:***.** .* *****.** **.*****. * *
C1 CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG
C2 CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG
C3 CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG
C4 CAGTGGCCGGTAATATTTTTCAGTCCAGGTGGGATGAGTATGTGCCCGAG
C5 CAGTGGCGGGAAATGTGTTCCAGTCCAGGTGGGATGAGTACGTGTCCGAG
C6 CCGTGGCGGGAAATATATTCCAATCCCGGTGGGATGAATATGTGCCGGAA
C7 CGGTGGCAGGAAATATATTCCAATCCAGGTGGGATGAATATGTGCCGGAA
C8 CAGTGGCGGGAAATATATTCCAATCCAGGTGGGATGAATATGTTCCGGAG
* ***** **:***.* ** **.***.**********.** ** * **.
C1 TTGATGAAGACACTGTATGGTGTCAGTGAG
C2 TTAATGAAGACACTCTATGGCGTCAGTGAG
C3 TTGATGAAGACACTCTATGGCGTCAGTGAG
C4 TTGATGAAGACACTCTATGGTGTCAGTGAG
C5 CTGATGAAGACACTCTATGGTGTCAGTGAG
C6 CTGATGAAGACACTCTATGGTGTCAGCGAG
C7 CTGATGAAGACACTCTATGGAGTCAATGAG
C8 TTGATGAAGACACTCTATGGTGTTGATGAG
*.*********** ***** ** .. ***
>C1
ATGAAATTGCCTGCATTGCATTTGTTATTCCTGGGCTTTATTTGCCTGGC
TCGCAGCCAGGATAACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG
AGGTGATCCCAGAAATTTTGGATGAGCCTCCGAGGGAGTTACTTAGGATC
AAGTACGACAACACCATTGACATAGAGGAGGGCAAGACCTATACTCCGAC
GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT
TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAACCGAGAGAATCCC
ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
TATTATGAAGGGGCAACCGATATCGGAGTACTTCGGTCCTCTGCCTCCAA
AGGATAGTGGTATTCAGCGGTATCTTATTCTTGTGTATCAGCAATCTGAT
AAGCTGGACTTTGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA
TAGTAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCAC
CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG
TTGATGAAGACACTGTATGGTGTCAGTGAG
>C2
ATGAAATGGCTTGCATTGCATTTGTTATTCCTGGGCTTTATTTGCCTAGC
TCGCAGCCAGGATGACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG
AGGTGATCCCCGAAATTTTGGACGAGCCTCCGAGGGAGTTACTCAGGATC
AAGTACGACAACACCATTGACATCGAGGAGGGCAAGACCTATACTCCGAC
GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT
TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAATCGAGAGAATCCC
ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
TATAATGAAGGGGCAGCCCATATCGGAGTACTTCGGTCCCCTGCCTCCAA
AGGATAGTGGCATTCAGCGGTATCTAATTCTGGTGTATCAGCAATCCGAT
AAGCTGGACTTCGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA
TAGCAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCTC
CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG
TTAATGAAGACACTCTATGGCGTCAGTGAG
>C3
ATGAAATTGCTTGCATTGCATTTGTTATTCCTCGGGTTTATTTGCCTGGC
TCGCAGCCAGGATAACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG
AGGTGATCCCCGAAATTTTGGACGAGCCTCCGAGGGAGTTACTCAGGATC
AAGTACGACAACACCATTGACATCGAGGAGGGCAAGACCTATACTCCGAC
GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT
TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAACCGAGAGAATCCC
ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
TATAATGAAGGGGCAGCCGATATCGGACTACTTCGGTCCCCTGCCTCCAA
AGGATAGTGGCATTCAGCGGTATCTTATTCTGGTGTATCAGCAATCCGAT
AAGCTGGACTTCGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA
CAGCAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCTC
CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG
TTGATGAAGACACTCTATGGCGTCAGTGAG
>C4
ATGAAATTGCTCGCTTTGCATTTGTTATTCCTGTGCTTTGTGGGCCTGGC
TTGCAGTCAGGATAATGACGAGAATGTCAGAAGGATAATGAAAGAAATGG
CGGTGATACCCGAAATTTTGGACGAGCCTCCGAGGGAGTTGCTTAGGATC
AAGTACGACAACACCTTCGATATAGAGGAGGGCAAGACCTATACTCCCAC
GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAATGCGGATCCCGAGTCCT
TCTACACCGTGCTCATGATTTGTCCCGATGCTCCGAACCGAGAGAATCCC
ATGTACCGCTCCTGGCTGCATTGGCTGGTGGTCAATGTTCCCGGACTGGA
CATAATGAAGGGCCAACCGATATCGGAGTACTTCGGTCCCCTACCGACCA
AGGATAGTGGCATTCAGCGATATCTTATTCTGGTGTATCAGCAGTCCGAC
AAACTGGACTTCGACGAGAAGAAAATGGAGCTGAGCAATGCCGACGGTCA
TAGCAACTTTGACGTGATGAAGTTCACCCAGAAGTATGAGATGGGCCCTC
CAGTGGCCGGTAATATTTTTCAGTCCAGGTGGGATGAGTATGTGCCCGAG
TTGATGAAGACACTCTATGGTGTCAGTGAG
>C5
ATGAAATTGCTTGCATTGCATTTGTTATTCCTGGCTTCCATTTGCCTCGT
TCGCAGTCAGGACAACGACGAGGATGTCCGGAGGATCATGAAGGAAATGG
CGGTGATCCCCGACATTCTGGACGAGCCCCCGAGGCAGTTGCTTAGGGTC
AAGTACGACAACACCTTTGATATCGAGGAGGGCAAGACCTATACTCCCAC
GGAGCTGAAGTTCCAGCCGCGACTCGACTGGAATGCGGATCCCGAGTCCT
TCTACACCGTGCTCATGATTTGTCCCGATGCGCCGAACCGGGAGAATCCC
ATGTACCGCTCCTGGCTCCACTGGCTGGTGGTCAATGTACCCGGATTGGA
CGTAATGAAGGGCCAGCCGATATCGGAGTACTTCGGCCCACTGCCTCCAA
AGGATAGTGGCATTCAGCGCTATCTTATTCTGGTGTATCAGCAGTCCGAC
AAACTGGACTTCGACGAGAAGAAAATGGAGCTGAGCAACGCCGATGGTCA
CAGCAATTTCGACGTGATGAAGTTCGCCCAGAAATACGAGATGGGCCCTC
CAGTGGCGGGAAATGTGTTCCAGTCCAGGTGGGATGAGTACGTGTCCGAG
CTGATGAAGACACTCTATGGTGTCAGTGAG
>C6
ATGAAATTGCTGGTCTGTCATTTGCTATTCCTGGGCTTTATTTGCCTAGG
TCGCAGTCAGGACGATAGCGAGAATGTCAGAAGGATAATGAAGGAAATGG
AGGTGATCCCGGAAATTTTAGACGAGCCTCCCAGGGAATTACTTAGGATA
AAATATGACAACACCTTTGACATTGAGGAGGGCAAGTCCTATACTCCGAG
TGAGCTCAAGTTCCAACCCAGGCTCGATTGGAATGCGGATCCCGAGTCCT
TTTACACCGTGGTAATGATTTGTCCCGATGCTCCGAATCGCGATAATCCC
ATGTATCGCTCCTGGCTCCACTGGTTGGTGGTCAATATTCCCGGATTGGA
TATAATGAAGGGTCAACCGATTTCGGAATACTTTGGTCCTCTTCCGCCAA
AGGACAGTGGAGTCCAGCGGTATCTCCTTCTCGTGTATCAGCAGTCGGAT
AAACTGGACTTCGATGAGAAGAAAATCGAGCTAAGCAATGCCGATGGTCA
TAGCAATTTTGATGTCAAGAAATTCGCGCAGAAATATGAAATGGGATCGC
CCGTGGCGGGAAATATATTCCAATCCCGGTGGGATGAATATGTGCCGGAA
CTGATGAAGACACTCTATGGTGTCAGCGAG
>C7
ATGAAATTGATAGTATGTCATTGGATATTCCTGGGCTTTATTTGCCTAAG
TCGAAGTCAGGACGACAATGATAATGTTAGAAGGATAATGAAGGAAATGG
AGGTAACCCCAGATATCTTAGAGGAGCCTCCAAGGGAGTTACTTAGGATA
AAATATGAGAACACCTTTGACATTGAGGAGGGCAAGACCTATACTCCTAC
AGAGCTGAAATTCCAACCCAGACTGGATTGGAATGCGGATCCTGAGTCCT
TTTACACGGTGGTTATGATCTGCCCCGATGCTCCGAATCGTGAGAATCCG
ATGTATCGTTCTTGGCTTCATTGGTTGGTTGTCAATATCCCCGGTTTGGA
TATAATGAAGGGTCAACCGGTATCGGATTACTTTGGTCCTTTACCACCAA
AAGATAGTGGAACTCAGCGTTATCTTATTCTGGTGTATCAGCAATCGGAT
AAACTGGATTTCGATGAGAAGAAAATCGAACTGAGCAATGCCGATGGTCA
TAGCAATTTCGATGTAAAGAAATTTGCGCAGAAATATGAAATGGGAACTC
CGGTGGCAGGAAATATATTCCAATCCAGGTGGGATGAATATGTGCCGGAA
CTGATGAAGACACTCTATGGAGTCAATGAG
>C8
ATGAAATTGCATGGGTTACTTTTGCTATTCCTGGGCTTCATTTGCCTGAG
TCGCAGTCAGGACGAAAATGAGAATGTTCGCAGGATAATGAAGGAAATGG
AGGTGATCCCTGAAATTTTAGATGAACCGCCCAACGAATTACTCAGGATT
AAATATGACAACACCTTTGACATCGAAGAGGGCAAGTCCTATACTCCAAA
AGAACTTAAATTCCAACCCAGACTTGATTGGAACGCGGATCCTGAGACAT
TTTACACTGTGGTTATGATTTGTCCCGATGCTCCGAATCGTGAGAATCCC
ATGTACCGATCCTGGCTTCATTGGCTGGTGGTCAATGTTCCCGGATTGGA
TATAATGAAGGGTCAACCCATATCGGATTACTTTGGTCCTCTGCCACCAA
AAGACAGTGGAGTTCAGCGCTATCTTATTCTGGTCTATCGGCAATCGGAT
AAACTGGATTTTGATGAGAAGAAGATAGAGCTAAGTAATGCCGATGGTCA
TAGCAATTTTGATGTGATGAAGTTTGCCCAGAAGTACGAAATGGGAACTC
CAGTGGCGGGAAATATATTCCAATCCAGGTGGGATGAATATGTTCCGGAG
TTGATGAAGACACTCTATGGTGTTGATGAG
>C1
MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C2
MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C3
MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C4
MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C5
MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
LMKTLYGVSE
>C6
MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
LMKTLYGVSE
>C7
MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVNE
>C8
MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
LMKTLYGVDE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 630 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480112606
Setting output file names to "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 606842
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9350185240
Seed = 1590106148
Swapseed = 1480112606
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 35 unique site patterns
Division 2 has 21 unique site patterns
Division 3 has 110 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2873.315482 -- -24.349928
Chain 2 -- -2854.021540 -- -24.349928
Chain 3 -- -2884.117503 -- -24.349928
Chain 4 -- -2844.423671 -- -24.349928
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2845.989459 -- -24.349928
Chain 2 -- -2863.020613 -- -24.349928
Chain 3 -- -2805.325381 -- -24.349928
Chain 4 -- -2878.704699 -- -24.349928
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2873.315] (-2854.022) (-2884.118) (-2844.424) * [-2845.989] (-2863.021) (-2805.325) (-2878.705)
500 -- [-2287.513] (-2321.530) (-2318.335) (-2305.186) * (-2320.752) (-2316.239) (-2298.570) [-2304.038] -- 0:00:00
1000 -- [-2247.771] (-2276.054) (-2276.310) (-2291.158) * (-2297.752) (-2288.803) (-2265.656) [-2249.890] -- 0:16:39
1500 -- (-2230.246) [-2237.997] (-2230.299) (-2244.292) * (-2259.654) (-2258.573) [-2224.323] (-2239.044) -- 0:11:05
2000 -- [-2230.932] (-2235.620) (-2225.854) (-2232.332) * (-2246.181) [-2229.650] (-2219.996) (-2234.939) -- 0:08:19
2500 -- [-2219.260] (-2230.077) (-2216.787) (-2216.864) * (-2218.478) (-2214.191) [-2208.838] (-2226.164) -- 0:06:39
3000 -- [-2210.244] (-2215.953) (-2224.450) (-2216.154) * (-2213.971) [-2208.728] (-2205.910) (-2228.102) -- 0:05:32
3500 -- (-2208.086) (-2224.728) [-2216.941] (-2212.559) * [-2216.623] (-2202.862) (-2208.151) (-2232.998) -- 0:09:29
4000 -- (-2207.995) (-2204.753) [-2203.189] (-2209.852) * (-2211.476) (-2205.559) [-2208.528] (-2232.135) -- 0:08:18
4500 -- (-2207.818) [-2206.242] (-2211.844) (-2210.880) * (-2205.614) [-2213.618] (-2211.769) (-2207.726) -- 0:07:22
5000 -- (-2196.366) (-2205.384) (-2215.567) [-2209.138] * [-2204.452] (-2213.043) (-2204.205) (-2205.075) -- 0:06:38
Average standard deviation of split frequencies: 0.089791
5500 -- (-2212.049) (-2200.475) [-2205.856] (-2211.307) * [-2210.006] (-2207.465) (-2208.252) (-2208.522) -- 0:06:01
6000 -- [-2209.904] (-2204.649) (-2204.973) (-2210.979) * [-2212.433] (-2213.868) (-2207.065) (-2209.709) -- 0:05:31
6500 -- (-2210.101) (-2205.148) [-2203.394] (-2210.672) * (-2208.282) (-2204.763) (-2211.671) [-2205.037] -- 0:07:38
7000 -- (-2208.011) [-2206.822] (-2214.196) (-2205.929) * [-2208.605] (-2218.047) (-2199.976) (-2201.224) -- 0:07:05
7500 -- (-2205.231) [-2210.956] (-2206.455) (-2208.667) * (-2212.995) [-2209.788] (-2205.575) (-2208.440) -- 0:06:37
8000 -- (-2210.581) (-2208.626) (-2207.519) [-2204.427] * (-2205.890) (-2212.070) (-2202.524) [-2206.387] -- 0:06:12
8500 -- (-2207.576) [-2202.545] (-2204.093) (-2206.968) * (-2205.793) (-2211.353) [-2199.584] (-2208.421) -- 0:05:49
9000 -- [-2208.064] (-2212.609) (-2206.074) (-2209.958) * [-2202.612] (-2211.156) (-2214.529) (-2214.218) -- 0:07:20
9500 -- (-2208.414) [-2207.789] (-2207.404) (-2204.902) * (-2203.126) (-2208.612) (-2207.208) [-2208.948] -- 0:06:57
10000 -- (-2205.473) (-2213.170) (-2207.217) [-2198.832] * (-2202.364) [-2206.017] (-2203.928) (-2208.000) -- 0:06:36
Average standard deviation of split frequencies: 0.026517
10500 -- (-2209.803) (-2208.105) (-2212.209) [-2205.384] * (-2205.834) [-2202.888] (-2200.562) (-2219.090) -- 0:06:16
11000 -- [-2203.535] (-2208.527) (-2201.236) (-2201.213) * [-2202.155] (-2212.758) (-2208.026) (-2213.831) -- 0:05:59
11500 -- (-2207.619) (-2209.294) [-2214.593] (-2206.777) * (-2208.568) [-2207.943] (-2215.044) (-2208.789) -- 0:05:43
12000 -- (-2209.380) (-2202.656) (-2220.642) [-2207.720] * (-2213.616) [-2206.296] (-2210.526) (-2203.339) -- 0:06:51
12500 -- (-2202.760) [-2204.324] (-2203.197) (-2216.864) * (-2217.498) (-2210.867) [-2208.080] (-2214.539) -- 0:06:35
13000 -- (-2205.880) [-2205.925] (-2207.326) (-2221.332) * (-2210.859) (-2202.009) [-2210.275] (-2208.030) -- 0:06:19
13500 -- (-2204.629) (-2210.856) [-2204.969] (-2209.769) * (-2209.915) (-2202.246) (-2201.909) [-2205.480] -- 0:06:05
14000 -- (-2210.199) (-2203.290) (-2209.982) [-2212.122] * [-2215.676] (-2204.360) (-2209.382) (-2205.455) -- 0:05:52
14500 -- (-2203.740) (-2204.355) (-2213.646) [-2206.310] * (-2209.269) [-2202.257] (-2202.422) (-2208.888) -- 0:06:47
15000 -- (-2205.845) [-2202.014] (-2214.465) (-2209.040) * (-2219.495) [-2200.665] (-2212.190) (-2203.301) -- 0:06:34
Average standard deviation of split frequencies: 0.005893
15500 -- [-2213.541] (-2213.923) (-2207.705) (-2210.308) * [-2215.419] (-2203.927) (-2203.673) (-2203.939) -- 0:06:21
16000 -- [-2205.809] (-2204.307) (-2207.970) (-2207.336) * (-2209.846) [-2201.835] (-2204.062) (-2204.291) -- 0:06:09
16500 -- (-2211.757) (-2208.546) (-2207.437) [-2211.522] * [-2204.241] (-2206.037) (-2205.335) (-2206.124) -- 0:05:57
17000 -- [-2212.571] (-2202.972) (-2208.084) (-2206.750) * (-2210.863) [-2204.652] (-2203.032) (-2213.212) -- 0:05:46
17500 -- (-2205.693) (-2199.347) [-2204.595] (-2208.562) * [-2206.738] (-2203.716) (-2206.740) (-2208.876) -- 0:06:33
18000 -- (-2212.381) [-2202.394] (-2209.436) (-2207.349) * (-2213.168) (-2206.909) (-2201.371) [-2213.295] -- 0:06:21
18500 -- (-2208.765) (-2206.531) [-2207.311] (-2205.683) * (-2212.951) [-2203.012] (-2200.851) (-2205.777) -- 0:06:11
19000 -- (-2200.751) [-2206.963] (-2209.060) (-2211.082) * [-2202.509] (-2211.401) (-2203.780) (-2212.453) -- 0:06:01
19500 -- [-2212.812] (-2214.277) (-2209.419) (-2217.283) * (-2213.422) (-2210.592) [-2207.109] (-2213.589) -- 0:05:51
20000 -- (-2204.888) (-2208.659) [-2203.751] (-2209.626) * (-2209.275) (-2200.422) (-2210.358) [-2206.487] -- 0:06:32
Average standard deviation of split frequencies: 0.015207
20500 -- (-2213.990) [-2207.445] (-2201.414) (-2216.609) * (-2209.207) (-2202.880) (-2206.190) [-2203.317] -- 0:06:22
21000 -- (-2211.495) (-2206.078) [-2208.007] (-2201.764) * (-2207.627) (-2209.822) (-2204.732) [-2205.779] -- 0:06:12
21500 -- [-2203.691] (-2210.918) (-2207.510) (-2206.409) * (-2214.523) (-2206.352) [-2206.415] (-2206.369) -- 0:06:04
22000 -- (-2208.409) (-2205.798) (-2215.428) [-2204.444] * (-2204.681) (-2217.349) [-2199.273] (-2204.849) -- 0:05:55
22500 -- [-2204.444] (-2204.415) (-2201.043) (-2213.788) * (-2208.119) (-2212.013) (-2209.185) [-2203.761] -- 0:05:47
23000 -- (-2207.589) (-2210.415) (-2199.160) [-2209.230] * [-2204.489] (-2216.370) (-2208.345) (-2202.940) -- 0:06:22
23500 -- [-2205.801] (-2200.433) (-2208.850) (-2203.480) * (-2211.236) [-2206.649] (-2200.878) (-2205.049) -- 0:06:13
24000 -- (-2208.851) (-2200.738) [-2207.669] (-2209.497) * (-2207.003) (-2203.998) (-2212.609) [-2203.607] -- 0:06:06
24500 -- (-2208.105) (-2198.172) (-2209.055) [-2213.999] * (-2210.230) (-2211.692) (-2204.812) [-2202.855] -- 0:05:58
25000 -- (-2209.325) (-2204.170) [-2205.974] (-2209.866) * [-2202.925] (-2202.151) (-2210.902) (-2204.555) -- 0:05:51
Average standard deviation of split frequencies: 0.024175
25500 -- (-2206.879) (-2216.380) [-2203.388] (-2220.349) * (-2210.807) (-2211.739) [-2216.449] (-2210.549) -- 0:06:22
26000 -- (-2208.009) (-2216.695) [-2211.749] (-2217.246) * (-2212.614) [-2205.748] (-2214.633) (-2210.466) -- 0:06:14
26500 -- (-2202.959) [-2209.355] (-2208.052) (-2218.546) * (-2213.157) (-2201.837) [-2208.180] (-2216.718) -- 0:06:07
27000 -- [-2202.903] (-2203.414) (-2209.898) (-2212.886) * (-2207.796) (-2213.435) [-2202.792] (-2206.638) -- 0:06:00
27500 -- (-2212.787) [-2202.776] (-2206.446) (-2207.725) * (-2210.146) [-2209.378] (-2208.737) (-2208.715) -- 0:05:53
28000 -- [-2202.220] (-2209.338) (-2211.054) (-2208.976) * (-2218.137) (-2204.135) [-2206.566] (-2207.513) -- 0:05:47
28500 -- (-2207.983) (-2208.968) [-2210.378] (-2210.647) * (-2214.773) [-2210.790] (-2212.401) (-2210.349) -- 0:06:14
29000 -- (-2208.131) (-2209.237) [-2205.876] (-2205.893) * (-2210.684) (-2209.435) [-2205.579] (-2208.846) -- 0:06:08
29500 -- [-2210.756] (-2207.279) (-2208.364) (-2208.208) * (-2212.826) (-2209.835) [-2206.108] (-2205.455) -- 0:06:01
30000 -- [-2201.311] (-2206.638) (-2210.033) (-2209.978) * (-2208.705) (-2209.596) (-2209.337) [-2208.273] -- 0:05:55
Average standard deviation of split frequencies: 0.017934
30500 -- (-2199.047) [-2204.696] (-2209.736) (-2205.769) * (-2205.850) (-2209.557) [-2204.418] (-2212.440) -- 0:05:49
31000 -- (-2206.825) (-2210.590) (-2204.197) [-2211.172] * [-2208.153] (-2201.623) (-2203.701) (-2217.351) -- 0:06:15
31500 -- (-2212.021) [-2205.004] (-2208.208) (-2206.491) * [-2209.848] (-2206.493) (-2202.236) (-2213.852) -- 0:06:08
32000 -- [-2205.547] (-2201.489) (-2211.485) (-2219.048) * (-2207.334) [-2202.828] (-2215.899) (-2203.642) -- 0:06:03
32500 -- [-2204.043] (-2216.455) (-2202.580) (-2209.410) * (-2202.524) (-2211.579) [-2201.123] (-2207.056) -- 0:05:57
33000 -- [-2202.825] (-2215.655) (-2200.532) (-2215.753) * (-2208.279) (-2209.944) (-2204.618) [-2206.409] -- 0:05:51
33500 -- (-2204.187) [-2208.317] (-2209.139) (-2203.974) * (-2225.018) [-2205.349] (-2207.909) (-2214.819) -- 0:05:46
34000 -- [-2204.532] (-2214.662) (-2204.118) (-2201.027) * (-2212.582) (-2209.706) [-2211.995] (-2201.631) -- 0:06:09
34500 -- (-2215.743) (-2204.033) [-2203.532] (-2205.667) * (-2212.076) (-2222.207) [-2209.633] (-2205.281) -- 0:06:03
35000 -- (-2209.028) (-2204.157) [-2206.196] (-2210.621) * (-2203.294) [-2221.306] (-2212.767) (-2210.322) -- 0:05:58
Average standard deviation of split frequencies: 0.026189
35500 -- (-2209.754) [-2206.939] (-2204.514) (-2204.157) * (-2204.487) (-2220.525) (-2214.362) [-2212.624] -- 0:05:53
36000 -- (-2205.640) [-2206.845] (-2206.042) (-2205.030) * (-2202.959) [-2213.181] (-2215.126) (-2204.153) -- 0:05:48
36500 -- (-2206.740) (-2211.231) [-2207.682] (-2211.139) * (-2204.432) [-2214.978] (-2211.561) (-2206.316) -- 0:06:09
37000 -- (-2216.481) [-2204.710] (-2206.383) (-2202.848) * (-2211.961) (-2210.027) (-2208.579) [-2210.018] -- 0:06:04
37500 -- (-2210.855) [-2209.901] (-2208.843) (-2210.779) * (-2204.678) [-2203.436] (-2207.815) (-2209.764) -- 0:05:59
38000 -- (-2210.896) (-2211.652) (-2209.840) [-2203.419] * (-2202.192) (-2205.587) (-2205.625) [-2201.818] -- 0:05:54
38500 -- (-2211.392) [-2206.999] (-2211.731) (-2212.969) * [-2216.606] (-2206.655) (-2214.921) (-2217.185) -- 0:05:49
39000 -- [-2208.865] (-2211.909) (-2201.574) (-2219.119) * [-2204.660] (-2209.586) (-2207.970) (-2214.557) -- 0:05:44
39500 -- [-2203.327] (-2208.570) (-2209.409) (-2213.016) * [-2201.555] (-2204.505) (-2204.912) (-2213.640) -- 0:06:04
40000 -- (-2212.195) (-2208.811) (-2207.030) [-2206.190] * (-2216.902) [-2202.760] (-2206.895) (-2212.977) -- 0:06:00
Average standard deviation of split frequencies: 0.032844
40500 -- (-2210.131) (-2211.372) [-2204.226] (-2219.979) * [-2204.400] (-2215.943) (-2202.909) (-2212.788) -- 0:05:55
41000 -- (-2217.805) [-2208.141] (-2208.089) (-2209.614) * (-2204.972) [-2202.661] (-2202.871) (-2207.639) -- 0:05:50
41500 -- [-2203.292] (-2210.136) (-2209.829) (-2210.764) * (-2203.320) [-2206.127] (-2211.878) (-2202.431) -- 0:05:46
42000 -- (-2209.260) (-2201.798) [-2204.291] (-2200.820) * (-2196.906) (-2203.794) [-2205.193] (-2208.380) -- 0:06:04
42500 -- (-2217.767) (-2200.680) (-2201.785) [-2203.692] * (-2205.818) [-2200.416] (-2211.371) (-2208.320) -- 0:06:00
43000 -- (-2215.936) (-2208.504) (-2211.179) [-2211.128] * [-2209.070] (-2204.796) (-2207.876) (-2210.867) -- 0:05:56
43500 -- (-2220.736) [-2210.325] (-2206.735) (-2211.797) * (-2209.450) (-2209.691) (-2208.254) [-2210.649] -- 0:05:51
44000 -- (-2208.744) (-2199.599) (-2204.630) [-2205.695] * (-2211.129) (-2217.384) [-2201.657] (-2203.649) -- 0:05:47
44500 -- [-2204.975] (-2210.046) (-2208.867) (-2205.518) * [-2205.568] (-2208.001) (-2205.545) (-2204.716) -- 0:06:05
45000 -- (-2207.721) (-2207.171) [-2207.947] (-2204.895) * (-2206.743) [-2206.949] (-2209.515) (-2202.154) -- 0:06:00
Average standard deviation of split frequencies: 0.027816
45500 -- (-2204.290) (-2202.152) (-2208.941) [-2201.482] * (-2206.263) (-2208.690) (-2209.652) [-2204.639] -- 0:05:56
46000 -- (-2217.119) [-2206.852] (-2212.163) (-2207.751) * (-2207.514) (-2208.389) (-2204.624) [-2206.408] -- 0:05:52
46500 -- (-2209.004) (-2200.907) [-2214.755] (-2210.393) * [-2208.164] (-2209.264) (-2208.113) (-2208.307) -- 0:05:48
47000 -- (-2203.972) (-2208.824) (-2210.188) [-2216.931] * (-2209.562) (-2202.166) [-2203.983] (-2199.432) -- 0:05:44
47500 -- (-2201.194) [-2209.772] (-2217.182) (-2207.171) * (-2206.052) (-2205.540) [-2204.745] (-2205.881) -- 0:06:00
48000 -- (-2213.890) [-2202.837] (-2209.653) (-2208.402) * (-2212.486) (-2202.331) (-2212.755) [-2204.753] -- 0:05:57
48500 -- [-2211.023] (-2204.399) (-2199.255) (-2203.784) * (-2212.513) [-2203.969] (-2201.338) (-2208.570) -- 0:05:53
49000 -- (-2207.312) (-2206.614) [-2206.486] (-2211.404) * (-2213.759) [-2207.089] (-2203.007) (-2211.618) -- 0:05:49
49500 -- [-2207.210] (-2201.522) (-2204.600) (-2209.769) * [-2206.519] (-2208.560) (-2202.343) (-2204.773) -- 0:05:45
50000 -- (-2206.512) (-2206.224) (-2214.658) [-2204.141] * (-2209.372) (-2215.354) [-2199.464] (-2216.849) -- 0:06:01
Average standard deviation of split frequencies: 0.027912
50500 -- [-2208.309] (-2204.537) (-2205.535) (-2208.785) * (-2211.327) [-2210.757] (-2203.761) (-2203.174) -- 0:05:57
51000 -- [-2205.083] (-2210.410) (-2204.152) (-2215.375) * (-2206.797) (-2208.067) [-2210.142] (-2204.454) -- 0:05:53
51500 -- (-2216.283) (-2213.942) (-2209.699) [-2205.014] * (-2212.554) (-2207.899) (-2208.926) [-2206.320] -- 0:05:49
52000 -- (-2205.298) (-2201.557) (-2207.299) [-2210.286] * (-2209.896) (-2201.810) (-2209.866) [-2207.014] -- 0:05:46
52500 -- (-2215.645) (-2213.032) [-2208.044] (-2201.229) * (-2212.489) (-2220.289) (-2214.679) [-2201.585] -- 0:05:42
53000 -- (-2208.247) (-2211.454) (-2201.947) [-2209.057] * [-2207.293] (-2205.200) (-2209.901) (-2210.340) -- 0:05:57
53500 -- (-2209.485) (-2203.252) [-2204.092] (-2213.978) * (-2219.791) (-2219.907) [-2200.853] (-2217.707) -- 0:05:53
54000 -- [-2204.941] (-2209.135) (-2204.213) (-2208.853) * (-2215.401) [-2215.699] (-2207.920) (-2212.266) -- 0:05:50
54500 -- [-2208.708] (-2208.275) (-2208.053) (-2211.758) * (-2205.058) (-2207.470) [-2203.474] (-2204.627) -- 0:05:46
55000 -- [-2200.202] (-2210.889) (-2207.239) (-2207.595) * (-2215.402) (-2213.313) [-2211.499] (-2205.271) -- 0:05:43
Average standard deviation of split frequencies: 0.025254
55500 -- [-2204.110] (-2215.403) (-2203.141) (-2219.106) * (-2210.584) (-2218.088) (-2207.567) [-2204.334] -- 0:05:57
56000 -- (-2212.660) [-2208.674] (-2209.262) (-2214.062) * [-2206.100] (-2215.260) (-2205.057) (-2202.469) -- 0:05:54
56500 -- (-2209.152) [-2206.993] (-2206.649) (-2209.592) * [-2204.029] (-2212.663) (-2214.372) (-2202.402) -- 0:05:50
57000 -- (-2207.767) [-2205.562] (-2214.654) (-2207.534) * (-2206.611) (-2215.162) (-2221.313) [-2203.886] -- 0:05:47
57500 -- (-2200.070) (-2213.330) (-2204.784) [-2202.141] * (-2210.934) (-2206.072) (-2205.352) [-2206.574] -- 0:05:44
58000 -- (-2208.195) (-2204.616) [-2208.862] (-2210.680) * (-2204.434) [-2204.141] (-2202.540) (-2209.124) -- 0:05:41
58500 -- (-2209.316) (-2208.279) (-2202.395) [-2208.121] * (-2201.325) (-2207.467) [-2204.449] (-2201.140) -- 0:05:54
59000 -- [-2207.489] (-2221.330) (-2207.552) (-2209.163) * (-2203.945) (-2204.203) (-2209.160) [-2205.840] -- 0:05:50
59500 -- (-2203.915) [-2205.524] (-2207.381) (-2212.578) * [-2206.455] (-2207.379) (-2209.479) (-2216.173) -- 0:05:47
60000 -- [-2207.382] (-2210.917) (-2212.139) (-2206.009) * (-2205.257) [-2210.432] (-2205.592) (-2212.108) -- 0:05:44
Average standard deviation of split frequencies: 0.025901
60500 -- (-2201.224) (-2211.717) [-2203.599] (-2210.750) * [-2205.368] (-2207.660) (-2205.540) (-2212.240) -- 0:05:41
61000 -- (-2206.270) (-2206.735) (-2206.557) [-2205.973] * (-2205.634) (-2206.036) [-2207.913] (-2205.753) -- 0:05:54
61500 -- (-2204.461) [-2216.980] (-2207.724) (-2211.185) * (-2205.610) (-2204.947) (-2202.716) [-2204.327] -- 0:05:50
62000 -- (-2206.405) (-2212.227) [-2208.009] (-2218.169) * (-2206.972) (-2206.847) [-2207.541] (-2203.776) -- 0:05:47
62500 -- (-2211.925) (-2201.394) [-2206.749] (-2209.249) * (-2211.020) (-2215.603) [-2205.530] (-2200.945) -- 0:05:45
63000 -- (-2200.773) [-2203.244] (-2215.754) (-2212.448) * (-2209.478) [-2212.280] (-2207.842) (-2208.221) -- 0:05:42
63500 -- [-2199.948] (-2205.555) (-2205.446) (-2213.375) * (-2208.139) [-2210.353] (-2214.173) (-2211.513) -- 0:05:39
64000 -- (-2201.875) (-2200.509) (-2209.919) [-2210.158] * (-2204.302) [-2200.938] (-2206.236) (-2208.364) -- 0:05:51
64500 -- [-2202.101] (-2202.214) (-2208.664) (-2210.563) * (-2201.170) [-2206.462] (-2212.090) (-2206.023) -- 0:05:48
65000 -- (-2206.309) [-2202.987] (-2205.418) (-2209.426) * (-2206.228) [-2208.560] (-2210.173) (-2209.530) -- 0:05:45
Average standard deviation of split frequencies: 0.022448
65500 -- (-2212.031) [-2206.352] (-2212.064) (-2208.840) * (-2210.885) (-2205.123) (-2211.012) [-2205.984] -- 0:05:42
66000 -- [-2202.775] (-2205.605) (-2207.979) (-2202.245) * (-2205.761) (-2214.608) (-2211.490) [-2202.792] -- 0:05:39
66500 -- [-2208.443] (-2215.674) (-2211.437) (-2210.354) * (-2206.587) [-2206.140] (-2202.819) (-2212.747) -- 0:05:50
67000 -- (-2206.415) (-2210.698) [-2213.390] (-2210.323) * [-2207.959] (-2203.183) (-2208.024) (-2200.501) -- 0:05:48
67500 -- (-2210.012) [-2203.363] (-2203.171) (-2198.637) * (-2204.826) [-2205.661] (-2221.793) (-2212.578) -- 0:05:45
68000 -- [-2210.194] (-2209.553) (-2209.703) (-2201.613) * (-2204.025) (-2215.041) [-2208.557] (-2209.044) -- 0:05:42
68500 -- (-2209.287) [-2209.517] (-2208.760) (-2205.523) * (-2208.343) (-2211.202) (-2207.454) [-2202.812] -- 0:05:39
69000 -- [-2209.217] (-2205.396) (-2206.231) (-2215.666) * [-2205.876] (-2211.303) (-2205.600) (-2204.969) -- 0:05:50
69500 -- [-2202.887] (-2213.451) (-2210.071) (-2209.194) * (-2204.203) [-2209.792] (-2209.017) (-2203.630) -- 0:05:48
70000 -- (-2201.057) (-2206.247) [-2208.385] (-2206.118) * (-2210.045) (-2204.893) [-2206.918] (-2204.292) -- 0:05:45
Average standard deviation of split frequencies: 0.021124
70500 -- (-2207.189) [-2214.860] (-2202.713) (-2210.582) * (-2206.500) (-2203.937) [-2204.127] (-2215.826) -- 0:05:42
71000 -- (-2209.184) (-2204.743) (-2212.614) [-2210.303] * (-2208.285) (-2207.950) (-2216.178) [-2207.518] -- 0:05:40
71500 -- (-2206.678) [-2205.566] (-2207.060) (-2205.551) * (-2201.698) (-2201.886) (-2206.262) [-2210.816] -- 0:05:37
72000 -- [-2204.861] (-2218.070) (-2207.031) (-2208.590) * (-2213.212) (-2204.601) (-2214.541) [-2205.992] -- 0:05:48
72500 -- (-2202.191) [-2204.279] (-2210.931) (-2202.223) * [-2204.476] (-2208.636) (-2205.384) (-2206.435) -- 0:05:45
73000 -- (-2215.696) (-2203.074) (-2206.522) [-2209.885] * (-2208.509) (-2208.433) [-2205.590] (-2209.336) -- 0:05:42
73500 -- (-2201.854) [-2206.068] (-2208.262) (-2206.029) * [-2201.215] (-2213.503) (-2207.083) (-2202.941) -- 0:05:40
74000 -- (-2219.148) (-2212.602) [-2205.830] (-2200.558) * (-2203.707) (-2206.413) (-2205.910) [-2208.508] -- 0:05:37
74500 -- (-2209.976) (-2212.588) (-2205.184) [-2204.537] * (-2206.922) [-2204.977] (-2204.386) (-2201.957) -- 0:05:47
75000 -- (-2200.816) (-2208.198) (-2212.823) [-2209.446] * [-2201.694] (-2209.608) (-2213.713) (-2201.284) -- 0:05:45
Average standard deviation of split frequencies: 0.020380
75500 -- (-2203.285) (-2215.690) (-2200.389) [-2204.555] * [-2204.729] (-2208.346) (-2205.258) (-2202.130) -- 0:05:42
76000 -- (-2207.882) (-2210.780) [-2202.210] (-2207.157) * (-2204.846) (-2212.491) (-2219.193) [-2204.040] -- 0:05:40
76500 -- (-2213.966) [-2207.575] (-2205.748) (-2206.028) * [-2205.850] (-2206.979) (-2212.266) (-2206.779) -- 0:05:38
77000 -- [-2203.397] (-2202.327) (-2200.210) (-2211.092) * [-2208.908] (-2211.879) (-2213.343) (-2210.797) -- 0:05:35
77500 -- (-2205.640) (-2206.570) [-2205.214] (-2210.168) * [-2204.459] (-2204.371) (-2219.246) (-2209.573) -- 0:05:45
78000 -- (-2210.987) (-2213.262) (-2203.649) [-2203.184] * (-2201.939) (-2207.701) (-2208.249) [-2211.435] -- 0:05:42
78500 -- (-2208.810) [-2204.297] (-2204.173) (-2208.701) * [-2203.173] (-2209.311) (-2215.481) (-2207.642) -- 0:05:40
79000 -- (-2213.825) [-2204.417] (-2205.007) (-2208.190) * [-2202.795] (-2211.857) (-2214.611) (-2201.975) -- 0:05:38
79500 -- (-2212.581) [-2203.908] (-2204.594) (-2215.663) * (-2205.383) (-2216.182) (-2206.567) [-2205.487] -- 0:05:35
80000 -- (-2204.921) [-2203.937] (-2212.335) (-2212.340) * (-2205.724) (-2213.564) [-2207.365] (-2207.226) -- 0:05:45
Average standard deviation of split frequencies: 0.014610
80500 -- (-2205.801) [-2205.489] (-2213.304) (-2213.958) * (-2205.727) (-2208.738) (-2225.164) [-2207.238] -- 0:05:42
81000 -- (-2210.553) [-2198.240] (-2209.775) (-2214.387) * (-2204.196) (-2217.320) [-2210.396] (-2209.742) -- 0:05:40
81500 -- (-2216.408) [-2204.874] (-2205.813) (-2205.444) * [-2204.693] (-2209.739) (-2210.636) (-2201.169) -- 0:05:38
82000 -- (-2210.839) (-2202.902) (-2202.994) [-2212.442] * [-2207.226] (-2208.507) (-2215.246) (-2214.747) -- 0:05:35
82500 -- (-2205.636) [-2208.420] (-2211.306) (-2204.319) * (-2205.329) [-2206.911] (-2200.747) (-2203.497) -- 0:05:33
83000 -- (-2202.877) (-2211.583) (-2202.359) [-2213.295] * [-2205.706] (-2212.222) (-2211.169) (-2211.863) -- 0:05:42
83500 -- [-2204.008] (-2213.650) (-2201.069) (-2211.987) * (-2214.225) (-2204.786) [-2212.574] (-2201.302) -- 0:05:40
84000 -- (-2207.137) [-2213.626] (-2217.499) (-2212.583) * (-2216.906) (-2205.102) (-2204.454) [-2210.424] -- 0:05:38
84500 -- (-2206.081) (-2214.346) [-2204.084] (-2210.073) * (-2218.648) [-2202.239] (-2207.980) (-2211.235) -- 0:05:35
85000 -- (-2208.552) (-2209.131) (-2204.059) [-2206.841] * (-2208.424) [-2205.426] (-2204.830) (-2212.410) -- 0:05:33
Average standard deviation of split frequencies: 0.018271
85500 -- [-2215.195] (-2211.762) (-2207.551) (-2200.781) * (-2207.530) [-2202.847] (-2214.657) (-2207.786) -- 0:05:42
86000 -- (-2208.336) [-2210.524] (-2207.905) (-2202.997) * (-2213.404) (-2203.472) [-2205.207] (-2209.302) -- 0:05:40
86500 -- (-2213.823) (-2203.420) [-2209.970] (-2204.398) * (-2221.286) [-2211.261] (-2212.807) (-2202.776) -- 0:05:37
87000 -- (-2215.219) [-2207.980] (-2217.187) (-2208.377) * (-2204.360) (-2206.145) (-2207.000) [-2207.485] -- 0:05:35
87500 -- [-2209.940] (-2206.249) (-2223.365) (-2206.070) * (-2203.906) [-2210.662] (-2212.454) (-2215.202) -- 0:05:33
88000 -- (-2209.466) [-2215.021] (-2209.599) (-2198.795) * (-2218.319) [-2210.399] (-2207.913) (-2207.601) -- 0:05:31
88500 -- (-2211.516) (-2210.800) [-2203.762] (-2201.915) * (-2208.515) (-2207.958) (-2201.251) [-2202.680] -- 0:05:39
89000 -- (-2218.022) (-2206.377) (-2206.319) [-2208.642] * (-2215.333) (-2214.569) (-2209.726) [-2214.580] -- 0:05:37
89500 -- [-2200.849] (-2200.598) (-2213.261) (-2203.942) * (-2209.392) [-2206.124] (-2208.945) (-2211.700) -- 0:05:35
90000 -- (-2203.876) (-2202.910) (-2205.009) [-2201.041] * [-2203.436] (-2201.632) (-2209.601) (-2214.324) -- 0:05:33
Average standard deviation of split frequencies: 0.020797
90500 -- (-2204.762) (-2208.304) [-2206.748] (-2211.550) * [-2206.797] (-2206.714) (-2209.499) (-2204.432) -- 0:05:31
91000 -- (-2211.441) [-2205.766] (-2200.681) (-2205.729) * (-2205.607) [-2203.123] (-2212.719) (-2204.212) -- 0:05:39
91500 -- (-2215.485) (-2209.891) (-2204.108) [-2209.613] * (-2218.408) [-2203.045] (-2204.831) (-2214.835) -- 0:05:37
92000 -- [-2207.453] (-2205.141) (-2201.813) (-2204.903) * (-2208.219) (-2202.066) [-2213.766] (-2212.621) -- 0:05:35
92500 -- [-2202.900] (-2219.807) (-2212.837) (-2215.972) * (-2205.132) [-2203.062] (-2200.760) (-2210.333) -- 0:05:33
93000 -- (-2213.971) (-2207.249) (-2214.554) [-2205.089] * (-2212.974) (-2207.076) [-2208.608] (-2206.833) -- 0:05:31
93500 -- [-2201.982] (-2210.003) (-2201.365) (-2206.760) * (-2206.587) [-2205.076] (-2210.586) (-2207.542) -- 0:05:29
94000 -- (-2211.345) (-2208.882) (-2208.080) [-2207.255] * [-2212.000] (-2205.544) (-2213.072) (-2207.129) -- 0:05:37
94500 -- (-2203.285) (-2207.644) [-2203.619] (-2211.294) * (-2200.967) [-2204.429] (-2209.648) (-2213.951) -- 0:05:35
95000 -- (-2209.205) [-2206.143] (-2206.987) (-2211.873) * (-2208.948) [-2200.782] (-2216.256) (-2203.515) -- 0:05:33
Average standard deviation of split frequencies: 0.019642
95500 -- (-2217.058) (-2205.162) [-2208.299] (-2206.793) * (-2220.729) (-2203.836) (-2210.914) [-2203.478] -- 0:05:31
96000 -- [-2207.475] (-2215.684) (-2209.958) (-2209.821) * [-2215.379] (-2211.350) (-2205.747) (-2203.155) -- 0:05:29
96500 -- (-2209.760) [-2206.401] (-2211.265) (-2210.042) * (-2214.162) (-2208.771) [-2206.466] (-2206.922) -- 0:05:37
97000 -- (-2212.094) [-2199.935] (-2215.774) (-2216.234) * (-2212.849) (-2206.760) [-2207.695] (-2210.152) -- 0:05:35
97500 -- (-2208.922) [-2206.405] (-2212.795) (-2215.809) * (-2210.741) (-2214.526) [-2206.462] (-2204.262) -- 0:05:33
98000 -- [-2208.865] (-2208.449) (-2203.466) (-2208.311) * [-2207.733] (-2206.482) (-2211.411) (-2204.516) -- 0:05:31
98500 -- (-2207.933) (-2213.942) (-2207.774) [-2203.653] * (-2216.810) [-2208.465] (-2200.330) (-2215.563) -- 0:05:29
99000 -- [-2204.027] (-2209.012) (-2210.306) (-2208.362) * (-2218.218) (-2210.123) [-2204.396] (-2208.711) -- 0:05:27
99500 -- (-2206.469) (-2204.216) (-2211.852) [-2207.375] * (-2214.345) (-2209.828) (-2210.594) [-2209.711] -- 0:05:34
100000 -- [-2215.359] (-2207.181) (-2212.542) (-2214.648) * [-2208.231] (-2213.268) (-2206.864) (-2206.960) -- 0:05:33
Average standard deviation of split frequencies: 0.025421
100500 -- (-2212.129) (-2224.999) [-2203.772] (-2206.316) * (-2207.193) [-2208.797] (-2212.175) (-2217.910) -- 0:05:31
101000 -- (-2205.217) (-2210.898) [-2204.691] (-2206.328) * (-2204.873) (-2203.074) [-2206.152] (-2213.045) -- 0:05:29
101500 -- [-2203.123] (-2201.744) (-2202.621) (-2217.420) * (-2202.279) (-2213.074) (-2206.431) [-2204.839] -- 0:05:27
102000 -- (-2205.619) (-2209.457) [-2202.148] (-2213.629) * (-2204.966) (-2211.913) [-2204.447] (-2200.740) -- 0:05:34
102500 -- (-2203.889) (-2209.650) (-2211.123) [-2205.766] * (-2207.937) (-2205.504) [-2205.109] (-2203.810) -- 0:05:32
103000 -- (-2205.068) (-2206.697) (-2208.741) [-2210.288] * (-2211.843) (-2213.900) (-2215.055) [-2210.491] -- 0:05:30
103500 -- (-2216.882) [-2207.537] (-2199.042) (-2211.805) * (-2206.612) (-2207.214) (-2208.596) [-2205.112] -- 0:05:29
104000 -- (-2211.333) (-2211.348) (-2206.233) [-2204.482] * [-2208.504] (-2204.084) (-2210.565) (-2198.828) -- 0:05:27
104500 -- (-2205.097) (-2213.929) [-2201.874] (-2205.920) * [-2206.445] (-2202.704) (-2216.399) (-2208.106) -- 0:05:25
105000 -- (-2200.359) (-2208.244) [-2206.140] (-2205.817) * (-2206.593) (-2208.482) [-2208.199] (-2202.048) -- 0:05:32
Average standard deviation of split frequencies: 0.019059
105500 -- (-2205.227) (-2216.826) [-2206.471] (-2207.218) * (-2212.546) (-2204.610) [-2209.471] (-2209.579) -- 0:05:30
106000 -- [-2208.180] (-2213.672) (-2208.324) (-2206.703) * (-2218.834) [-2208.286] (-2213.476) (-2205.121) -- 0:05:28
106500 -- (-2212.905) [-2204.329] (-2209.362) (-2212.428) * (-2213.226) [-2208.254] (-2206.863) (-2208.819) -- 0:05:27
107000 -- (-2206.791) [-2207.045] (-2215.637) (-2203.027) * [-2208.836] (-2204.041) (-2210.954) (-2210.018) -- 0:05:25
107500 -- (-2207.237) [-2208.973] (-2202.640) (-2205.581) * (-2219.708) [-2201.752] (-2211.432) (-2201.834) -- 0:05:32
108000 -- [-2203.416] (-2215.223) (-2204.519) (-2206.645) * (-2210.536) (-2219.267) (-2214.523) [-2201.951] -- 0:05:30
108500 -- (-2203.346) (-2213.918) [-2209.553] (-2204.481) * (-2213.199) (-2206.153) [-2211.829] (-2201.303) -- 0:05:28
109000 -- (-2207.333) (-2217.445) [-2200.837] (-2205.606) * (-2210.149) (-2207.247) (-2211.242) [-2201.530] -- 0:05:26
109500 -- (-2209.225) (-2216.153) [-2206.651] (-2202.579) * (-2204.218) [-2202.466] (-2210.502) (-2205.452) -- 0:05:25
110000 -- (-2207.523) (-2212.959) (-2205.969) [-2200.570] * (-2207.418) (-2209.409) (-2207.756) [-2200.308] -- 0:05:23
Average standard deviation of split frequencies: 0.017647
110500 -- (-2217.372) [-2212.153] (-2212.704) (-2209.893) * (-2216.314) (-2211.312) (-2208.762) [-2203.076] -- 0:05:30
111000 -- (-2208.691) [-2210.595] (-2221.355) (-2214.397) * (-2206.658) (-2208.621) (-2218.697) [-2206.187] -- 0:05:28
111500 -- [-2200.769] (-2210.202) (-2204.561) (-2210.538) * (-2208.709) [-2206.660] (-2219.149) (-2205.093) -- 0:05:26
112000 -- (-2207.226) [-2209.130] (-2215.572) (-2203.707) * (-2215.493) (-2212.984) [-2204.880] (-2204.200) -- 0:05:25
112500 -- (-2207.712) (-2202.905) (-2207.404) [-2202.733] * (-2210.858) (-2206.305) (-2205.412) [-2198.116] -- 0:05:23
113000 -- (-2210.001) [-2204.520] (-2208.776) (-2210.998) * (-2212.720) (-2210.544) [-2206.997] (-2205.634) -- 0:05:29
113500 -- (-2204.126) [-2199.694] (-2206.988) (-2207.606) * [-2203.301] (-2207.022) (-2211.362) (-2204.484) -- 0:05:28
114000 -- (-2206.279) (-2206.360) [-2205.552] (-2205.775) * (-2204.683) (-2202.021) (-2214.880) [-2201.631] -- 0:05:26
114500 -- [-2209.226] (-2210.728) (-2205.396) (-2204.832) * (-2205.542) (-2201.566) (-2210.838) [-2204.456] -- 0:05:24
115000 -- (-2212.072) [-2204.853] (-2207.081) (-2207.068) * [-2207.693] (-2206.563) (-2208.470) (-2213.164) -- 0:05:23
Average standard deviation of split frequencies: 0.016255
115500 -- (-2211.742) (-2211.277) [-2208.768] (-2207.150) * (-2217.212) (-2205.876) [-2208.874] (-2205.689) -- 0:05:21
116000 -- (-2215.980) (-2202.504) (-2210.601) [-2207.821] * (-2220.145) [-2205.381] (-2216.670) (-2206.107) -- 0:05:27
116500 -- (-2213.337) (-2206.814) [-2207.260] (-2208.071) * (-2216.800) (-2214.445) [-2208.248] (-2204.284) -- 0:05:26
117000 -- [-2206.844] (-2206.674) (-2208.017) (-2209.276) * (-2211.085) (-2209.800) [-2205.526] (-2207.167) -- 0:05:24
117500 -- (-2205.668) (-2201.978) [-2202.640] (-2210.554) * [-2207.192] (-2207.176) (-2205.816) (-2207.328) -- 0:05:22
118000 -- (-2206.258) [-2200.978] (-2221.447) (-2204.002) * (-2213.952) [-2204.843] (-2210.832) (-2212.626) -- 0:05:21
118500 -- (-2210.942) [-2203.199] (-2203.748) (-2204.995) * (-2216.016) [-2204.603] (-2216.395) (-2205.045) -- 0:05:27
119000 -- (-2214.168) (-2209.113) [-2205.507] (-2208.065) * (-2207.725) (-2206.625) [-2212.741] (-2210.168) -- 0:05:25
119500 -- (-2214.611) (-2206.429) [-2206.082] (-2203.564) * (-2207.792) [-2207.341] (-2206.240) (-2211.010) -- 0:05:24
120000 -- (-2214.387) [-2201.645] (-2209.555) (-2203.237) * (-2224.473) (-2207.367) (-2205.893) [-2220.125] -- 0:05:22
Average standard deviation of split frequencies: 0.015069
120500 -- (-2203.877) (-2206.889) [-2215.601] (-2215.335) * (-2207.821) (-2206.078) [-2202.377] (-2203.820) -- 0:05:21
121000 -- (-2207.392) [-2205.733] (-2205.926) (-2207.515) * (-2209.336) (-2207.729) [-2208.669] (-2202.428) -- 0:05:26
121500 -- (-2202.125) (-2202.151) [-2203.336] (-2211.109) * [-2207.595] (-2208.124) (-2207.594) (-2205.593) -- 0:05:25
122000 -- (-2215.400) (-2217.427) [-2201.443] (-2200.785) * (-2206.594) (-2220.597) (-2205.042) [-2199.831] -- 0:05:23
122500 -- (-2208.779) (-2204.448) [-2204.011] (-2215.772) * (-2203.748) (-2212.389) [-2208.550] (-2210.843) -- 0:05:22
123000 -- (-2210.430) [-2202.318] (-2207.303) (-2209.639) * [-2205.694] (-2214.497) (-2211.718) (-2211.042) -- 0:05:20
123500 -- (-2210.323) [-2199.956] (-2210.277) (-2209.380) * [-2200.802] (-2206.167) (-2206.595) (-2211.103) -- 0:05:19
124000 -- (-2208.609) (-2201.849) [-2215.356] (-2205.553) * (-2206.032) (-2204.032) [-2200.791] (-2205.359) -- 0:05:24
124500 -- [-2202.790] (-2202.984) (-2205.861) (-2210.168) * [-2210.981] (-2205.302) (-2214.244) (-2205.821) -- 0:05:23
125000 -- (-2211.540) [-2204.380] (-2215.820) (-2205.511) * [-2203.891] (-2210.189) (-2213.757) (-2208.114) -- 0:05:22
Average standard deviation of split frequencies: 0.013896
125500 -- [-2205.554] (-2205.364) (-2209.462) (-2207.887) * [-2204.144] (-2210.965) (-2212.249) (-2205.059) -- 0:05:20
126000 -- (-2211.886) [-2203.340] (-2206.914) (-2208.464) * (-2212.542) (-2211.527) (-2206.790) [-2213.403] -- 0:05:19
126500 -- (-2204.136) (-2208.684) [-2213.055] (-2203.728) * (-2200.031) (-2213.434) [-2206.806] (-2206.399) -- 0:05:24
127000 -- (-2204.367) (-2206.111) (-2217.251) [-2203.555] * (-2202.051) [-2208.571] (-2205.790) (-2205.745) -- 0:05:23
127500 -- (-2212.029) (-2204.802) (-2219.962) [-2203.742] * (-2213.727) [-2204.898] (-2203.513) (-2209.868) -- 0:05:21
128000 -- (-2210.192) (-2203.050) [-2208.963] (-2200.217) * (-2202.783) [-2212.859] (-2199.306) (-2212.718) -- 0:05:20
128500 -- (-2203.296) [-2203.781] (-2206.188) (-2208.970) * (-2208.528) [-2207.547] (-2205.395) (-2205.014) -- 0:05:18
129000 -- (-2211.032) (-2205.618) (-2221.975) [-2202.922] * (-2211.312) (-2210.273) (-2204.626) [-2211.664] -- 0:05:17
129500 -- (-2208.323) (-2207.235) [-2209.705] (-2218.366) * [-2204.794] (-2215.669) (-2215.593) (-2217.732) -- 0:05:22
130000 -- (-2201.921) (-2201.323) [-2210.157] (-2216.285) * (-2200.766) [-2207.491] (-2210.891) (-2216.844) -- 0:05:21
Average standard deviation of split frequencies: 0.011338
130500 -- (-2206.775) (-2201.902) [-2209.984] (-2216.030) * (-2207.403) [-2208.591] (-2206.344) (-2207.598) -- 0:05:19
131000 -- (-2206.140) [-2200.212] (-2211.038) (-2214.106) * (-2211.339) (-2205.865) (-2211.243) [-2201.273] -- 0:05:18
131500 -- (-2212.013) (-2214.945) (-2210.405) [-2206.262] * [-2207.842] (-2207.925) (-2211.542) (-2211.727) -- 0:05:17
132000 -- (-2213.577) (-2207.516) [-2204.567] (-2207.071) * [-2205.709] (-2206.311) (-2204.727) (-2205.810) -- 0:05:22
132500 -- (-2211.009) [-2211.928] (-2204.230) (-2210.195) * (-2206.391) (-2210.246) [-2204.079] (-2205.334) -- 0:05:20
133000 -- (-2216.082) (-2208.244) (-2204.081) [-2209.699] * (-2203.810) (-2203.870) [-2205.436] (-2208.303) -- 0:05:19
133500 -- (-2198.628) (-2218.416) (-2205.987) [-2206.140] * (-2201.645) (-2204.783) (-2212.478) [-2205.518] -- 0:05:18
134000 -- (-2215.842) (-2207.892) [-2206.527] (-2212.030) * [-2208.404] (-2201.005) (-2210.106) (-2207.557) -- 0:05:16
134500 -- (-2206.398) (-2207.392) [-2211.208] (-2207.324) * (-2203.063) (-2203.826) (-2206.266) [-2204.228] -- 0:05:15
135000 -- (-2202.107) [-2198.556] (-2207.526) (-2206.936) * (-2203.952) (-2207.730) [-2204.467] (-2209.560) -- 0:05:20
Average standard deviation of split frequencies: 0.010399
135500 -- (-2210.149) [-2199.046] (-2213.729) (-2213.065) * (-2207.552) [-2202.693] (-2210.052) (-2208.228) -- 0:05:19
136000 -- (-2209.758) (-2205.867) [-2204.616] (-2217.595) * [-2205.053] (-2212.160) (-2205.645) (-2209.698) -- 0:05:17
136500 -- (-2207.702) (-2206.161) [-2206.366] (-2211.242) * (-2214.144) (-2211.906) [-2202.764] (-2210.855) -- 0:05:16
137000 -- (-2208.126) (-2207.214) (-2209.295) [-2204.728] * [-2208.086] (-2207.010) (-2220.728) (-2206.180) -- 0:05:14
137500 -- (-2206.297) (-2216.269) [-2214.280] (-2203.418) * (-2209.454) [-2208.889] (-2203.683) (-2199.129) -- 0:05:19
138000 -- (-2208.531) (-2209.652) (-2203.015) [-2207.094] * [-2210.391] (-2207.464) (-2207.078) (-2208.216) -- 0:05:18
138500 -- (-2211.064) (-2202.642) [-2201.694] (-2207.283) * (-2212.268) (-2208.171) (-2205.428) [-2207.320] -- 0:05:17
139000 -- (-2207.092) [-2201.970] (-2204.692) (-2210.204) * (-2210.182) (-2204.422) [-2205.116] (-2209.552) -- 0:05:15
139500 -- (-2212.394) (-2200.146) (-2209.292) [-2203.086] * (-2216.621) (-2208.398) [-2204.475] (-2212.058) -- 0:05:14
140000 -- [-2204.502] (-2204.064) (-2207.498) (-2207.264) * (-2214.305) [-2207.526] (-2204.083) (-2203.919) -- 0:05:13
Average standard deviation of split frequencies: 0.010054
140500 -- (-2206.273) [-2205.704] (-2211.851) (-2210.349) * (-2217.429) [-2205.496] (-2208.567) (-2207.781) -- 0:05:18
141000 -- (-2201.479) (-2208.027) (-2207.566) [-2210.624] * (-2213.160) (-2205.441) (-2213.375) [-2203.532] -- 0:05:16
141500 -- (-2212.847) (-2211.182) (-2210.077) [-2204.217] * (-2209.858) [-2205.621] (-2214.216) (-2214.964) -- 0:05:15
142000 -- (-2203.046) (-2204.226) (-2204.041) [-2204.648] * (-2204.019) [-2205.036] (-2211.323) (-2205.911) -- 0:05:14
142500 -- (-2205.666) (-2206.098) (-2207.896) [-2198.884] * (-2210.110) (-2202.316) (-2209.656) [-2207.519] -- 0:05:12
143000 -- (-2206.181) [-2205.375] (-2205.720) (-2209.361) * (-2210.880) [-2204.413] (-2207.576) (-2213.154) -- 0:05:17
143500 -- (-2206.812) (-2209.151) [-2206.769] (-2202.824) * (-2212.350) (-2210.165) [-2205.024] (-2210.993) -- 0:05:16
144000 -- (-2204.881) [-2207.321] (-2210.535) (-2201.844) * (-2204.131) (-2208.201) [-2203.655] (-2207.424) -- 0:05:15
144500 -- (-2208.768) [-2205.155] (-2212.181) (-2206.146) * (-2202.778) [-2208.009] (-2202.221) (-2208.035) -- 0:05:13
145000 -- (-2217.238) [-2199.042] (-2209.492) (-2208.088) * (-2210.653) (-2206.633) [-2205.270] (-2206.299) -- 0:05:12
Average standard deviation of split frequencies: 0.008610
145500 -- (-2215.058) (-2206.083) (-2207.788) [-2203.730] * [-2207.658] (-2210.057) (-2214.880) (-2204.745) -- 0:05:11
146000 -- [-2202.251] (-2214.068) (-2213.424) (-2200.713) * (-2206.852) [-2204.336] (-2209.459) (-2211.694) -- 0:05:15
146500 -- (-2209.852) (-2207.035) [-2201.416] (-2208.522) * [-2203.138] (-2208.970) (-2214.334) (-2209.093) -- 0:05:14
147000 -- (-2207.152) (-2208.216) (-2205.172) [-2202.748] * [-2204.626] (-2201.617) (-2205.566) (-2204.138) -- 0:05:13
147500 -- (-2210.960) (-2206.806) [-2206.095] (-2208.830) * (-2203.683) (-2201.494) [-2210.273] (-2204.468) -- 0:05:12
148000 -- [-2210.613] (-2206.220) (-2214.881) (-2208.947) * (-2202.152) (-2212.884) [-2206.622] (-2203.871) -- 0:05:10
148500 -- (-2210.773) (-2203.252) (-2202.982) [-2200.775] * [-2201.428] (-2201.569) (-2214.025) (-2207.368) -- 0:05:15
149000 -- (-2206.676) (-2203.654) [-2205.556] (-2203.528) * [-2205.590] (-2207.085) (-2214.210) (-2207.866) -- 0:05:14
149500 -- (-2206.114) [-2206.637] (-2206.684) (-2206.011) * [-2203.859] (-2205.554) (-2214.326) (-2210.415) -- 0:05:12
150000 -- (-2205.031) [-2200.610] (-2211.119) (-2207.703) * [-2201.851] (-2209.626) (-2208.340) (-2202.373) -- 0:05:11
Average standard deviation of split frequencies: 0.008865
150500 -- (-2205.999) (-2202.322) [-2205.033] (-2206.006) * (-2206.708) (-2211.779) (-2218.279) [-2213.653] -- 0:05:10
151000 -- (-2203.119) (-2209.600) (-2212.529) [-2204.877] * [-2211.030] (-2206.941) (-2208.077) (-2216.780) -- 0:05:09
151500 -- [-2202.072] (-2206.686) (-2215.211) (-2207.448) * (-2209.363) [-2212.945] (-2206.390) (-2211.328) -- 0:05:13
152000 -- (-2209.430) (-2206.909) [-2207.361] (-2206.361) * (-2211.801) (-2215.879) [-2208.917] (-2211.165) -- 0:05:12
152500 -- (-2215.173) (-2208.584) [-2218.715] (-2206.010) * (-2210.989) (-2212.205) (-2210.880) [-2210.396] -- 0:05:11
153000 -- (-2212.862) (-2213.009) (-2209.158) [-2203.654] * (-2210.391) [-2209.097] (-2200.609) (-2206.830) -- 0:05:10
153500 -- (-2210.391) (-2200.975) [-2215.506] (-2201.702) * [-2205.642] (-2214.049) (-2207.156) (-2221.715) -- 0:05:08
154000 -- (-2206.182) (-2204.076) [-2204.743] (-2206.846) * [-2203.491] (-2198.717) (-2204.135) (-2207.966) -- 0:05:13
154500 -- (-2207.120) (-2206.284) (-2207.028) [-2201.095] * (-2206.823) (-2213.302) (-2213.817) [-2207.712] -- 0:05:11
155000 -- (-2213.465) (-2204.407) (-2202.033) [-2209.280] * (-2204.126) (-2220.577) (-2205.199) [-2211.884] -- 0:05:10
Average standard deviation of split frequencies: 0.009065
155500 -- (-2206.311) (-2203.848) [-2217.940] (-2209.345) * (-2219.627) (-2210.785) (-2201.201) [-2209.375] -- 0:05:09
156000 -- (-2208.091) (-2217.739) (-2211.717) [-2200.882] * (-2212.456) (-2205.548) [-2209.865] (-2209.315) -- 0:05:08
156500 -- (-2208.120) [-2203.241] (-2205.960) (-2210.168) * (-2215.432) [-2206.683] (-2204.290) (-2215.806) -- 0:05:12
157000 -- (-2209.876) (-2212.255) [-2214.229] (-2213.449) * (-2205.029) (-2204.251) (-2207.997) [-2211.466] -- 0:05:11
157500 -- (-2202.033) [-2201.953] (-2207.982) (-2209.371) * (-2213.258) (-2205.532) (-2204.947) [-2200.925] -- 0:05:10
158000 -- (-2205.209) (-2205.466) (-2206.224) [-2207.436] * (-2215.431) (-2207.706) (-2207.370) [-2211.441] -- 0:05:09
158500 -- (-2202.969) (-2204.291) [-2205.180] (-2212.628) * (-2205.766) [-2205.951] (-2212.106) (-2215.455) -- 0:05:07
159000 -- (-2208.455) [-2209.671] (-2201.246) (-2209.672) * (-2207.460) [-2206.961] (-2200.206) (-2209.238) -- 0:05:06
159500 -- (-2200.818) [-2205.117] (-2212.053) (-2207.360) * (-2211.242) (-2208.152) (-2207.303) [-2210.487] -- 0:05:10
160000 -- (-2212.068) (-2210.466) (-2206.618) [-2206.407] * (-2209.362) (-2215.447) [-2203.472] (-2211.095) -- 0:05:09
Average standard deviation of split frequencies: 0.007335
160500 -- [-2209.353] (-2207.852) (-2209.535) (-2201.101) * [-2207.456] (-2208.003) (-2210.166) (-2202.340) -- 0:05:08
161000 -- (-2202.868) (-2205.138) (-2205.287) [-2203.144] * [-2204.960] (-2221.504) (-2209.313) (-2209.269) -- 0:05:07
161500 -- (-2211.298) (-2204.379) [-2212.622] (-2215.973) * (-2218.715) (-2210.681) (-2209.248) [-2203.295] -- 0:05:06
162000 -- (-2209.506) [-2202.090] (-2211.715) (-2203.857) * (-2212.702) [-2210.532] (-2215.329) (-2206.467) -- 0:05:10
162500 -- (-2202.491) (-2200.360) [-2212.152] (-2205.031) * (-2205.066) (-2217.426) [-2205.033] (-2207.609) -- 0:05:09
163000 -- (-2204.439) (-2200.870) (-2202.594) [-2206.943] * [-2203.232] (-2212.640) (-2205.274) (-2201.358) -- 0:05:08
163500 -- (-2210.290) [-2204.938] (-2206.648) (-2217.996) * (-2210.962) (-2201.920) [-2199.909] (-2214.938) -- 0:05:06
164000 -- (-2204.627) (-2219.191) (-2216.915) [-2203.941] * (-2206.965) (-2206.714) [-2206.657] (-2207.021) -- 0:05:05
164500 -- (-2207.018) [-2214.652] (-2213.081) (-2204.659) * (-2203.243) [-2209.982] (-2206.286) (-2211.704) -- 0:05:04
165000 -- (-2204.026) (-2214.637) (-2204.847) [-2204.015] * (-2207.886) (-2210.962) [-2202.006] (-2207.026) -- 0:05:08
Average standard deviation of split frequencies: 0.008519
165500 -- [-2207.111] (-2219.435) (-2205.389) (-2213.078) * [-2204.278] (-2204.460) (-2203.101) (-2207.289) -- 0:05:07
166000 -- [-2205.009] (-2208.298) (-2201.323) (-2200.595) * (-2208.484) [-2205.269] (-2208.048) (-2209.082) -- 0:05:06
166500 -- (-2213.965) [-2209.420] (-2211.373) (-2200.725) * [-2213.373] (-2206.263) (-2212.184) (-2214.420) -- 0:05:05
167000 -- (-2202.498) [-2206.441] (-2209.963) (-2208.161) * (-2210.505) [-2204.160] (-2206.863) (-2208.690) -- 0:05:04
167500 -- (-2205.465) (-2206.024) [-2209.668] (-2210.072) * (-2213.461) (-2209.786) [-2203.338] (-2216.283) -- 0:05:08
168000 -- (-2205.847) (-2213.684) (-2207.728) [-2205.320] * [-2210.916] (-2199.626) (-2207.995) (-2208.095) -- 0:05:07
168500 -- (-2205.332) (-2206.751) (-2197.018) [-2210.433] * (-2218.877) [-2206.947] (-2205.726) (-2207.316) -- 0:05:05
169000 -- (-2203.607) (-2209.345) (-2203.773) [-2207.879] * (-2212.638) [-2202.463] (-2217.296) (-2213.134) -- 0:05:04
169500 -- (-2201.129) (-2205.962) [-2204.086] (-2206.053) * (-2210.395) [-2204.237] (-2213.855) (-2213.644) -- 0:05:03
170000 -- (-2203.715) (-2211.988) [-2205.608] (-2202.581) * [-2205.449] (-2208.637) (-2218.146) (-2210.648) -- 0:05:02
Average standard deviation of split frequencies: 0.009207
170500 -- (-2208.272) [-2201.348] (-2204.273) (-2208.110) * (-2212.631) (-2210.223) (-2217.778) [-2211.388] -- 0:05:06
171000 -- (-2208.156) [-2204.860] (-2208.738) (-2201.668) * [-2210.073] (-2206.178) (-2207.986) (-2210.350) -- 0:05:05
171500 -- [-2206.683] (-2205.874) (-2214.506) (-2206.342) * (-2205.014) [-2205.977] (-2209.317) (-2204.949) -- 0:05:04
172000 -- (-2210.311) [-2206.812] (-2213.556) (-2207.290) * (-2205.605) (-2202.642) (-2214.208) [-2203.797] -- 0:05:03
172500 -- (-2206.047) [-2204.200] (-2203.755) (-2212.481) * [-2197.960] (-2204.571) (-2213.461) (-2216.251) -- 0:05:02
173000 -- (-2204.552) (-2209.626) [-2207.180] (-2210.902) * [-2200.100] (-2205.915) (-2207.993) (-2207.056) -- 0:05:05
173500 -- (-2202.141) (-2203.102) [-2200.990] (-2206.759) * (-2208.509) [-2204.548] (-2208.461) (-2207.542) -- 0:05:04
174000 -- (-2205.777) (-2209.353) (-2213.746) [-2202.679] * (-2211.120) (-2204.698) (-2223.179) [-2206.016] -- 0:05:03
174500 -- (-2209.557) (-2199.469) [-2207.599] (-2203.345) * (-2209.550) (-2207.065) [-2208.377] (-2205.723) -- 0:05:02
175000 -- (-2215.388) [-2201.854] (-2209.418) (-2205.210) * (-2207.257) (-2210.312) [-2204.501] (-2216.153) -- 0:05:01
Average standard deviation of split frequencies: 0.007142
175500 -- (-2210.138) (-2209.494) (-2203.286) [-2199.465] * (-2208.234) (-2205.439) (-2204.427) [-2213.491] -- 0:05:00
176000 -- (-2205.643) (-2201.598) [-2201.617] (-2206.094) * [-2208.447] (-2216.071) (-2213.097) (-2212.529) -- 0:05:04
176500 -- (-2214.149) [-2207.490] (-2224.478) (-2209.336) * [-2212.937] (-2208.684) (-2208.945) (-2216.272) -- 0:05:03
177000 -- (-2202.909) [-2216.832] (-2207.804) (-2217.656) * [-2202.792] (-2216.190) (-2216.970) (-2207.987) -- 0:05:02
177500 -- (-2211.121) (-2207.854) (-2201.568) [-2207.404] * (-2209.403) (-2216.041) (-2203.765) [-2201.705] -- 0:05:01
178000 -- (-2206.228) [-2204.483] (-2205.727) (-2209.921) * (-2202.143) (-2212.052) (-2207.957) [-2206.573] -- 0:05:00
178500 -- (-2214.136) (-2209.915) (-2205.368) [-2218.787] * (-2207.896) (-2201.223) [-2204.499] (-2217.764) -- 0:05:03
179000 -- [-2201.629] (-2211.239) (-2203.951) (-2217.613) * (-2203.297) [-2210.502] (-2212.099) (-2208.447) -- 0:05:02
179500 -- (-2211.163) (-2208.180) (-2206.003) [-2214.483] * (-2208.830) [-2204.986] (-2212.518) (-2216.766) -- 0:05:01
180000 -- (-2204.859) [-2206.107] (-2205.013) (-2204.972) * (-2214.753) [-2206.766] (-2210.124) (-2214.043) -- 0:05:00
Average standard deviation of split frequencies: 0.006958
180500 -- (-2206.966) [-2201.778] (-2204.032) (-2212.787) * (-2211.902) [-2206.509] (-2208.612) (-2212.861) -- 0:04:59
181000 -- (-2205.253) (-2211.691) [-2214.335] (-2208.329) * (-2201.080) (-2211.131) (-2207.420) [-2203.930] -- 0:04:58
181500 -- [-2202.313] (-2211.603) (-2205.125) (-2206.108) * (-2209.477) (-2208.665) (-2216.289) [-2207.562] -- 0:05:02
182000 -- (-2210.470) [-2213.608] (-2199.992) (-2213.684) * (-2213.188) [-2206.819] (-2223.193) (-2209.114) -- 0:05:01
182500 -- (-2204.916) [-2202.724] (-2214.910) (-2210.421) * (-2210.609) [-2209.817] (-2209.399) (-2209.931) -- 0:05:00
183000 -- (-2210.018) (-2216.642) (-2209.918) [-2205.009] * (-2208.465) (-2215.679) (-2205.353) [-2203.471] -- 0:04:59
183500 -- (-2209.697) [-2204.858] (-2210.137) (-2207.811) * (-2217.211) (-2214.785) [-2203.526] (-2208.138) -- 0:04:58
184000 -- [-2209.142] (-2199.684) (-2209.124) (-2207.335) * (-2206.534) (-2207.250) [-2213.105] (-2213.203) -- 0:05:01
184500 -- (-2209.666) (-2208.053) [-2213.153] (-2211.496) * (-2205.431) (-2206.547) [-2204.536] (-2213.204) -- 0:05:00
185000 -- [-2205.955] (-2209.172) (-2200.174) (-2209.321) * (-2208.470) (-2205.882) [-2203.197] (-2206.759) -- 0:04:59
Average standard deviation of split frequencies: 0.009293
185500 -- (-2206.868) (-2202.387) [-2206.657] (-2200.978) * (-2207.589) (-2202.586) [-2210.662] (-2204.008) -- 0:04:58
186000 -- [-2202.710] (-2210.530) (-2208.106) (-2203.733) * (-2206.246) [-2200.616] (-2211.936) (-2211.733) -- 0:04:57
186500 -- (-2213.514) (-2209.358) (-2208.592) [-2199.711] * (-2201.569) [-2202.286] (-2210.709) (-2208.731) -- 0:04:56
187000 -- (-2220.353) (-2212.712) [-2202.305] (-2202.270) * [-2201.845] (-2207.392) (-2223.544) (-2213.098) -- 0:04:59
187500 -- (-2209.581) [-2203.302] (-2210.419) (-2201.411) * (-2203.856) (-2208.047) [-2208.960] (-2211.072) -- 0:04:59
188000 -- [-2205.379] (-2206.539) (-2209.567) (-2205.125) * (-2205.798) (-2203.563) [-2206.231] (-2217.236) -- 0:04:58
188500 -- [-2208.259] (-2213.136) (-2204.372) (-2209.847) * [-2207.520] (-2212.214) (-2209.054) (-2207.388) -- 0:04:57
189000 -- (-2203.149) (-2212.586) [-2201.378] (-2210.986) * (-2217.479) (-2206.473) (-2200.715) [-2204.090] -- 0:04:56
189500 -- [-2214.524] (-2213.813) (-2204.324) (-2210.357) * (-2213.107) (-2209.921) [-2207.851] (-2204.884) -- 0:04:59
190000 -- (-2211.826) (-2212.235) (-2203.109) [-2205.205] * (-2208.977) [-2208.688] (-2202.318) (-2210.928) -- 0:04:58
Average standard deviation of split frequencies: 0.009065
190500 -- (-2208.281) [-2204.556] (-2209.721) (-2202.493) * (-2203.704) (-2210.442) [-2204.508] (-2220.279) -- 0:04:57
191000 -- (-2207.078) [-2203.307] (-2201.890) (-2206.549) * [-2204.780] (-2208.595) (-2201.993) (-2211.237) -- 0:04:56
191500 -- (-2203.556) [-2202.117] (-2209.883) (-2208.643) * [-2215.280] (-2212.503) (-2205.524) (-2216.170) -- 0:04:55
192000 -- (-2210.017) (-2202.856) (-2210.137) [-2211.257] * (-2212.899) (-2202.446) (-2206.487) [-2206.124] -- 0:04:54
192500 -- (-2205.358) (-2207.484) [-2203.976] (-2205.227) * [-2204.543] (-2202.465) (-2198.782) (-2209.332) -- 0:04:57
193000 -- (-2201.066) (-2206.585) (-2213.431) [-2204.196] * (-2215.142) [-2207.691] (-2208.846) (-2213.357) -- 0:04:56
193500 -- (-2199.854) [-2205.041] (-2212.536) (-2212.870) * [-2205.182] (-2213.437) (-2207.019) (-2208.389) -- 0:04:55
194000 -- (-2201.093) (-2206.915) [-2203.292] (-2211.053) * (-2208.441) [-2202.797] (-2206.594) (-2206.031) -- 0:04:54
194500 -- (-2201.761) (-2207.498) [-2207.276] (-2216.790) * (-2206.107) [-2205.768] (-2204.575) (-2210.479) -- 0:04:54
195000 -- [-2206.038] (-2210.084) (-2221.839) (-2221.112) * [-2207.778] (-2210.636) (-2201.369) (-2206.830) -- 0:04:57
Average standard deviation of split frequencies: 0.010021
195500 -- [-2210.149] (-2210.874) (-2207.307) (-2211.966) * (-2208.646) [-2210.763] (-2204.970) (-2199.932) -- 0:04:56
196000 -- [-2204.316] (-2209.087) (-2206.838) (-2206.923) * (-2207.818) (-2208.552) [-2208.307] (-2209.441) -- 0:04:55
196500 -- [-2205.213] (-2201.436) (-2210.545) (-2215.447) * (-2211.100) [-2207.736] (-2208.261) (-2211.381) -- 0:04:54
197000 -- [-2205.403] (-2204.266) (-2212.525) (-2205.881) * (-2208.447) [-2203.572] (-2208.671) (-2206.631) -- 0:04:53
197500 -- [-2205.093] (-2205.628) (-2213.751) (-2212.297) * (-2204.272) [-2203.361] (-2210.946) (-2206.229) -- 0:04:56
198000 -- [-2201.984] (-2210.619) (-2210.519) (-2209.258) * [-2205.101] (-2207.484) (-2214.818) (-2210.526) -- 0:04:55
198500 -- (-2205.216) [-2203.064] (-2211.923) (-2210.481) * (-2205.608) [-2204.302] (-2207.063) (-2206.230) -- 0:04:54
199000 -- [-2204.605] (-2213.333) (-2208.632) (-2218.885) * [-2206.825] (-2210.778) (-2200.500) (-2205.347) -- 0:04:53
199500 -- (-2212.069) (-2200.071) (-2213.058) [-2204.039] * (-2211.818) [-2212.057] (-2209.259) (-2210.711) -- 0:04:52
200000 -- (-2201.408) (-2206.772) [-2206.796] (-2203.501) * [-2200.799] (-2206.213) (-2211.262) (-2204.506) -- 0:04:52
Average standard deviation of split frequencies: 0.008614
200500 -- [-2206.085] (-2202.727) (-2202.272) (-2214.580) * (-2213.060) [-2205.920] (-2207.793) (-2207.272) -- 0:04:55
201000 -- (-2205.947) [-2207.988] (-2206.742) (-2210.018) * (-2208.836) [-2202.390] (-2201.474) (-2206.722) -- 0:04:54
201500 -- (-2208.137) [-2207.530] (-2206.415) (-2211.401) * (-2211.691) (-2207.947) [-2209.178] (-2211.538) -- 0:04:53
202000 -- (-2206.273) (-2210.981) [-2209.284] (-2205.251) * (-2205.306) (-2210.100) [-2207.098] (-2208.005) -- 0:04:52
202500 -- (-2200.593) [-2204.080] (-2209.793) (-2216.979) * [-2209.939] (-2214.571) (-2206.626) (-2211.366) -- 0:04:51
203000 -- (-2208.383) (-2203.034) [-2203.991] (-2212.800) * [-2201.972] (-2209.887) (-2207.365) (-2207.858) -- 0:04:54
203500 -- (-2206.582) [-2209.832] (-2208.484) (-2209.814) * (-2202.901) [-2209.648] (-2209.057) (-2211.678) -- 0:04:53
204000 -- [-2205.892] (-2214.701) (-2206.260) (-2209.878) * (-2216.223) (-2205.762) [-2205.926] (-2205.649) -- 0:04:52
204500 -- (-2214.432) (-2208.281) (-2206.702) [-2204.593] * (-2214.925) (-2206.454) [-2201.936] (-2210.214) -- 0:04:51
205000 -- (-2204.565) (-2205.717) (-2209.820) [-2204.169] * (-2207.800) (-2205.906) (-2210.695) [-2208.383] -- 0:04:50
Average standard deviation of split frequencies: 0.006865
205500 -- [-2201.436] (-2209.585) (-2214.757) (-2207.290) * (-2210.305) [-2209.114] (-2204.724) (-2209.365) -- 0:04:49
206000 -- (-2214.841) (-2208.291) (-2214.657) [-2206.365] * (-2213.524) [-2217.893] (-2210.962) (-2199.717) -- 0:04:52
206500 -- (-2212.763) (-2209.658) [-2203.467] (-2207.907) * (-2210.942) (-2207.712) (-2215.585) [-2206.218] -- 0:04:52
207000 -- (-2209.964) [-2212.371] (-2200.050) (-2205.950) * (-2214.298) (-2210.392) (-2201.738) [-2213.923] -- 0:04:51
207500 -- (-2208.344) (-2209.379) [-2206.611] (-2209.664) * (-2215.870) (-2213.748) [-2209.688] (-2207.853) -- 0:04:50
208000 -- (-2203.505) [-2209.034] (-2206.866) (-2207.804) * (-2204.554) [-2209.831] (-2209.993) (-2209.724) -- 0:04:49
208500 -- (-2211.485) (-2208.686) [-2202.219] (-2214.002) * [-2207.061] (-2206.759) (-2204.300) (-2202.507) -- 0:04:52
209000 -- (-2206.561) [-2208.451] (-2206.371) (-2215.599) * (-2217.619) (-2217.981) (-2216.567) [-2204.252] -- 0:04:51
209500 -- (-2206.082) (-2208.471) [-2205.837] (-2215.310) * (-2207.982) (-2207.624) [-2200.702] (-2208.492) -- 0:04:50
210000 -- [-2199.428] (-2206.463) (-2203.005) (-2211.300) * [-2211.487] (-2201.466) (-2203.288) (-2201.904) -- 0:04:49
Average standard deviation of split frequencies: 0.008951
210500 -- (-2206.561) (-2206.532) [-2205.470] (-2208.600) * [-2208.402] (-2213.853) (-2205.672) (-2211.216) -- 0:04:48
211000 -- (-2206.695) [-2203.942] (-2206.075) (-2209.401) * (-2203.075) (-2210.200) [-2209.994] (-2216.131) -- 0:04:47
211500 -- (-2208.370) (-2218.064) [-2206.132] (-2221.939) * (-2206.143) (-2201.525) (-2206.869) [-2205.341] -- 0:04:50
212000 -- (-2207.954) (-2212.550) [-2203.136] (-2218.262) * [-2205.624] (-2210.598) (-2205.907) (-2205.638) -- 0:04:49
212500 -- [-2203.367] (-2213.441) (-2214.485) (-2212.064) * [-2204.770] (-2211.064) (-2212.055) (-2207.547) -- 0:04:49
213000 -- (-2206.463) [-2212.448] (-2213.348) (-2207.504) * (-2206.577) [-2207.581] (-2203.885) (-2214.294) -- 0:04:48
213500 -- [-2207.393] (-2207.532) (-2205.380) (-2206.426) * (-2209.500) (-2203.097) [-2209.965] (-2210.889) -- 0:04:47
214000 -- (-2217.461) (-2211.838) (-2207.156) [-2206.646] * [-2207.614] (-2211.958) (-2207.247) (-2207.393) -- 0:04:50
214500 -- [-2205.342] (-2213.565) (-2206.544) (-2203.276) * (-2207.000) (-2209.748) (-2207.467) [-2202.040] -- 0:04:49
215000 -- (-2201.386) [-2206.852] (-2203.845) (-2202.909) * (-2208.936) [-2210.524] (-2203.630) (-2208.164) -- 0:04:48
Average standard deviation of split frequencies: 0.008730
215500 -- (-2208.548) [-2205.911] (-2203.799) (-2213.170) * (-2217.549) (-2204.096) [-2208.969] (-2203.492) -- 0:04:47
216000 -- (-2210.164) (-2207.196) (-2208.639) [-2209.125] * (-2210.559) (-2209.169) (-2212.549) [-2208.932] -- 0:04:46
216500 -- (-2210.923) (-2203.243) [-2214.346] (-2207.123) * (-2205.856) (-2201.284) [-2207.863] (-2207.256) -- 0:04:45
217000 -- (-2215.141) (-2205.074) (-2210.968) [-2207.944] * (-2206.077) (-2214.849) [-2212.070] (-2201.763) -- 0:04:48
217500 -- [-2204.348] (-2202.691) (-2212.048) (-2207.699) * [-2200.260] (-2210.349) (-2204.049) (-2204.935) -- 0:04:47
218000 -- (-2204.655) [-2213.462] (-2211.058) (-2206.380) * (-2209.618) (-2201.413) (-2205.597) [-2203.424] -- 0:04:46
218500 -- [-2201.510] (-2199.082) (-2207.894) (-2207.760) * (-2209.888) (-2204.662) [-2214.937] (-2210.839) -- 0:04:46
219000 -- (-2203.798) (-2202.625) [-2211.734] (-2205.980) * (-2203.654) [-2204.551] (-2216.289) (-2214.608) -- 0:04:45
219500 -- (-2223.131) (-2211.989) [-2204.528] (-2204.833) * (-2202.848) [-2204.195] (-2217.503) (-2210.368) -- 0:04:48
220000 -- (-2211.836) [-2206.861] (-2207.934) (-2200.979) * (-2206.264) (-2219.373) (-2208.868) [-2208.918] -- 0:04:47
Average standard deviation of split frequencies: 0.009257
220500 -- (-2210.571) (-2205.976) (-2207.797) [-2205.249] * (-2205.817) (-2215.847) (-2202.265) [-2202.898] -- 0:04:46
221000 -- [-2210.704] (-2211.714) (-2207.484) (-2206.021) * (-2205.575) (-2204.931) (-2204.553) [-2210.120] -- 0:04:45
221500 -- (-2219.717) (-2203.586) [-2205.048] (-2214.609) * (-2211.865) (-2205.950) [-2210.657] (-2214.393) -- 0:04:44
222000 -- [-2206.548] (-2206.106) (-2204.396) (-2204.100) * (-2208.409) (-2211.657) [-2206.055] (-2203.540) -- 0:04:43
222500 -- [-2198.773] (-2206.954) (-2210.237) (-2215.720) * (-2211.288) (-2215.430) (-2205.404) [-2198.203] -- 0:04:46
223000 -- (-2198.681) (-2214.617) [-2202.619] (-2211.447) * (-2205.115) [-2209.346] (-2202.249) (-2209.080) -- 0:04:45
223500 -- [-2201.580] (-2208.413) (-2204.798) (-2214.625) * (-2210.920) [-2207.861] (-2214.697) (-2212.484) -- 0:04:44
224000 -- (-2209.109) [-2201.845] (-2205.175) (-2208.698) * [-2204.611] (-2208.316) (-2219.482) (-2215.040) -- 0:04:44
224500 -- (-2209.201) [-2199.886] (-2205.865) (-2219.567) * [-2203.378] (-2204.316) (-2210.122) (-2208.569) -- 0:04:43
225000 -- (-2207.201) [-2200.578] (-2208.696) (-2212.873) * (-2206.591) (-2217.310) [-2207.071] (-2214.045) -- 0:04:45
Average standard deviation of split frequencies: 0.009734
225500 -- (-2204.983) (-2200.057) [-2209.281] (-2205.530) * (-2207.275) (-2210.459) (-2206.734) [-2210.753] -- 0:04:45
226000 -- (-2209.284) [-2207.937] (-2208.948) (-2213.201) * (-2209.678) [-2208.493] (-2205.276) (-2208.189) -- 0:04:44
226500 -- [-2207.566] (-2202.318) (-2211.253) (-2208.903) * (-2206.271) [-2205.835] (-2217.834) (-2207.428) -- 0:04:43
227000 -- (-2213.169) (-2205.844) [-2207.279] (-2217.449) * [-2199.795] (-2207.830) (-2209.394) (-2204.921) -- 0:04:42
227500 -- (-2207.558) (-2213.236) [-2206.767] (-2207.813) * (-2207.944) [-2206.913] (-2206.030) (-2202.689) -- 0:04:45
228000 -- [-2204.075] (-2204.946) (-2208.652) (-2205.162) * (-2203.421) (-2216.291) [-2211.145] (-2205.253) -- 0:04:44
228500 -- [-2207.585] (-2213.023) (-2209.523) (-2206.324) * [-2201.769] (-2207.484) (-2218.607) (-2208.056) -- 0:04:43
229000 -- (-2204.625) [-2208.911] (-2210.504) (-2212.240) * (-2206.610) (-2209.211) (-2214.123) [-2202.254] -- 0:04:42
229500 -- (-2204.623) (-2206.197) (-2203.077) [-2210.727] * [-2204.238] (-2207.506) (-2208.908) (-2211.396) -- 0:04:42
230000 -- (-2207.362) (-2209.530) (-2200.750) [-2204.727] * (-2210.446) (-2208.422) [-2201.108] (-2216.347) -- 0:04:41
Average standard deviation of split frequencies: 0.008175
230500 -- [-2219.380] (-2203.713) (-2208.113) (-2206.612) * (-2207.318) [-2211.941] (-2206.804) (-2207.864) -- 0:04:43
231000 -- [-2213.475] (-2203.079) (-2207.494) (-2204.006) * (-2207.600) [-2208.176] (-2217.444) (-2213.602) -- 0:04:42
231500 -- (-2208.548) (-2205.656) (-2205.709) [-2204.200] * (-2199.499) (-2208.098) (-2210.965) [-2209.984] -- 0:04:42
232000 -- (-2209.219) [-2198.659] (-2213.388) (-2200.896) * (-2204.379) [-2199.594] (-2202.440) (-2205.887) -- 0:04:41
232500 -- (-2198.254) [-2203.661] (-2208.987) (-2207.340) * (-2205.017) [-2206.245] (-2212.953) (-2215.163) -- 0:04:40
233000 -- [-2201.291] (-2208.506) (-2219.523) (-2207.547) * (-2210.162) (-2210.238) (-2208.247) [-2208.225] -- 0:04:43
233500 -- (-2208.983) (-2208.307) (-2208.320) [-2212.284] * [-2205.109] (-2205.202) (-2206.674) (-2203.847) -- 0:04:42
234000 -- [-2203.483] (-2202.562) (-2213.192) (-2207.016) * (-2210.415) (-2210.581) [-2203.079] (-2207.667) -- 0:04:41
234500 -- (-2209.256) (-2205.657) (-2207.302) [-2204.322] * (-2204.152) (-2203.279) [-2206.030] (-2207.388) -- 0:04:40
235000 -- (-2202.491) (-2204.071) (-2206.418) [-2215.321] * (-2214.785) (-2220.040) [-2206.429] (-2210.153) -- 0:04:39
Average standard deviation of split frequencies: 0.007657
235500 -- (-2219.103) [-2201.739] (-2205.621) (-2221.071) * (-2207.900) (-2206.926) (-2203.623) [-2211.104] -- 0:04:42
236000 -- [-2213.700] (-2203.554) (-2204.198) (-2209.774) * (-2215.606) (-2207.903) (-2208.543) [-2208.092] -- 0:04:41
236500 -- (-2211.629) (-2205.138) (-2212.069) [-2207.999] * (-2212.664) (-2206.202) [-2210.696] (-2209.176) -- 0:04:40
237000 -- (-2211.611) [-2204.331] (-2210.623) (-2203.879) * (-2208.187) (-2204.249) (-2203.227) [-2201.278] -- 0:04:40
237500 -- [-2207.102] (-2207.211) (-2208.781) (-2207.853) * (-2210.791) (-2211.228) [-2209.910] (-2211.046) -- 0:04:39
238000 -- (-2211.341) [-2207.836] (-2217.144) (-2205.574) * [-2204.429] (-2216.473) (-2206.857) (-2219.350) -- 0:04:38
238500 -- [-2212.188] (-2206.640) (-2213.718) (-2204.554) * (-2205.703) (-2206.250) (-2203.218) [-2211.750] -- 0:04:40
239000 -- (-2216.382) [-2203.041] (-2203.190) (-2206.971) * [-2208.668] (-2201.365) (-2208.631) (-2211.660) -- 0:04:40
239500 -- (-2209.343) (-2203.268) [-2204.335] (-2217.022) * (-2209.350) (-2216.751) [-2208.314] (-2216.154) -- 0:04:39
240000 -- (-2204.124) [-2205.014] (-2204.167) (-2212.625) * [-2208.030] (-2205.234) (-2199.629) (-2207.415) -- 0:04:38
Average standard deviation of split frequencies: 0.010447
240500 -- (-2209.710) (-2206.202) (-2209.796) [-2205.251] * [-2203.222] (-2206.465) (-2207.591) (-2209.150) -- 0:04:37
241000 -- (-2206.272) (-2208.822) (-2206.341) [-2204.858] * (-2208.494) [-2201.247] (-2215.472) (-2206.655) -- 0:04:40
241500 -- (-2203.680) [-2212.106] (-2210.486) (-2211.680) * (-2207.650) (-2206.914) (-2215.578) [-2214.345] -- 0:04:39
242000 -- (-2204.192) (-2212.911) (-2209.256) [-2207.398] * [-2207.502] (-2207.219) (-2201.211) (-2213.117) -- 0:04:38
242500 -- (-2204.837) (-2213.237) (-2211.385) [-2216.157] * (-2201.214) (-2201.636) (-2204.020) [-2202.796] -- 0:04:38
243000 -- [-2207.060] (-2209.530) (-2203.804) (-2206.534) * [-2202.753] (-2204.766) (-2206.237) (-2216.045) -- 0:04:37
243500 -- (-2206.837) [-2199.396] (-2203.150) (-2209.001) * (-2203.926) (-2202.974) (-2206.525) [-2209.636] -- 0:04:39
244000 -- (-2210.893) (-2209.051) (-2205.543) [-2205.498] * (-2205.326) (-2207.772) (-2210.109) [-2205.826] -- 0:04:38
244500 -- (-2212.712) (-2214.603) (-2212.067) [-2205.676] * [-2208.297] (-2210.137) (-2205.187) (-2213.971) -- 0:04:38
245000 -- (-2201.767) [-2198.743] (-2207.768) (-2212.032) * (-2209.572) [-2209.857] (-2206.876) (-2214.530) -- 0:04:37
Average standard deviation of split frequencies: 0.012136
245500 -- (-2211.369) (-2201.543) [-2212.143] (-2207.202) * (-2205.577) (-2204.371) (-2213.176) [-2216.767] -- 0:04:36
246000 -- (-2207.739) [-2201.500] (-2212.450) (-2211.455) * (-2203.766) (-2203.095) [-2202.675] (-2210.533) -- 0:04:35
246500 -- (-2206.498) (-2209.101) (-2203.796) [-2207.603] * (-2203.401) [-2209.122] (-2204.696) (-2206.176) -- 0:04:38
247000 -- (-2213.466) (-2206.001) [-2209.294] (-2203.851) * (-2212.539) (-2213.215) (-2212.252) [-2203.719] -- 0:04:37
247500 -- (-2207.548) (-2212.312) (-2208.064) [-2204.659] * (-2209.932) (-2204.842) (-2212.226) [-2205.981] -- 0:04:36
248000 -- (-2213.471) [-2202.508] (-2209.644) (-2214.127) * (-2211.828) (-2207.523) (-2209.034) [-2200.386] -- 0:04:35
248500 -- (-2213.769) (-2203.558) [-2206.060] (-2214.215) * (-2209.076) [-2208.203] (-2211.399) (-2212.480) -- 0:04:35
249000 -- (-2206.923) (-2206.762) [-2203.577] (-2204.281) * (-2207.981) [-2208.689] (-2205.509) (-2216.425) -- 0:04:37
249500 -- (-2209.785) [-2208.771] (-2221.027) (-2206.914) * [-2205.892] (-2209.176) (-2213.302) (-2210.565) -- 0:04:36
250000 -- (-2204.059) (-2213.980) (-2212.050) [-2206.150] * (-2209.009) [-2209.153] (-2209.141) (-2209.153) -- 0:04:36
Average standard deviation of split frequencies: 0.010657
250500 -- (-2208.940) (-2204.322) (-2204.295) [-2201.155] * (-2203.323) (-2203.146) [-2202.470] (-2207.395) -- 0:04:35
251000 -- (-2205.481) [-2203.659] (-2214.984) (-2211.220) * [-2206.203] (-2210.619) (-2210.403) (-2202.125) -- 0:04:34
251500 -- (-2209.866) (-2201.404) [-2202.060] (-2208.331) * (-2204.791) (-2202.209) [-2208.499] (-2209.407) -- 0:04:33
252000 -- (-2205.289) [-2202.343] (-2207.275) (-2212.210) * (-2205.932) (-2200.945) (-2218.075) [-2206.426] -- 0:04:36
252500 -- (-2202.803) (-2209.231) (-2208.206) [-2216.221] * (-2208.521) (-2204.852) [-2199.892] (-2207.015) -- 0:04:35
253000 -- [-2205.424] (-2209.438) (-2214.640) (-2221.227) * [-2204.097] (-2212.776) (-2217.402) (-2210.994) -- 0:04:34
253500 -- [-2204.631] (-2204.951) (-2208.839) (-2203.412) * [-2209.830] (-2208.248) (-2206.916) (-2211.055) -- 0:04:33
254000 -- (-2209.173) [-2207.973] (-2207.389) (-2207.233) * (-2211.517) (-2205.087) [-2207.988] (-2209.046) -- 0:04:33
254500 -- (-2204.123) (-2211.402) [-2206.040] (-2209.924) * [-2210.131] (-2206.391) (-2225.729) (-2210.899) -- 0:04:35
255000 -- [-2201.043] (-2214.492) (-2207.297) (-2211.709) * (-2205.665) (-2217.692) [-2207.567] (-2212.590) -- 0:04:34
Average standard deviation of split frequencies: 0.010435
255500 -- [-2206.173] (-2211.247) (-2208.542) (-2208.750) * (-2212.599) (-2207.433) (-2208.760) [-2199.902] -- 0:04:33
256000 -- (-2209.777) [-2207.023] (-2206.513) (-2207.745) * [-2206.876] (-2204.601) (-2203.539) (-2200.891) -- 0:04:33
256500 -- [-2201.107] (-2207.834) (-2212.367) (-2208.720) * (-2215.251) (-2214.997) (-2208.806) [-2202.337] -- 0:04:32
257000 -- (-2205.170) [-2200.723] (-2213.435) (-2207.373) * (-2206.529) (-2207.925) (-2205.687) [-2206.321] -- 0:04:34
257500 -- [-2200.519] (-2206.350) (-2205.947) (-2209.599) * (-2205.666) (-2205.433) [-2208.736] (-2201.995) -- 0:04:33
258000 -- [-2201.255] (-2202.957) (-2216.185) (-2204.727) * (-2205.058) (-2208.717) (-2205.846) [-2212.250] -- 0:04:33
258500 -- (-2211.106) [-2209.132] (-2212.472) (-2211.980) * (-2203.049) (-2205.469) (-2210.752) [-2207.555] -- 0:04:32
259000 -- (-2210.007) [-2204.563] (-2205.972) (-2206.301) * (-2208.161) (-2213.285) [-2202.347] (-2202.237) -- 0:04:31
259500 -- (-2208.816) [-2206.810] (-2207.369) (-2200.722) * (-2207.022) [-2206.448] (-2205.036) (-2216.938) -- 0:04:31
260000 -- [-2207.216] (-2215.423) (-2202.341) (-2205.047) * (-2212.871) (-2205.904) (-2210.725) [-2199.598] -- 0:04:33
Average standard deviation of split frequencies: 0.011454
260500 -- (-2212.836) [-2204.977] (-2215.765) (-2202.095) * [-2207.458] (-2209.356) (-2210.659) (-2203.458) -- 0:04:32
261000 -- [-2201.984] (-2212.752) (-2209.545) (-2208.494) * (-2206.800) [-2200.126] (-2203.897) (-2199.563) -- 0:04:31
261500 -- [-2206.181] (-2210.441) (-2205.834) (-2213.676) * (-2215.785) (-2205.118) (-2215.798) [-2203.468] -- 0:04:31
262000 -- [-2204.629] (-2210.207) (-2201.637) (-2209.611) * (-2214.037) [-2206.454] (-2207.406) (-2203.706) -- 0:04:30
262500 -- (-2208.391) [-2204.213] (-2221.623) (-2214.088) * (-2207.480) (-2205.580) [-2204.600] (-2206.737) -- 0:04:32
263000 -- (-2209.518) [-2205.492] (-2205.272) (-2209.250) * (-2206.074) [-2200.816] (-2209.601) (-2205.698) -- 0:04:31
263500 -- (-2205.512) (-2206.006) [-2205.158] (-2212.299) * [-2207.741] (-2202.044) (-2205.559) (-2208.410) -- 0:04:31
264000 -- [-2204.640] (-2208.060) (-2205.960) (-2213.049) * (-2213.675) [-2206.001] (-2209.546) (-2215.085) -- 0:04:30
264500 -- (-2202.096) [-2202.138] (-2207.260) (-2218.832) * [-2205.113] (-2201.148) (-2216.711) (-2212.023) -- 0:04:29
265000 -- (-2213.467) [-2203.846] (-2206.795) (-2208.507) * (-2219.445) [-2202.791] (-2215.942) (-2210.082) -- 0:04:29
Average standard deviation of split frequencies: 0.010338
265500 -- (-2213.652) (-2213.801) [-2213.865] (-2208.217) * [-2208.597] (-2201.724) (-2213.468) (-2201.490) -- 0:04:31
266000 -- (-2209.525) (-2208.843) (-2209.277) [-2206.228] * [-2205.591] (-2208.937) (-2203.895) (-2208.174) -- 0:04:30
266500 -- (-2208.333) (-2218.135) [-2209.016] (-2205.318) * [-2208.594] (-2216.190) (-2207.467) (-2211.362) -- 0:04:29
267000 -- (-2217.612) (-2221.962) [-2210.493] (-2206.821) * (-2214.781) [-2202.974] (-2208.802) (-2208.954) -- 0:04:29
267500 -- [-2208.852] (-2207.065) (-2209.142) (-2208.252) * (-2213.371) (-2213.720) (-2209.063) [-2203.470] -- 0:04:28
268000 -- (-2207.474) [-2205.404] (-2208.284) (-2204.905) * (-2203.605) (-2213.507) [-2201.462] (-2211.789) -- 0:04:30
268500 -- (-2206.263) (-2203.098) (-2206.740) [-2207.408] * (-2218.807) (-2215.826) (-2201.205) [-2209.996] -- 0:04:29
269000 -- (-2203.723) [-2209.014] (-2210.237) (-2206.564) * [-2210.891] (-2216.617) (-2210.313) (-2203.474) -- 0:04:29
269500 -- (-2202.199) (-2205.473) (-2208.332) [-2210.009] * (-2210.113) [-2207.039] (-2213.230) (-2205.280) -- 0:04:28
270000 -- (-2201.505) (-2204.857) [-2202.612] (-2209.818) * (-2200.155) (-2209.550) (-2204.692) [-2205.480] -- 0:04:27
Average standard deviation of split frequencies: 0.010740
270500 -- (-2208.408) (-2214.536) [-2213.356] (-2211.806) * (-2202.946) (-2209.465) (-2212.168) [-2204.772] -- 0:04:29
271000 -- (-2208.981) (-2206.501) [-2204.609] (-2215.909) * [-2205.769] (-2210.790) (-2203.909) (-2210.302) -- 0:04:29
271500 -- [-2209.251] (-2209.129) (-2203.041) (-2210.994) * [-2208.153] (-2206.217) (-2210.967) (-2206.667) -- 0:04:28
272000 -- (-2208.268) (-2219.104) [-2202.250] (-2210.493) * (-2209.806) [-2204.493] (-2207.209) (-2210.692) -- 0:04:27
272500 -- [-2205.750] (-2210.708) (-2206.686) (-2216.090) * (-2210.302) (-2202.438) (-2211.180) [-2205.805] -- 0:04:26
273000 -- [-2203.465] (-2202.148) (-2213.514) (-2213.319) * (-2209.636) (-2210.728) (-2218.507) [-2203.859] -- 0:04:26
273500 -- (-2213.027) (-2212.553) (-2204.761) [-2205.686] * (-2206.193) [-2199.403] (-2204.260) (-2209.902) -- 0:04:28
274000 -- (-2209.574) [-2207.852] (-2211.227) (-2211.484) * [-2204.238] (-2204.288) (-2200.172) (-2206.447) -- 0:04:27
274500 -- (-2213.331) (-2219.519) (-2202.676) [-2203.004] * (-2202.439) (-2207.519) (-2201.844) [-2203.679] -- 0:04:26
275000 -- (-2203.608) (-2210.616) (-2207.008) [-2210.039] * (-2209.139) (-2213.179) [-2205.368] (-2207.645) -- 0:04:26
Average standard deviation of split frequencies: 0.009394
275500 -- (-2199.076) [-2203.546] (-2209.846) (-2216.131) * (-2201.703) [-2204.076] (-2207.887) (-2205.656) -- 0:04:25
276000 -- (-2207.007) (-2212.539) [-2204.922] (-2217.771) * (-2212.101) (-2214.345) (-2206.629) [-2201.609] -- 0:04:27
276500 -- (-2205.456) (-2206.681) (-2212.424) [-2203.333] * (-2204.493) (-2215.788) (-2205.514) [-2205.847] -- 0:04:26
277000 -- (-2207.041) [-2207.359] (-2204.892) (-2208.985) * [-2210.838] (-2210.700) (-2209.804) (-2213.802) -- 0:04:26
277500 -- [-2212.219] (-2209.695) (-2203.488) (-2203.938) * (-2204.459) (-2207.304) (-2209.933) [-2205.305] -- 0:04:25
278000 -- (-2212.524) [-2214.198] (-2209.193) (-2210.562) * (-2207.602) (-2206.652) [-2207.820] (-2203.869) -- 0:04:24
278500 -- [-2205.312] (-2208.851) (-2207.683) (-2212.419) * (-2211.010) [-2204.834] (-2204.976) (-2207.836) -- 0:04:24
279000 -- (-2207.440) (-2207.073) (-2207.743) [-2212.018] * (-2204.582) (-2204.801) [-2199.194] (-2209.166) -- 0:04:26
279500 -- (-2206.250) [-2206.695] (-2203.642) (-2202.913) * (-2206.559) (-2217.481) (-2212.064) [-2208.667] -- 0:04:25
280000 -- (-2205.015) (-2208.008) (-2208.282) [-2207.336] * (-2203.084) [-2209.052] (-2214.323) (-2206.416) -- 0:04:24
Average standard deviation of split frequencies: 0.009798
280500 -- (-2204.414) (-2205.784) (-2213.652) [-2201.446] * (-2204.072) (-2204.781) [-2207.717] (-2215.090) -- 0:04:24
281000 -- [-2203.860] (-2214.273) (-2208.518) (-2202.853) * [-2210.284] (-2208.077) (-2207.687) (-2218.408) -- 0:04:23
281500 -- [-2208.222] (-2209.520) (-2208.623) (-2213.150) * (-2207.204) (-2207.292) [-2207.777] (-2210.646) -- 0:04:25
282000 -- (-2214.365) [-2204.959] (-2207.878) (-2208.532) * (-2207.236) (-2207.773) [-2209.163] (-2206.442) -- 0:04:24
282500 -- (-2216.634) (-2213.475) [-2205.818] (-2212.178) * (-2208.863) [-2213.940] (-2209.177) (-2204.305) -- 0:04:24
283000 -- (-2209.317) [-2216.990] (-2211.256) (-2219.076) * [-2200.613] (-2212.797) (-2211.807) (-2204.541) -- 0:04:23
283500 -- (-2212.167) (-2213.467) [-2201.320] (-2208.124) * (-2206.256) (-2203.900) [-2206.464] (-2200.806) -- 0:04:22
284000 -- [-2202.995] (-2205.961) (-2212.106) (-2208.168) * (-2205.239) (-2212.494) [-2207.757] (-2209.770) -- 0:04:24
284500 -- (-2203.606) (-2205.941) [-2201.104] (-2209.579) * [-2211.814] (-2207.918) (-2206.087) (-2211.119) -- 0:04:24
285000 -- (-2205.038) (-2206.635) (-2209.262) [-2211.623] * (-2215.450) (-2207.649) (-2208.624) [-2207.305] -- 0:04:23
Average standard deviation of split frequencies: 0.011067
285500 -- (-2208.365) (-2209.187) (-2205.088) [-2200.614] * (-2211.918) (-2209.457) (-2207.353) [-2210.923] -- 0:04:22
286000 -- (-2207.178) [-2205.418] (-2204.105) (-2205.963) * (-2223.721) [-2208.246] (-2203.918) (-2212.405) -- 0:04:22
286500 -- [-2208.108] (-2201.950) (-2205.495) (-2216.173) * (-2210.299) (-2216.311) [-2205.245] (-2209.558) -- 0:04:21
287000 -- (-2214.045) (-2211.770) (-2207.129) [-2210.513] * (-2213.787) [-2205.661] (-2218.083) (-2210.648) -- 0:04:23
287500 -- (-2213.541) (-2209.394) [-2205.720] (-2203.908) * [-2210.360] (-2210.458) (-2212.884) (-2204.663) -- 0:04:22
288000 -- (-2208.660) (-2207.958) [-2210.807] (-2207.156) * [-2210.906] (-2210.060) (-2218.534) (-2203.977) -- 0:04:22
288500 -- (-2201.072) (-2204.172) [-2206.754] (-2208.804) * (-2206.571) [-2207.586] (-2214.320) (-2206.919) -- 0:04:21
289000 -- [-2202.682] (-2209.966) (-2199.551) (-2210.043) * [-2206.090] (-2213.527) (-2214.156) (-2206.223) -- 0:04:20
289500 -- (-2206.894) (-2204.479) (-2212.656) [-2205.970] * [-2203.202] (-2204.139) (-2205.358) (-2204.031) -- 0:04:22
290000 -- (-2206.613) [-2209.166] (-2213.944) (-2212.228) * (-2211.699) (-2205.365) (-2216.590) [-2200.762] -- 0:04:21
Average standard deviation of split frequencies: 0.011816
290500 -- (-2206.024) [-2203.431] (-2206.250) (-2210.056) * [-2210.476] (-2217.532) (-2209.971) (-2206.320) -- 0:04:21
291000 -- (-2205.921) (-2214.157) [-2205.048] (-2205.533) * (-2208.542) (-2207.354) [-2205.039] (-2215.718) -- 0:04:20
291500 -- (-2213.648) (-2209.116) (-2205.986) [-2201.743] * [-2203.351] (-2214.380) (-2212.856) (-2208.378) -- 0:04:20
292000 -- (-2201.107) (-2210.593) (-2202.421) [-2201.309] * [-2203.521] (-2221.616) (-2211.979) (-2205.990) -- 0:04:21
292500 -- (-2206.705) (-2205.375) [-2208.694] (-2205.506) * [-2208.013] (-2212.165) (-2208.284) (-2214.122) -- 0:04:21
293000 -- (-2208.504) (-2214.602) [-2210.318] (-2212.188) * (-2206.259) (-2213.820) (-2200.957) [-2202.851] -- 0:04:20
293500 -- (-2205.357) [-2211.059] (-2222.464) (-2210.676) * (-2212.388) (-2211.884) (-2208.596) [-2213.432] -- 0:04:19
294000 -- [-2207.013] (-2212.366) (-2204.626) (-2215.056) * (-2210.348) [-2200.915] (-2205.654) (-2207.602) -- 0:04:19
294500 -- [-2204.267] (-2208.337) (-2207.007) (-2216.112) * [-2204.506] (-2223.883) (-2209.161) (-2211.039) -- 0:04:18
295000 -- (-2205.329) (-2203.454) (-2206.661) [-2206.311] * (-2213.262) [-2208.581] (-2207.078) (-2214.051) -- 0:04:20
Average standard deviation of split frequencies: 0.012058
295500 -- [-2206.236] (-2205.064) (-2208.189) (-2217.416) * (-2204.097) (-2216.246) [-2205.700] (-2207.187) -- 0:04:19
296000 -- [-2206.644] (-2210.448) (-2200.632) (-2211.061) * (-2205.793) (-2205.930) (-2206.439) [-2207.563] -- 0:04:19
296500 -- (-2215.268) (-2212.017) (-2211.682) [-2203.365] * (-2215.513) (-2202.384) [-2204.609] (-2208.631) -- 0:04:18
297000 -- (-2223.905) (-2219.459) (-2204.082) [-2213.951] * (-2211.757) [-2207.773] (-2204.361) (-2209.632) -- 0:04:18
297500 -- [-2211.716] (-2209.514) (-2215.867) (-2211.455) * (-2210.428) (-2211.770) (-2207.263) [-2212.605] -- 0:04:19
298000 -- [-2207.874] (-2206.592) (-2209.738) (-2204.926) * (-2209.568) (-2208.087) [-2200.203] (-2201.029) -- 0:04:19
298500 -- [-2212.859] (-2205.854) (-2214.566) (-2203.462) * [-2206.716] (-2212.396) (-2211.575) (-2211.104) -- 0:04:18
299000 -- (-2212.853) (-2205.999) (-2208.779) [-2204.813] * (-2210.653) [-2204.466] (-2213.265) (-2209.878) -- 0:04:17
299500 -- [-2203.489] (-2206.846) (-2210.474) (-2204.925) * (-2203.202) [-2202.105] (-2205.339) (-2215.193) -- 0:04:17
300000 -- (-2210.686) (-2204.358) (-2204.501) [-2206.150] * [-2206.765] (-2205.481) (-2203.641) (-2208.950) -- 0:04:16
Average standard deviation of split frequencies: 0.011423
300500 -- [-2207.831] (-2209.528) (-2207.038) (-2214.902) * (-2212.921) [-2205.299] (-2208.904) (-2204.458) -- 0:04:18
301000 -- (-2210.901) [-2215.672] (-2207.638) (-2217.089) * (-2207.347) (-2205.367) [-2207.871] (-2207.087) -- 0:04:17
301500 -- [-2209.636] (-2207.667) (-2211.232) (-2212.559) * (-2210.068) (-2202.879) [-2199.640] (-2203.409) -- 0:04:17
302000 -- (-2208.505) [-2204.159] (-2205.159) (-2206.655) * (-2199.875) [-2212.345] (-2207.360) (-2211.654) -- 0:04:16
302500 -- (-2208.494) (-2207.916) [-2209.371] (-2221.474) * (-2210.459) (-2207.619) [-2208.901] (-2208.301) -- 0:04:15
303000 -- [-2201.369] (-2209.166) (-2210.278) (-2209.758) * (-2211.661) (-2208.038) (-2213.843) [-2209.365] -- 0:04:17
303500 -- [-2207.465] (-2211.821) (-2219.055) (-2207.569) * (-2213.606) (-2210.377) (-2215.870) [-2198.903] -- 0:04:17
304000 -- (-2202.522) (-2217.922) [-2206.789] (-2206.882) * (-2208.256) [-2202.400] (-2212.042) (-2207.768) -- 0:04:16
304500 -- [-2206.525] (-2207.190) (-2211.283) (-2202.041) * (-2204.917) (-2206.152) [-2208.805] (-2199.552) -- 0:04:15
305000 -- (-2207.319) (-2204.675) (-2206.518) [-2201.412] * (-2215.659) (-2211.276) (-2201.649) [-2200.179] -- 0:04:15
Average standard deviation of split frequencies: 0.011004
305500 -- [-2198.754] (-2206.857) (-2210.617) (-2202.930) * (-2206.975) (-2209.953) [-2209.779] (-2208.080) -- 0:04:16
306000 -- [-2202.610] (-2206.388) (-2209.305) (-2204.086) * [-2207.813] (-2212.668) (-2212.827) (-2210.283) -- 0:04:16
306500 -- (-2203.604) (-2201.877) (-2208.301) [-2209.529] * [-2205.008] (-2215.409) (-2205.962) (-2218.562) -- 0:04:15
307000 -- (-2206.941) [-2205.377] (-2216.281) (-2206.434) * (-2214.901) (-2209.024) [-2203.328] (-2207.707) -- 0:04:15
307500 -- (-2206.822) [-2207.123] (-2216.972) (-2212.344) * (-2205.904) [-2205.241] (-2206.335) (-2204.084) -- 0:04:14
308000 -- [-2206.336] (-2202.746) (-2212.817) (-2205.814) * [-2215.105] (-2206.609) (-2205.758) (-2204.709) -- 0:04:13
308500 -- [-2203.394] (-2215.762) (-2208.138) (-2205.186) * (-2208.906) (-2210.579) (-2211.669) [-2203.831] -- 0:04:15
309000 -- (-2203.257) (-2206.543) [-2204.408] (-2213.455) * (-2205.110) [-2204.696] (-2222.940) (-2205.376) -- 0:04:14
309500 -- (-2216.459) (-2207.472) (-2216.635) [-2202.250] * [-2202.099] (-2205.249) (-2214.060) (-2200.404) -- 0:04:14
310000 -- (-2209.710) [-2204.199] (-2210.016) (-2210.493) * (-2209.875) [-2207.406] (-2202.807) (-2200.639) -- 0:04:13
Average standard deviation of split frequencies: 0.011922
310500 -- (-2204.628) (-2223.199) [-2207.623] (-2218.089) * (-2204.343) (-2206.446) (-2210.314) [-2207.504] -- 0:04:13
311000 -- (-2207.360) (-2207.685) [-2204.927] (-2214.218) * (-2218.704) [-2203.858] (-2209.354) (-2213.160) -- 0:04:14
311500 -- [-2213.167] (-2204.501) (-2202.092) (-2212.197) * (-2206.786) (-2206.496) [-2203.705] (-2209.110) -- 0:04:14
312000 -- (-2210.630) [-2205.480] (-2204.376) (-2203.080) * (-2216.987) [-2203.534] (-2203.926) (-2208.797) -- 0:04:13
312500 -- (-2213.616) [-2201.288] (-2212.600) (-2214.420) * (-2212.197) (-2212.900) [-2208.186] (-2207.014) -- 0:04:13
313000 -- [-2208.385] (-2210.251) (-2208.704) (-2213.471) * (-2200.572) (-2207.251) (-2208.378) [-2202.305] -- 0:04:12
313500 -- (-2208.640) [-2202.236] (-2218.199) (-2219.941) * (-2210.976) (-2202.908) [-2205.624] (-2204.111) -- 0:04:14
314000 -- [-2205.385] (-2207.762) (-2208.519) (-2220.663) * (-2202.219) (-2203.353) (-2210.555) [-2200.774] -- 0:04:13
314500 -- [-2199.599] (-2201.895) (-2208.764) (-2210.755) * (-2209.609) (-2208.320) (-2210.016) [-2207.953] -- 0:04:12
315000 -- (-2211.126) [-2205.216] (-2206.792) (-2211.119) * [-2213.452] (-2205.438) (-2217.120) (-2209.828) -- 0:04:12
Average standard deviation of split frequencies: 0.011295
315500 -- [-2206.198] (-2207.286) (-2208.315) (-2211.582) * (-2205.864) (-2212.297) (-2218.166) [-2207.129] -- 0:04:11
316000 -- (-2203.915) [-2202.161] (-2212.964) (-2209.417) * (-2208.596) [-2212.402] (-2211.045) (-2204.941) -- 0:04:11
316500 -- (-2208.199) (-2215.568) [-2208.904] (-2211.360) * (-2207.040) (-2219.392) [-2205.714] (-2202.215) -- 0:04:12
317000 -- [-2209.164] (-2212.872) (-2203.182) (-2209.452) * (-2202.073) [-2207.984] (-2211.877) (-2200.679) -- 0:04:12
317500 -- (-2213.744) (-2205.858) [-2204.002] (-2205.600) * (-2202.581) (-2214.533) [-2207.143] (-2208.396) -- 0:04:11
318000 -- (-2214.412) (-2214.217) [-2206.463] (-2208.849) * [-2205.245] (-2210.192) (-2209.227) (-2205.104) -- 0:04:10
318500 -- (-2210.458) (-2207.750) (-2204.641) [-2199.291] * (-2209.476) (-2215.183) [-2202.154] (-2212.294) -- 0:04:10
319000 -- (-2208.583) (-2210.400) [-2211.670] (-2210.075) * [-2203.845] (-2209.766) (-2201.237) (-2208.107) -- 0:04:11
319500 -- (-2213.994) (-2205.171) (-2217.953) [-2203.786] * (-2204.715) (-2200.808) [-2207.619] (-2208.800) -- 0:04:11
320000 -- [-2200.929] (-2205.925) (-2209.135) (-2203.700) * (-2208.568) (-2206.454) (-2213.197) [-2213.947] -- 0:04:10
Average standard deviation of split frequencies: 0.010921
320500 -- (-2211.462) (-2218.028) [-2202.555] (-2201.299) * (-2208.218) (-2210.599) [-2206.449] (-2219.653) -- 0:04:10
321000 -- (-2209.651) [-2206.876] (-2203.434) (-2204.258) * [-2207.284] (-2215.399) (-2206.165) (-2208.300) -- 0:04:09
321500 -- (-2218.715) [-2202.062] (-2211.886) (-2202.889) * (-2201.299) (-2209.546) (-2206.665) [-2204.039] -- 0:04:09
322000 -- (-2205.715) [-2203.587] (-2205.320) (-2207.648) * (-2204.830) [-2212.339] (-2209.455) (-2204.539) -- 0:04:10
322500 -- (-2205.726) (-2209.953) (-2205.370) [-2204.094] * [-2204.727] (-2210.638) (-2213.995) (-2201.672) -- 0:04:09
323000 -- [-2201.773] (-2206.443) (-2206.973) (-2202.579) * (-2205.321) [-2206.744] (-2213.928) (-2210.651) -- 0:04:09
323500 -- (-2210.324) (-2209.658) (-2209.013) [-2206.639] * (-2201.852) (-2205.417) (-2205.464) [-2204.004] -- 0:04:08
324000 -- (-2203.809) (-2210.434) (-2205.391) [-2208.646] * (-2206.971) [-2203.166] (-2203.612) (-2204.127) -- 0:04:08
324500 -- (-2210.634) [-2207.340] (-2210.666) (-2211.428) * [-2206.755] (-2204.942) (-2204.561) (-2205.621) -- 0:04:09
325000 -- (-2201.544) [-2207.662] (-2213.723) (-2206.587) * (-2203.007) [-2202.771] (-2216.720) (-2210.798) -- 0:04:09
Average standard deviation of split frequencies: 0.011155
325500 -- (-2205.152) (-2216.663) [-2201.594] (-2211.401) * (-2203.077) (-2211.445) [-2216.663] (-2205.506) -- 0:04:08
326000 -- (-2202.961) (-2205.723) [-2202.901] (-2218.225) * (-2208.422) [-2207.155] (-2205.393) (-2209.302) -- 0:04:08
326500 -- (-2213.004) [-2202.034] (-2202.098) (-2210.478) * (-2204.478) (-2206.628) (-2208.247) [-2207.767] -- 0:04:07
327000 -- (-2216.857) [-2206.523] (-2208.175) (-2206.721) * (-2209.206) [-2204.511] (-2206.101) (-2210.533) -- 0:04:09
327500 -- (-2205.465) (-2206.760) [-2211.186] (-2208.704) * (-2201.277) (-2209.929) (-2209.797) [-2211.780] -- 0:04:08
328000 -- (-2211.794) [-2201.459] (-2207.955) (-2219.631) * [-2204.427] (-2211.852) (-2204.065) (-2208.647) -- 0:04:07
328500 -- (-2212.414) [-2210.485] (-2208.956) (-2206.681) * (-2209.647) (-2209.912) [-2210.942] (-2212.777) -- 0:04:07
329000 -- (-2205.974) (-2208.661) (-2207.002) [-2208.655] * [-2198.308] (-2208.456) (-2205.971) (-2211.337) -- 0:04:06
329500 -- (-2204.144) (-2212.805) [-2201.407] (-2207.728) * (-2212.923) (-2208.568) (-2208.706) [-2204.520] -- 0:04:08
330000 -- (-2212.081) [-2202.295] (-2207.932) (-2209.352) * (-2216.274) (-2215.742) (-2205.679) [-2203.746] -- 0:04:07
Average standard deviation of split frequencies: 0.010387
330500 -- (-2210.136) [-2210.088] (-2207.873) (-2212.614) * [-2204.184] (-2212.409) (-2206.323) (-2216.632) -- 0:04:07
331000 -- (-2207.394) (-2216.735) [-2204.476] (-2208.525) * (-2206.483) [-2205.366] (-2208.089) (-2207.787) -- 0:04:06
331500 -- (-2205.751) (-2210.228) (-2203.966) [-2208.093] * (-2205.481) (-2210.062) [-2209.255] (-2203.232) -- 0:04:06
332000 -- (-2206.495) [-2201.574] (-2217.605) (-2204.112) * (-2214.185) (-2207.019) (-2212.017) [-2201.744] -- 0:04:07
332500 -- (-2205.095) (-2203.852) (-2206.196) [-2205.920] * [-2206.000] (-2211.465) (-2207.594) (-2200.789) -- 0:04:06
333000 -- (-2201.976) (-2204.996) [-2200.930] (-2203.026) * (-2201.281) [-2212.527] (-2215.453) (-2211.552) -- 0:04:06
333500 -- (-2209.479) (-2207.471) [-2206.414] (-2210.948) * [-2200.053] (-2207.932) (-2203.499) (-2201.604) -- 0:04:05
334000 -- (-2209.183) (-2199.922) [-2203.477] (-2212.994) * [-2198.315] (-2204.967) (-2203.859) (-2208.138) -- 0:04:05
334500 -- (-2207.579) [-2205.987] (-2207.078) (-2205.808) * [-2201.472] (-2216.502) (-2216.012) (-2203.858) -- 0:04:06
335000 -- (-2211.446) [-2203.569] (-2201.325) (-2211.636) * (-2206.357) (-2205.657) [-2202.735] (-2211.913) -- 0:04:06
Average standard deviation of split frequencies: 0.010623
335500 -- (-2206.003) (-2206.911) [-2202.748] (-2201.415) * [-2211.407] (-2205.064) (-2202.801) (-2204.026) -- 0:04:05
336000 -- [-2210.820] (-2204.928) (-2205.987) (-2197.851) * (-2214.402) (-2206.068) [-2211.934] (-2207.587) -- 0:04:05
336500 -- (-2203.487) (-2205.450) [-2202.965] (-2210.255) * (-2206.818) (-2203.253) [-2200.584] (-2209.419) -- 0:04:04
337000 -- [-2212.761] (-2202.675) (-2207.611) (-2213.604) * [-2202.427] (-2209.387) (-2213.146) (-2210.852) -- 0:04:03
337500 -- [-2211.042] (-2203.069) (-2209.769) (-2212.193) * (-2206.802) (-2203.071) (-2208.024) [-2203.360] -- 0:04:05
338000 -- [-2204.721] (-2205.490) (-2212.660) (-2205.707) * (-2204.363) (-2203.325) [-2207.142] (-2205.277) -- 0:04:04
338500 -- [-2206.428] (-2205.667) (-2207.515) (-2205.446) * [-2203.613] (-2206.361) (-2217.860) (-2210.647) -- 0:04:04
339000 -- [-2208.918] (-2212.025) (-2210.366) (-2212.649) * (-2207.687) [-2205.232] (-2215.381) (-2211.165) -- 0:04:03
339500 -- (-2210.094) (-2211.975) [-2209.925] (-2210.643) * (-2207.560) (-2214.526) [-2209.779] (-2209.504) -- 0:04:03
340000 -- (-2221.142) (-2213.818) (-2216.486) [-2207.295] * (-2206.347) (-2206.781) (-2208.317) [-2204.713] -- 0:04:04
Average standard deviation of split frequencies: 0.010872
340500 -- (-2219.325) (-2202.813) (-2207.087) [-2207.812] * [-2202.920] (-2208.496) (-2211.270) (-2206.149) -- 0:04:04
341000 -- (-2213.241) (-2205.647) (-2217.247) [-2203.744] * (-2208.600) (-2210.635) (-2206.415) [-2201.640] -- 0:04:03
341500 -- (-2208.921) (-2213.848) [-2207.050] (-2203.894) * (-2211.011) [-2215.261] (-2213.421) (-2207.958) -- 0:04:02
342000 -- (-2213.926) (-2214.018) (-2201.152) [-2205.220] * [-2199.788] (-2206.442) (-2200.315) (-2208.881) -- 0:04:02
342500 -- (-2207.722) (-2206.251) (-2210.280) [-2200.394] * (-2209.858) [-2209.923] (-2208.388) (-2209.478) -- 0:04:01
343000 -- [-2206.200] (-2207.823) (-2211.651) (-2208.320) * (-2206.430) [-2206.228] (-2215.260) (-2212.221) -- 0:04:03
343500 -- (-2214.793) (-2210.159) (-2211.958) [-2202.165] * [-2207.754] (-2210.922) (-2225.052) (-2214.182) -- 0:04:02
344000 -- [-2207.918] (-2218.195) (-2207.864) (-2201.336) * (-2202.897) (-2209.567) (-2214.965) [-2211.706] -- 0:04:02
344500 -- (-2207.999) (-2199.269) [-2203.555] (-2203.091) * [-2205.274] (-2205.146) (-2212.632) (-2209.633) -- 0:04:01
345000 -- (-2210.876) (-2209.585) (-2204.435) [-2212.128] * (-2221.350) [-2203.198] (-2210.675) (-2206.833) -- 0:04:01
Average standard deviation of split frequencies: 0.010510
345500 -- (-2217.877) (-2201.841) (-2206.816) [-2216.073] * (-2208.984) [-2201.680] (-2205.109) (-2207.028) -- 0:04:02
346000 -- (-2210.508) [-2209.547] (-2206.572) (-2205.395) * (-2206.267) [-2202.780] (-2203.095) (-2210.394) -- 0:04:01
346500 -- (-2208.335) (-2208.387) (-2209.887) [-2210.435] * (-2207.583) [-2210.573] (-2210.790) (-2203.654) -- 0:04:01
347000 -- (-2206.214) (-2211.623) (-2217.443) [-2200.285] * (-2208.164) [-2206.550] (-2205.957) (-2207.467) -- 0:04:00
347500 -- [-2204.802] (-2205.002) (-2206.310) (-2204.193) * (-2209.531) (-2203.258) [-2205.422] (-2203.474) -- 0:04:00
348000 -- (-2202.367) (-2214.644) (-2207.779) [-2217.343] * (-2206.897) [-2207.032] (-2204.747) (-2208.706) -- 0:03:59
348500 -- (-2203.556) [-2203.619] (-2206.778) (-2210.436) * (-2216.107) (-2206.148) (-2207.901) [-2208.922] -- 0:04:01
349000 -- [-2204.063] (-2211.811) (-2206.674) (-2203.635) * (-2212.814) (-2211.449) [-2204.194] (-2202.589) -- 0:04:00
349500 -- [-2202.331] (-2214.696) (-2209.161) (-2205.081) * (-2206.459) (-2212.128) [-2201.574] (-2207.730) -- 0:04:00
350000 -- (-2212.805) (-2207.102) [-2206.497] (-2206.197) * [-2210.772] (-2213.246) (-2211.823) (-2213.507) -- 0:03:59
Average standard deviation of split frequencies: 0.010754
350500 -- (-2204.723) [-2203.815] (-2200.466) (-2208.861) * (-2215.479) (-2213.052) [-2203.139] (-2214.378) -- 0:03:59
351000 -- (-2212.574) (-2209.716) (-2203.839) [-2202.852] * (-2205.099) (-2215.787) [-2204.446] (-2199.842) -- 0:04:00
351500 -- (-2209.279) (-2202.495) [-2198.195] (-2205.203) * (-2202.253) (-2225.431) (-2219.051) [-2204.978] -- 0:03:59
352000 -- (-2215.243) (-2206.407) [-2202.499] (-2201.284) * [-2212.710] (-2210.685) (-2209.760) (-2206.381) -- 0:03:59
352500 -- (-2208.396) (-2202.353) [-2202.427] (-2211.597) * (-2203.113) (-2215.709) (-2204.917) [-2206.120] -- 0:03:58
353000 -- (-2218.585) (-2211.697) (-2207.942) [-2201.481] * (-2203.342) (-2216.381) [-2205.559] (-2209.662) -- 0:03:58
353500 -- [-2207.687] (-2204.847) (-2204.641) (-2204.841) * (-2209.115) (-2209.414) (-2208.932) [-2203.842] -- 0:03:57
354000 -- (-2205.608) [-2210.957] (-2205.231) (-2212.716) * (-2204.913) (-2209.079) [-2209.542] (-2204.686) -- 0:03:59
354500 -- (-2205.330) (-2202.706) (-2206.547) [-2203.922] * (-2208.915) (-2206.791) (-2207.244) [-2204.377] -- 0:03:58
355000 -- (-2203.147) (-2204.713) [-2203.174] (-2210.796) * (-2207.257) [-2203.720] (-2203.267) (-2205.169) -- 0:03:58
Average standard deviation of split frequencies: 0.011918
355500 -- (-2201.018) (-2209.345) [-2203.536] (-2208.839) * (-2209.032) [-2202.947] (-2210.271) (-2205.519) -- 0:03:57
356000 -- (-2199.154) [-2202.073] (-2208.970) (-2209.526) * [-2205.154] (-2209.947) (-2211.049) (-2204.890) -- 0:03:56
356500 -- (-2203.457) (-2206.494) (-2208.080) [-2207.663] * (-2214.389) (-2208.160) (-2213.181) [-2207.233] -- 0:03:58
357000 -- (-2212.154) [-2201.388] (-2214.844) (-2204.888) * (-2215.679) (-2214.390) [-2205.665] (-2208.300) -- 0:03:57
357500 -- (-2219.489) [-2205.942] (-2209.854) (-2223.630) * [-2209.905] (-2208.946) (-2212.289) (-2209.152) -- 0:03:57
358000 -- [-2210.523] (-2214.943) (-2203.995) (-2204.216) * [-2208.419] (-2201.825) (-2216.330) (-2209.801) -- 0:03:56
358500 -- (-2207.816) (-2206.278) (-2217.575) [-2208.288] * (-2206.921) [-2207.853] (-2206.373) (-2207.174) -- 0:03:56
359000 -- (-2206.511) [-2207.070] (-2204.172) (-2204.344) * (-2209.742) (-2209.455) (-2205.750) [-2212.562] -- 0:03:55
359500 -- (-2215.303) [-2199.081] (-2209.640) (-2205.472) * (-2203.585) (-2201.249) [-2201.723] (-2203.119) -- 0:03:56
360000 -- [-2212.776] (-2209.670) (-2203.173) (-2212.150) * (-2209.714) [-2207.971] (-2210.122) (-2202.126) -- 0:03:56
Average standard deviation of split frequencies: 0.011763
360500 -- [-2203.952] (-2206.276) (-2202.922) (-2203.890) * [-2212.895] (-2210.733) (-2204.031) (-2207.983) -- 0:03:55
361000 -- (-2211.950) (-2211.317) [-2212.121] (-2216.800) * (-2213.168) [-2205.560] (-2203.403) (-2204.630) -- 0:03:55
361500 -- (-2208.110) (-2206.970) [-2202.045] (-2210.285) * (-2208.487) [-2204.815] (-2203.685) (-2208.600) -- 0:03:54
362000 -- [-2203.636] (-2214.484) (-2208.193) (-2210.774) * (-2212.243) (-2202.168) [-2205.159] (-2216.515) -- 0:03:56
362500 -- (-2208.973) (-2207.322) [-2206.752] (-2211.854) * (-2208.714) (-2203.056) [-2211.024] (-2206.208) -- 0:03:55
363000 -- (-2205.850) [-2203.577] (-2202.126) (-2209.828) * [-2207.815] (-2203.144) (-2205.454) (-2201.031) -- 0:03:55
363500 -- (-2204.776) (-2204.680) [-2201.921] (-2209.900) * [-2203.368] (-2204.084) (-2213.217) (-2216.741) -- 0:03:54
364000 -- (-2205.420) (-2204.966) (-2211.623) [-2204.355] * (-2207.004) [-2202.138] (-2209.186) (-2200.030) -- 0:03:54
364500 -- [-2204.768] (-2216.549) (-2219.325) (-2212.947) * (-2203.120) [-2202.336] (-2205.215) (-2206.960) -- 0:03:53
365000 -- [-2203.368] (-2204.508) (-2217.443) (-2206.165) * (-2203.107) (-2206.400) [-2215.024] (-2207.074) -- 0:03:54
Average standard deviation of split frequencies: 0.011224
365500 -- [-2204.392] (-2208.173) (-2208.998) (-2211.829) * [-2208.333] (-2206.160) (-2211.866) (-2211.298) -- 0:03:54
366000 -- (-2204.289) (-2212.424) [-2207.203] (-2215.313) * [-2198.750] (-2207.912) (-2203.802) (-2200.155) -- 0:03:53
366500 -- [-2207.083] (-2213.983) (-2209.692) (-2206.008) * (-2203.172) (-2205.548) (-2202.338) [-2198.394] -- 0:03:53
367000 -- [-2204.393] (-2210.334) (-2209.619) (-2206.977) * (-2202.356) (-2215.793) [-2205.482] (-2201.938) -- 0:03:52
367500 -- [-2199.357] (-2206.421) (-2207.542) (-2202.667) * (-2206.870) [-2210.226] (-2208.574) (-2201.366) -- 0:03:54
368000 -- (-2209.296) (-2204.505) (-2213.227) [-2205.899] * (-2208.673) [-2208.198] (-2207.441) (-2206.624) -- 0:03:53
368500 -- (-2204.136) [-2204.164] (-2207.605) (-2209.907) * [-2210.168] (-2204.165) (-2205.457) (-2206.076) -- 0:03:53
369000 -- (-2211.515) [-2206.735] (-2208.901) (-2219.074) * [-2201.058] (-2204.543) (-2208.917) (-2208.183) -- 0:03:52
369500 -- (-2212.529) (-2207.677) (-2209.883) [-2215.553] * (-2205.370) (-2212.547) [-2199.429] (-2206.956) -- 0:03:52
370000 -- (-2209.467) (-2210.259) (-2207.188) [-2208.574] * [-2205.187] (-2206.640) (-2208.245) (-2209.562) -- 0:03:51
Average standard deviation of split frequencies: 0.010174
370500 -- (-2204.895) (-2208.488) [-2206.352] (-2203.787) * (-2202.914) [-2207.085] (-2211.113) (-2204.491) -- 0:03:52
371000 -- (-2205.994) (-2215.245) [-2204.601] (-2205.597) * (-2200.097) (-2201.813) (-2207.307) [-2206.539] -- 0:03:52
371500 -- (-2206.278) [-2205.578] (-2204.842) (-2209.924) * (-2212.091) [-2208.984] (-2211.323) (-2213.388) -- 0:03:51
372000 -- [-2208.271] (-2206.749) (-2213.449) (-2207.375) * [-2210.109] (-2206.852) (-2211.323) (-2205.565) -- 0:03:51
372500 -- [-2205.442] (-2200.711) (-2204.869) (-2206.076) * (-2212.667) [-2204.877] (-2205.559) (-2205.060) -- 0:03:50
373000 -- (-2216.073) (-2209.505) [-2203.886] (-2205.464) * (-2206.031) [-2201.285] (-2204.586) (-2209.770) -- 0:03:51
373500 -- [-2203.432] (-2211.270) (-2209.216) (-2217.102) * (-2208.830) (-2201.174) (-2213.016) [-2203.333] -- 0:03:51
374000 -- [-2201.784] (-2212.494) (-2208.331) (-2209.050) * (-2207.378) (-2216.685) [-2210.667] (-2202.089) -- 0:03:50
374500 -- [-2209.536] (-2205.633) (-2208.382) (-2207.296) * [-2200.194] (-2209.041) (-2209.118) (-2201.445) -- 0:03:50
375000 -- [-2202.123] (-2203.914) (-2206.616) (-2207.729) * [-2207.842] (-2211.479) (-2207.279) (-2206.678) -- 0:03:50
Average standard deviation of split frequencies: 0.010209
375500 -- (-2209.158) [-2202.448] (-2211.473) (-2206.525) * (-2211.122) (-2202.768) (-2212.038) [-2211.696] -- 0:03:51
376000 -- [-2201.514] (-2201.465) (-2206.857) (-2213.249) * (-2208.973) (-2206.358) [-2206.120] (-2216.035) -- 0:03:50
376500 -- (-2208.109) (-2215.281) (-2210.264) [-2203.370] * (-2206.675) [-2207.526] (-2203.421) (-2212.423) -- 0:03:50
377000 -- (-2211.648) (-2215.486) (-2201.544) [-2203.432] * (-2219.192) (-2208.007) (-2203.919) [-2204.046] -- 0:03:49
377500 -- (-2204.801) (-2205.265) [-2205.283] (-2213.252) * (-2203.429) (-2209.502) (-2202.197) [-2216.674] -- 0:03:49
378000 -- (-2213.099) (-2215.121) [-2206.100] (-2207.692) * (-2205.987) (-2211.555) [-2206.863] (-2209.075) -- 0:03:48
378500 -- (-2211.681) (-2202.107) [-2208.799] (-2211.125) * [-2199.227] (-2205.127) (-2213.722) (-2197.446) -- 0:03:49
379000 -- (-2210.636) [-2209.065] (-2213.877) (-2205.110) * (-2212.771) (-2205.279) [-2209.682] (-2210.233) -- 0:03:49
379500 -- (-2212.632) (-2201.483) (-2212.568) [-2208.324] * (-2204.289) (-2205.183) (-2214.601) [-2204.778] -- 0:03:48
380000 -- [-2203.159] (-2212.136) (-2218.252) (-2205.177) * [-2206.746] (-2208.941) (-2215.702) (-2204.567) -- 0:03:48
Average standard deviation of split frequencies: 0.009730
380500 -- (-2205.016) (-2215.912) [-2207.902] (-2205.495) * (-2207.113) (-2208.813) [-2201.553] (-2212.256) -- 0:03:47
381000 -- (-2206.348) [-2202.707] (-2217.813) (-2208.711) * (-2208.150) (-2210.380) [-2207.620] (-2207.967) -- 0:03:49
381500 -- (-2211.178) (-2208.716) (-2203.599) [-2205.660] * (-2206.024) [-2204.703] (-2213.793) (-2210.968) -- 0:03:48
382000 -- (-2212.010) [-2202.929] (-2204.870) (-2202.341) * (-2204.388) (-2217.024) [-2206.126] (-2208.654) -- 0:03:48
382500 -- [-2205.869] (-2206.821) (-2201.860) (-2209.200) * (-2216.267) (-2217.523) (-2203.976) [-2206.545] -- 0:03:47
383000 -- (-2208.687) (-2204.084) [-2204.436] (-2218.455) * [-2210.935] (-2207.930) (-2204.217) (-2207.257) -- 0:03:47
383500 -- (-2215.997) [-2200.961] (-2210.046) (-2220.184) * (-2208.009) [-2209.519] (-2210.758) (-2202.955) -- 0:03:46
384000 -- [-2205.844] (-2215.854) (-2206.391) (-2209.160) * [-2207.052] (-2209.626) (-2210.206) (-2203.881) -- 0:03:47
384500 -- (-2205.848) (-2209.997) [-2202.899] (-2205.118) * (-2217.474) [-2203.461] (-2209.579) (-2210.085) -- 0:03:47
385000 -- [-2204.835] (-2207.383) (-2213.644) (-2201.835) * (-2212.591) (-2205.392) [-2202.237] (-2217.637) -- 0:03:46
Average standard deviation of split frequencies: 0.008549
385500 -- [-2206.330] (-2209.705) (-2217.478) (-2207.249) * [-2204.212] (-2209.705) (-2205.766) (-2205.022) -- 0:03:46
386000 -- [-2212.465] (-2203.523) (-2203.446) (-2203.871) * (-2208.525) (-2205.180) (-2215.155) [-2207.716] -- 0:03:45
386500 -- (-2207.572) [-2201.752] (-2206.660) (-2206.315) * (-2203.966) [-2206.415] (-2212.553) (-2208.033) -- 0:03:46
387000 -- [-2203.281] (-2203.691) (-2209.385) (-2208.589) * (-2210.319) (-2215.155) [-2212.659] (-2211.815) -- 0:03:46
387500 -- (-2216.813) (-2210.208) (-2207.360) [-2201.924] * (-2211.815) (-2206.364) [-2204.902] (-2205.125) -- 0:03:46
388000 -- (-2210.368) (-2210.202) (-2212.452) [-2201.830] * (-2207.459) [-2205.671] (-2200.681) (-2202.871) -- 0:03:45
388500 -- [-2202.374] (-2209.590) (-2205.337) (-2198.182) * (-2205.773) (-2205.417) (-2218.125) [-2207.154] -- 0:03:45
389000 -- (-2209.770) [-2202.001] (-2200.973) (-2204.839) * (-2203.362) (-2206.638) [-2206.374] (-2207.463) -- 0:03:44
389500 -- (-2209.426) (-2204.294) (-2205.012) [-2203.029] * [-2203.353] (-2209.031) (-2209.101) (-2214.536) -- 0:03:45
390000 -- (-2201.279) (-2210.421) [-2207.303] (-2206.432) * (-2206.759) (-2216.505) [-2203.465] (-2213.684) -- 0:03:45
Average standard deviation of split frequencies: 0.009309
390500 -- (-2211.422) [-2212.579] (-2204.618) (-2206.549) * (-2206.190) (-2203.327) (-2211.043) [-2206.533] -- 0:03:44
391000 -- (-2218.360) [-2202.968] (-2205.790) (-2208.404) * [-2205.022] (-2209.253) (-2211.184) (-2218.530) -- 0:03:44
391500 -- [-2200.291] (-2212.502) (-2203.043) (-2207.236) * [-2208.525] (-2207.889) (-2213.271) (-2205.562) -- 0:03:43
392000 -- (-2205.432) (-2210.199) (-2209.094) [-2204.614] * [-2208.630] (-2219.809) (-2208.054) (-2203.923) -- 0:03:44
392500 -- [-2206.878] (-2207.872) (-2205.131) (-2201.204) * (-2209.662) (-2210.115) (-2211.295) [-2204.945] -- 0:03:44
393000 -- (-2213.582) [-2204.766] (-2202.829) (-2205.430) * (-2204.727) (-2212.774) [-2205.892] (-2210.958) -- 0:03:43
393500 -- (-2208.781) (-2205.985) (-2211.232) [-2214.594] * (-2211.198) (-2209.608) [-2209.009] (-2208.380) -- 0:03:43
394000 -- [-2201.087] (-2205.337) (-2205.358) (-2209.409) * (-2219.919) (-2202.604) [-2208.379] (-2208.715) -- 0:03:43
394500 -- [-2209.734] (-2204.892) (-2206.689) (-2205.774) * (-2206.051) (-2201.611) (-2210.810) [-2207.722] -- 0:03:42
395000 -- [-2199.291] (-2206.806) (-2201.537) (-2210.164) * (-2208.418) [-2205.131] (-2199.796) (-2202.887) -- 0:03:43
Average standard deviation of split frequencies: 0.008673
395500 -- (-2208.395) (-2205.380) (-2211.309) [-2200.835] * (-2202.282) (-2203.277) [-2202.337] (-2214.189) -- 0:03:43
396000 -- (-2202.555) (-2203.909) [-2206.261] (-2213.918) * (-2207.176) (-2202.971) (-2210.188) [-2207.688] -- 0:03:42
396500 -- (-2205.988) (-2207.799) (-2201.473) [-2205.242] * (-2210.690) (-2206.993) [-2203.208] (-2201.426) -- 0:03:42
397000 -- (-2207.217) (-2207.325) [-2205.998] (-2215.073) * (-2200.383) [-2202.181] (-2212.961) (-2201.085) -- 0:03:41
397500 -- (-2217.115) (-2210.221) (-2205.101) [-2204.460] * [-2204.052] (-2203.963) (-2206.231) (-2205.118) -- 0:03:41
398000 -- [-2206.992] (-2211.083) (-2207.810) (-2212.885) * [-2207.742] (-2211.072) (-2212.247) (-2207.113) -- 0:03:42
398500 -- [-2207.620] (-2210.313) (-2208.007) (-2202.576) * [-2207.665] (-2212.621) (-2212.000) (-2197.851) -- 0:03:41
399000 -- (-2207.655) [-2211.858] (-2204.032) (-2202.379) * (-2204.935) [-2215.296] (-2207.208) (-2213.388) -- 0:03:41
399500 -- (-2216.607) (-2220.449) (-2211.537) [-2202.589] * [-2210.009] (-2211.801) (-2208.486) (-2209.416) -- 0:03:40
400000 -- (-2213.209) (-2217.260) [-2201.029] (-2200.012) * (-2206.606) [-2207.996] (-2209.438) (-2211.146) -- 0:03:40
Average standard deviation of split frequencies: 0.008908
400500 -- (-2206.954) (-2202.923) [-2210.484] (-2206.637) * (-2205.815) (-2201.948) (-2213.832) [-2200.847] -- 0:03:41
401000 -- [-2204.311] (-2210.328) (-2206.963) (-2212.936) * (-2208.556) (-2209.765) [-2208.122] (-2210.480) -- 0:03:41
401500 -- [-2203.626] (-2211.066) (-2206.882) (-2203.696) * (-2208.113) (-2223.955) [-2200.792] (-2204.365) -- 0:03:40
402000 -- (-2204.487) (-2208.671) (-2209.786) [-2207.795] * (-2214.519) [-2208.852] (-2208.316) (-2206.869) -- 0:03:40
402500 -- (-2203.568) [-2207.835] (-2206.174) (-2215.316) * [-2197.145] (-2216.229) (-2212.253) (-2211.625) -- 0:03:39
403000 -- [-2199.987] (-2205.258) (-2203.200) (-2204.823) * [-2210.203] (-2211.353) (-2217.418) (-2209.802) -- 0:03:40
403500 -- (-2209.275) [-2209.084] (-2217.960) (-2207.984) * (-2207.603) (-2207.160) [-2208.358] (-2205.400) -- 0:03:40
404000 -- [-2206.120] (-2208.393) (-2212.012) (-2202.575) * (-2207.772) [-2213.191] (-2205.924) (-2209.979) -- 0:03:39
404500 -- [-2203.460] (-2207.282) (-2213.244) (-2211.233) * [-2209.815] (-2210.394) (-2211.015) (-2217.360) -- 0:03:39
405000 -- (-2208.144) (-2207.207) [-2201.449] (-2202.517) * (-2208.080) [-2206.355] (-2206.016) (-2205.046) -- 0:03:38
Average standard deviation of split frequencies: 0.009869
405500 -- (-2216.597) (-2206.497) [-2199.274] (-2203.853) * (-2211.874) (-2203.616) (-2206.369) [-2213.401] -- 0:03:38
406000 -- (-2209.129) [-2204.665] (-2206.436) (-2204.934) * (-2225.027) [-2211.028] (-2202.008) (-2213.757) -- 0:03:39
406500 -- [-2210.040] (-2211.992) (-2204.915) (-2207.447) * (-2208.769) (-2205.345) [-2203.339] (-2199.328) -- 0:03:39
407000 -- (-2210.441) (-2213.884) [-2207.670] (-2202.872) * [-2206.078] (-2204.191) (-2201.915) (-2206.497) -- 0:03:38
407500 -- [-2205.999] (-2204.505) (-2213.807) (-2205.854) * (-2209.446) [-2202.640] (-2215.173) (-2207.066) -- 0:03:38
408000 -- (-2205.757) (-2208.039) (-2210.903) [-2207.048] * (-2208.249) (-2201.203) [-2206.255] (-2208.394) -- 0:03:37
408500 -- (-2203.778) (-2215.076) [-2204.054] (-2206.557) * (-2204.673) (-2213.683) [-2201.555] (-2209.560) -- 0:03:38
409000 -- [-2203.322] (-2206.571) (-2207.688) (-2212.865) * (-2203.254) (-2206.407) [-2205.921] (-2214.348) -- 0:03:38
409500 -- [-2204.157] (-2212.107) (-2201.513) (-2209.031) * (-2202.173) [-2202.776] (-2199.132) (-2215.351) -- 0:03:37
410000 -- (-2199.846) [-2207.163] (-2205.538) (-2212.179) * (-2209.909) (-2217.636) [-2206.045] (-2211.063) -- 0:03:37
Average standard deviation of split frequencies: 0.010331
410500 -- (-2220.073) (-2203.368) [-2205.981] (-2219.863) * (-2209.954) (-2210.888) [-2200.882] (-2218.414) -- 0:03:36
411000 -- (-2219.243) (-2214.405) (-2206.269) [-2204.814] * (-2218.026) (-2213.842) [-2201.324] (-2205.566) -- 0:03:36
411500 -- (-2215.445) (-2210.775) [-2209.169] (-2207.178) * (-2207.365) (-2215.977) [-2202.616] (-2209.447) -- 0:03:37
412000 -- (-2206.006) (-2207.546) [-2209.663] (-2208.085) * (-2203.954) (-2210.129) (-2207.049) [-2206.784] -- 0:03:36
412500 -- (-2204.883) (-2205.889) [-2210.055] (-2208.345) * (-2207.852) (-2206.218) [-2207.148] (-2200.825) -- 0:03:36
413000 -- (-2206.303) (-2211.072) (-2210.402) [-2214.907] * (-2204.350) (-2203.181) (-2209.089) [-2208.176] -- 0:03:36
413500 -- (-2201.316) (-2204.305) (-2204.780) [-2202.370] * [-2207.670] (-2203.007) (-2203.050) (-2202.915) -- 0:03:35
414000 -- (-2216.069) (-2206.396) (-2208.016) [-2204.621] * (-2207.155) (-2199.460) (-2211.051) [-2200.743] -- 0:03:36
414500 -- (-2202.876) (-2205.710) [-2204.930] (-2211.253) * (-2209.553) [-2204.825] (-2208.232) (-2211.063) -- 0:03:36
415000 -- (-2205.642) (-2203.611) (-2210.854) [-2212.828] * (-2202.256) [-2211.832] (-2206.463) (-2211.462) -- 0:03:35
Average standard deviation of split frequencies: 0.010199
415500 -- (-2210.991) (-2207.188) [-2204.350] (-2213.187) * (-2206.882) (-2210.698) [-2212.446] (-2206.595) -- 0:03:35
416000 -- (-2216.487) (-2216.782) [-2209.359] (-2220.259) * (-2216.948) (-2219.773) [-2204.600] (-2210.546) -- 0:03:34
416500 -- (-2209.356) (-2213.448) [-2205.797] (-2211.437) * (-2205.964) (-2204.299) [-2203.038] (-2204.179) -- 0:03:34
417000 -- (-2203.193) (-2204.592) [-2201.883] (-2203.855) * (-2209.841) (-2206.465) (-2204.912) [-2200.891] -- 0:03:35
417500 -- [-2207.054] (-2208.668) (-2210.198) (-2202.379) * (-2206.277) [-2207.562] (-2211.497) (-2207.473) -- 0:03:34
418000 -- (-2211.962) (-2206.358) [-2210.825] (-2209.592) * (-2204.695) (-2201.517) (-2208.034) [-2203.595] -- 0:03:34
418500 -- [-2205.392] (-2211.616) (-2209.573) (-2207.419) * (-2211.643) [-2205.737] (-2209.975) (-2203.718) -- 0:03:33
419000 -- (-2211.795) [-2211.171] (-2203.209) (-2208.906) * (-2206.017) (-2203.321) [-2206.067] (-2215.602) -- 0:03:33
419500 -- [-2205.357] (-2207.923) (-2204.890) (-2213.959) * (-2208.312) (-2206.408) [-2201.796] (-2208.966) -- 0:03:33
420000 -- (-2211.806) (-2214.244) [-2202.484] (-2206.528) * (-2206.857) [-2212.185] (-2210.534) (-2203.257) -- 0:03:34
Average standard deviation of split frequencies: 0.009338
420500 -- (-2204.829) (-2211.476) (-2211.595) [-2202.981] * (-2202.747) [-2206.085] (-2215.853) (-2207.476) -- 0:03:33
421000 -- (-2211.924) (-2212.060) (-2221.622) [-2204.232] * (-2207.172) [-2201.022] (-2219.724) (-2211.549) -- 0:03:33
421500 -- (-2210.702) (-2212.784) [-2208.268] (-2206.702) * [-2204.916] (-2206.750) (-2211.991) (-2208.909) -- 0:03:32
422000 -- (-2204.590) [-2208.176] (-2214.063) (-2209.797) * [-2210.024] (-2207.940) (-2213.502) (-2204.994) -- 0:03:32
422500 -- (-2210.333) [-2206.824] (-2206.992) (-2208.622) * (-2205.066) (-2206.503) [-2203.774] (-2208.451) -- 0:03:33
423000 -- (-2211.169) (-2213.965) (-2206.688) [-2211.704] * (-2217.201) (-2202.166) [-2208.013] (-2207.498) -- 0:03:32
423500 -- [-2204.960] (-2219.889) (-2204.136) (-2212.712) * (-2205.711) (-2206.983) [-2204.271] (-2202.741) -- 0:03:32
424000 -- [-2201.825] (-2222.343) (-2207.364) (-2206.850) * (-2203.478) [-2210.422] (-2213.365) (-2217.798) -- 0:03:31
424500 -- [-2199.890] (-2211.032) (-2204.688) (-2204.216) * (-2205.222) (-2206.744) (-2214.277) [-2208.266] -- 0:03:31
425000 -- (-2205.732) (-2208.334) (-2206.836) [-2202.534] * [-2208.580] (-2208.478) (-2206.617) (-2208.415) -- 0:03:31
Average standard deviation of split frequencies: 0.009037
425500 -- (-2215.812) (-2204.387) [-2202.570] (-2208.449) * (-2215.808) (-2213.393) [-2205.124] (-2211.128) -- 0:03:31
426000 -- (-2219.523) (-2208.505) [-2208.707] (-2209.083) * (-2210.355) (-2209.422) (-2208.841) [-2203.126] -- 0:03:31
426500 -- (-2216.556) (-2203.776) [-2204.192] (-2218.794) * [-2204.359] (-2211.474) (-2211.622) (-2207.719) -- 0:03:31
427000 -- (-2209.443) (-2205.562) [-2202.037] (-2211.003) * [-2201.269] (-2203.259) (-2212.920) (-2210.275) -- 0:03:30
427500 -- (-2202.984) [-2210.792] (-2208.394) (-2212.323) * (-2209.199) [-2204.792] (-2209.987) (-2208.795) -- 0:03:30
428000 -- (-2209.892) [-2201.406] (-2207.279) (-2208.381) * (-2209.409) [-2198.234] (-2212.580) (-2202.249) -- 0:03:31
428500 -- (-2209.612) (-2205.281) (-2206.777) [-2200.114] * (-2213.121) [-2204.717] (-2207.988) (-2211.270) -- 0:03:30
429000 -- (-2206.664) [-2210.234] (-2208.993) (-2204.335) * [-2204.303] (-2207.629) (-2204.246) (-2204.733) -- 0:03:30
429500 -- (-2209.404) [-2201.925] (-2209.704) (-2205.846) * (-2209.568) (-2213.119) [-2207.076] (-2207.300) -- 0:03:29
430000 -- (-2208.432) [-2211.297] (-2206.597) (-2202.679) * (-2215.947) (-2208.826) (-2203.467) [-2214.473] -- 0:03:29
Average standard deviation of split frequencies: 0.008392
430500 -- (-2207.783) (-2206.783) (-2210.149) [-2203.498] * (-2205.071) (-2208.527) (-2209.435) [-2199.752] -- 0:03:29
431000 -- (-2217.007) (-2206.197) [-2207.361] (-2205.517) * [-2211.158] (-2212.620) (-2211.007) (-2207.409) -- 0:03:29
431500 -- (-2209.830) (-2220.820) [-2208.249] (-2211.730) * (-2208.151) (-2205.950) (-2204.571) [-2208.698] -- 0:03:29
432000 -- (-2213.297) (-2202.981) [-2203.480] (-2207.866) * (-2208.458) (-2205.149) [-2209.490] (-2207.403) -- 0:03:29
432500 -- (-2210.895) [-2203.556] (-2210.793) (-2201.209) * (-2211.151) (-2206.607) [-2210.461] (-2206.543) -- 0:03:28
433000 -- (-2227.362) (-2213.229) [-2204.513] (-2208.892) * (-2207.869) [-2202.950] (-2206.485) (-2208.244) -- 0:03:28
433500 -- (-2210.555) (-2205.112) [-2202.857] (-2210.374) * (-2215.955) (-2210.775) [-2203.352] (-2209.127) -- 0:03:29
434000 -- [-2204.264] (-2206.966) (-2205.551) (-2207.585) * (-2211.597) [-2195.556] (-2209.220) (-2201.018) -- 0:03:28
434500 -- (-2204.582) (-2208.577) [-2208.761] (-2213.187) * (-2210.668) [-2207.919] (-2202.989) (-2206.965) -- 0:03:28
435000 -- (-2205.766) (-2210.185) (-2206.356) [-2202.119] * [-2206.454] (-2208.882) (-2202.824) (-2207.895) -- 0:03:27
Average standard deviation of split frequencies: 0.008289
435500 -- [-2207.775] (-2210.516) (-2205.720) (-2206.131) * (-2217.660) [-2197.277] (-2207.425) (-2204.660) -- 0:03:27
436000 -- (-2209.625) [-2209.145] (-2210.087) (-2206.278) * [-2205.154] (-2210.388) (-2211.468) (-2206.037) -- 0:03:26
436500 -- (-2208.293) (-2207.066) (-2205.649) [-2206.225] * (-2201.256) (-2212.526) [-2210.608] (-2203.248) -- 0:03:27
437000 -- (-2223.901) (-2207.806) [-2201.614] (-2200.769) * (-2203.232) (-2211.446) [-2204.266] (-2209.612) -- 0:03:27
437500 -- (-2216.436) (-2207.410) (-2213.292) [-2205.395] * (-2206.369) [-2208.442] (-2210.156) (-2206.568) -- 0:03:27
438000 -- (-2214.907) [-2206.385] (-2208.114) (-2215.430) * (-2208.278) (-2215.221) [-2206.049] (-2206.988) -- 0:03:26
438500 -- (-2210.649) [-2201.709] (-2211.778) (-2207.658) * (-2213.332) (-2204.958) (-2205.413) [-2207.286] -- 0:03:26
439000 -- (-2212.176) [-2207.363] (-2220.740) (-2209.157) * (-2212.060) (-2200.031) [-2203.547] (-2217.891) -- 0:03:27
439500 -- (-2213.099) (-2208.625) [-2207.727] (-2203.230) * (-2213.552) (-2202.919) (-2204.625) [-2206.119] -- 0:03:26
440000 -- (-2212.393) (-2207.583) [-2207.588] (-2205.881) * (-2215.403) [-2203.902] (-2213.788) (-2211.991) -- 0:03:26
Average standard deviation of split frequencies: 0.009093
440500 -- (-2202.390) (-2202.378) (-2207.905) [-2203.711] * [-2202.833] (-2204.182) (-2212.355) (-2205.836) -- 0:03:25
441000 -- (-2199.845) (-2211.254) [-2205.854] (-2206.665) * (-2205.969) (-2207.078) [-2204.972] (-2208.665) -- 0:03:25
441500 -- (-2222.734) (-2208.807) [-2198.658] (-2199.604) * (-2204.968) [-2204.495] (-2207.400) (-2216.260) -- 0:03:24
442000 -- (-2207.214) (-2206.744) [-2211.561] (-2201.112) * (-2208.962) (-2204.472) (-2205.989) [-2208.700] -- 0:03:25
442500 -- (-2212.708) (-2198.072) (-2203.379) [-2202.967] * (-2206.347) [-2210.055] (-2203.472) (-2208.476) -- 0:03:25
443000 -- (-2214.377) [-2206.760] (-2209.696) (-2204.264) * (-2206.139) [-2209.495] (-2205.503) (-2209.715) -- 0:03:24
443500 -- (-2211.302) (-2208.818) [-2211.028] (-2204.136) * (-2206.710) [-2209.528] (-2206.288) (-2215.933) -- 0:03:24
444000 -- (-2214.229) [-2208.069] (-2210.799) (-2203.384) * (-2207.373) (-2208.245) (-2207.058) [-2208.177] -- 0:03:24
444500 -- (-2208.887) (-2206.837) (-2210.000) [-2208.968] * (-2208.948) [-2206.398] (-2217.469) (-2214.691) -- 0:03:24
445000 -- (-2207.284) [-2207.811] (-2214.134) (-2205.028) * [-2209.986] (-2208.974) (-2209.110) (-2204.885) -- 0:03:24
Average standard deviation of split frequencies: 0.009336
445500 -- (-2208.456) (-2205.196) (-2214.239) [-2200.532] * [-2208.198] (-2202.215) (-2203.550) (-2208.701) -- 0:03:24
446000 -- (-2216.022) (-2207.953) (-2208.910) [-2204.119] * (-2200.104) (-2210.107) [-2203.121] (-2201.868) -- 0:03:23
446500 -- (-2204.153) (-2210.224) [-2212.490] (-2206.475) * [-2204.536] (-2206.904) (-2201.804) (-2222.325) -- 0:03:23
447000 -- (-2204.411) (-2212.321) (-2201.675) [-2206.562] * (-2210.319) [-2206.890] (-2212.940) (-2215.352) -- 0:03:24
447500 -- (-2209.077) [-2210.321] (-2199.644) (-2206.702) * [-2199.019] (-2216.108) (-2218.983) (-2205.533) -- 0:03:23
448000 -- (-2205.515) (-2205.171) [-2201.105] (-2217.781) * [-2202.852] (-2218.155) (-2217.538) (-2212.465) -- 0:03:23
448500 -- (-2207.573) (-2204.724) (-2210.018) [-2209.559] * (-2205.948) (-2209.923) (-2221.784) [-2202.664] -- 0:03:22
449000 -- (-2217.332) [-2207.345] (-2205.380) (-2220.645) * (-2207.927) [-2210.136] (-2211.522) (-2204.799) -- 0:03:22
449500 -- (-2202.909) (-2209.165) [-2203.296] (-2204.982) * [-2207.350] (-2211.071) (-2200.373) (-2208.428) -- 0:03:22
450000 -- (-2203.207) [-2208.786] (-2206.891) (-2208.034) * (-2217.087) (-2205.011) (-2204.046) [-2202.344] -- 0:03:22
Average standard deviation of split frequencies: 0.009763
450500 -- (-2211.221) (-2210.090) [-2204.353] (-2203.583) * (-2217.516) [-2206.052] (-2207.462) (-2204.353) -- 0:03:22
451000 -- (-2208.749) [-2210.309] (-2211.184) (-2207.201) * (-2211.184) (-2211.560) (-2209.009) [-2202.364] -- 0:03:22
451500 -- (-2206.251) (-2208.735) (-2213.119) [-2210.607] * (-2203.351) (-2203.251) [-2207.641] (-2205.967) -- 0:03:21
452000 -- (-2202.805) [-2207.298] (-2206.216) (-2211.043) * (-2209.777) [-2200.007] (-2212.373) (-2219.462) -- 0:03:21
452500 -- (-2211.527) (-2216.402) (-2209.153) [-2212.086] * (-2207.190) (-2205.944) [-2202.063] (-2203.041) -- 0:03:22
453000 -- (-2205.887) [-2208.594] (-2208.348) (-2215.749) * [-2208.422] (-2217.207) (-2202.083) (-2202.781) -- 0:03:21
453500 -- (-2205.522) (-2205.902) [-2204.533] (-2206.646) * (-2204.940) (-2204.091) (-2206.177) [-2202.333] -- 0:03:21
454000 -- (-2209.942) (-2210.376) (-2208.287) [-2206.771] * [-2203.644] (-2209.802) (-2211.304) (-2204.708) -- 0:03:20
454500 -- (-2202.314) (-2205.795) [-2211.414] (-2202.948) * (-2211.075) (-2218.546) (-2211.137) [-2206.863] -- 0:03:20
455000 -- (-2208.097) (-2212.036) [-2213.162] (-2206.284) * (-2210.884) (-2209.836) [-2216.609] (-2214.134) -- 0:03:20
Average standard deviation of split frequencies: 0.009821
455500 -- (-2209.393) (-2212.528) [-2206.422] (-2207.039) * (-2207.107) (-2205.055) [-2206.601] (-2208.848) -- 0:03:20
456000 -- (-2208.338) (-2203.227) (-2212.204) [-2204.683] * (-2209.861) [-2201.926] (-2207.647) (-2208.027) -- 0:03:20
456500 -- [-2213.555] (-2206.150) (-2205.202) (-2204.007) * (-2214.457) [-2202.572] (-2204.576) (-2209.309) -- 0:03:20
457000 -- (-2201.539) [-2205.349] (-2216.250) (-2206.918) * (-2210.398) (-2206.488) (-2205.075) [-2210.583] -- 0:03:19
457500 -- (-2203.828) [-2203.791] (-2210.576) (-2203.316) * (-2216.928) (-2199.618) [-2205.675] (-2202.561) -- 0:03:19
458000 -- (-2204.026) (-2205.979) (-2212.518) [-2206.187] * [-2199.259] (-2207.602) (-2212.199) (-2201.279) -- 0:03:19
458500 -- (-2211.529) [-2200.473] (-2204.373) (-2205.938) * (-2206.522) (-2205.450) (-2218.155) [-2206.313] -- 0:03:19
459000 -- (-2200.744) (-2201.410) (-2207.082) [-2201.262] * (-2211.505) (-2211.916) (-2198.743) [-2201.542] -- 0:03:19
459500 -- (-2205.082) [-2201.282] (-2205.230) (-2212.242) * (-2211.072) (-2207.379) (-2206.350) [-2201.270] -- 0:03:18
460000 -- (-2209.664) [-2214.297] (-2204.265) (-2213.341) * [-2206.911] (-2213.527) (-2201.138) (-2207.626) -- 0:03:18
Average standard deviation of split frequencies: 0.010063
460500 -- [-2203.794] (-2208.631) (-2206.292) (-2204.952) * (-2211.680) [-2211.901] (-2201.236) (-2211.360) -- 0:03:17
461000 -- [-2204.421] (-2212.924) (-2212.307) (-2216.433) * (-2201.454) (-2219.294) [-2210.620] (-2208.405) -- 0:03:18
461500 -- [-2203.401] (-2207.854) (-2209.163) (-2207.520) * (-2209.742) (-2203.193) [-2206.316] (-2227.286) -- 0:03:18
462000 -- (-2205.962) (-2203.957) (-2207.137) [-2202.443] * (-2212.326) [-2203.631] (-2215.708) (-2211.729) -- 0:03:17
462500 -- [-2207.143] (-2214.870) (-2203.792) (-2204.697) * (-2203.166) (-2212.614) [-2207.493] (-2202.817) -- 0:03:17
463000 -- [-2209.771] (-2207.890) (-2224.809) (-2210.371) * (-2212.823) (-2206.406) [-2206.563] (-2202.697) -- 0:03:17
463500 -- [-2202.047] (-2204.310) (-2216.996) (-2205.586) * [-2210.276] (-2204.032) (-2203.469) (-2211.456) -- 0:03:17
464000 -- (-2206.636) (-2201.460) (-2210.980) [-2202.682] * (-2207.935) [-2206.403] (-2205.260) (-2206.346) -- 0:03:17
464500 -- (-2207.791) (-2211.185) (-2209.367) [-2209.102] * [-2205.040] (-2208.094) (-2222.072) (-2204.336) -- 0:03:17
465000 -- (-2202.919) [-2213.563] (-2210.361) (-2210.865) * (-2202.603) [-2202.526] (-2218.925) (-2208.351) -- 0:03:16
Average standard deviation of split frequencies: 0.010116
465500 -- (-2202.520) (-2215.226) [-2203.561] (-2202.657) * [-2203.728] (-2213.328) (-2214.922) (-2209.598) -- 0:03:16
466000 -- (-2203.675) (-2208.900) (-2208.750) [-2202.458] * (-2204.118) [-2203.108] (-2210.177) (-2206.973) -- 0:03:15
466500 -- [-2202.006] (-2214.854) (-2208.263) (-2203.299) * [-2209.845] (-2204.879) (-2213.260) (-2209.530) -- 0:03:16
467000 -- (-2205.899) (-2209.532) [-2207.627] (-2213.195) * (-2211.493) [-2208.831] (-2220.019) (-2213.724) -- 0:03:16
467500 -- (-2215.541) (-2206.260) [-2202.683] (-2202.275) * (-2202.470) [-2211.782] (-2208.293) (-2208.607) -- 0:03:15
468000 -- (-2203.251) [-2199.769] (-2201.338) (-2208.977) * (-2203.480) (-2213.451) [-2206.545] (-2202.500) -- 0:03:15
468500 -- [-2200.101] (-2205.435) (-2209.710) (-2209.966) * (-2210.959) [-2205.115] (-2206.519) (-2204.783) -- 0:03:15
469000 -- [-2200.438] (-2208.738) (-2207.193) (-2207.282) * [-2200.951] (-2212.461) (-2208.565) (-2207.812) -- 0:03:15
469500 -- (-2210.253) (-2211.131) (-2208.917) [-2203.085] * (-2203.706) (-2207.317) (-2202.033) [-2205.862] -- 0:03:15
470000 -- [-2207.924] (-2210.257) (-2208.755) (-2207.665) * (-2212.094) (-2210.725) [-2205.959] (-2208.492) -- 0:03:15
Average standard deviation of split frequencies: 0.009682
470500 -- (-2207.393) (-2224.920) [-2200.737] (-2202.205) * [-2208.555] (-2209.417) (-2210.013) (-2206.765) -- 0:03:14
471000 -- (-2212.617) (-2217.586) (-2205.265) [-2204.788] * [-2205.218] (-2215.792) (-2206.865) (-2204.200) -- 0:03:14
471500 -- (-2209.951) (-2213.144) (-2207.237) [-2202.246] * (-2212.797) (-2218.472) (-2202.604) [-2204.262] -- 0:03:13
472000 -- (-2203.228) (-2204.057) (-2214.902) [-2200.028] * (-2209.215) [-2210.180] (-2211.540) (-2205.297) -- 0:03:14
472500 -- (-2209.574) [-2207.938] (-2210.956) (-2203.775) * (-2204.303) [-2206.619] (-2207.595) (-2205.353) -- 0:03:14
473000 -- (-2206.074) (-2203.076) [-2208.854] (-2200.246) * (-2201.891) (-2216.144) (-2206.649) [-2203.197] -- 0:03:13
473500 -- (-2205.926) [-2202.967] (-2211.854) (-2201.848) * (-2214.005) (-2204.643) [-2205.001] (-2208.198) -- 0:03:13
474000 -- (-2212.122) [-2211.247] (-2206.604) (-2205.723) * (-2208.503) [-2209.610] (-2204.706) (-2201.794) -- 0:03:13
474500 -- [-2203.004] (-2201.845) (-2209.734) (-2211.662) * (-2202.576) [-2210.537] (-2210.698) (-2207.039) -- 0:03:13
475000 -- (-2212.630) [-2208.830] (-2209.603) (-2208.796) * (-2205.747) [-2206.591] (-2213.884) (-2204.985) -- 0:03:13
Average standard deviation of split frequencies: 0.009408
475500 -- (-2214.111) (-2207.973) (-2203.478) [-2200.157] * (-2204.563) (-2207.016) [-2204.069] (-2207.822) -- 0:03:13
476000 -- (-2214.698) [-2207.706] (-2211.116) (-2204.060) * (-2212.621) (-2210.107) [-2210.437] (-2202.554) -- 0:03:12
476500 -- (-2206.489) (-2214.068) [-2210.880] (-2208.589) * (-2199.527) (-2201.203) [-2206.796] (-2209.556) -- 0:03:12
477000 -- (-2208.400) (-2219.403) [-2210.554] (-2205.471) * (-2201.544) (-2206.496) (-2203.426) [-2210.284] -- 0:03:11
477500 -- (-2213.848) (-2209.166) [-2205.632] (-2210.056) * (-2206.236) [-2214.065] (-2203.860) (-2207.494) -- 0:03:12
478000 -- (-2210.999) (-2210.892) (-2202.979) [-2204.373] * (-2206.467) (-2216.302) [-2211.126] (-2203.875) -- 0:03:12
478500 -- (-2206.542) (-2216.580) [-2204.720] (-2214.956) * (-2202.979) (-2205.417) [-2202.655] (-2208.967) -- 0:03:11
479000 -- (-2210.829) (-2207.992) (-2203.843) [-2207.280] * (-2211.520) (-2203.329) [-2205.828] (-2209.360) -- 0:03:11
479500 -- (-2214.966) [-2212.413] (-2201.564) (-2201.763) * (-2214.127) (-2206.537) [-2205.525] (-2202.927) -- 0:03:11
480000 -- [-2203.290] (-2205.736) (-2204.637) (-2212.225) * (-2216.056) [-2208.884] (-2205.521) (-2208.253) -- 0:03:11
Average standard deviation of split frequencies: 0.008990
480500 -- (-2206.122) (-2214.248) [-2212.651] (-2210.054) * (-2210.089) [-2197.877] (-2207.606) (-2205.841) -- 0:03:11
481000 -- (-2212.705) (-2205.354) (-2210.644) [-2207.893] * (-2212.748) [-2202.961] (-2206.876) (-2209.821) -- 0:03:10
481500 -- (-2208.157) (-2210.570) [-2197.010] (-2216.646) * (-2208.275) (-2212.242) [-2203.449] (-2205.979) -- 0:03:10
482000 -- (-2209.646) [-2199.954] (-2199.076) (-2205.217) * (-2207.100) (-2209.044) [-2202.827] (-2218.336) -- 0:03:10
482500 -- (-2206.726) (-2213.147) (-2205.622) [-2206.499] * (-2206.746) (-2213.624) [-2203.557] (-2215.637) -- 0:03:09
483000 -- (-2203.505) (-2203.650) [-2203.700] (-2212.927) * (-2201.502) (-2203.809) (-2213.211) [-2206.236] -- 0:03:10
483500 -- (-2210.745) (-2210.354) [-2211.344] (-2213.597) * [-2209.334] (-2201.139) (-2214.095) (-2208.907) -- 0:03:10
484000 -- (-2213.054) [-2205.462] (-2212.809) (-2219.431) * (-2209.336) (-2207.320) [-2209.254] (-2206.787) -- 0:03:09
484500 -- (-2200.624) (-2203.646) [-2207.357] (-2209.171) * (-2212.404) (-2211.386) [-2200.803] (-2206.173) -- 0:03:09
485000 -- (-2209.312) [-2202.490] (-2211.421) (-2205.718) * (-2209.427) (-2206.009) [-2205.832] (-2208.076) -- 0:03:09
Average standard deviation of split frequencies: 0.008730
485500 -- (-2217.200) [-2204.849] (-2206.957) (-2203.562) * (-2203.648) (-2204.606) [-2199.430] (-2207.351) -- 0:03:09
486000 -- (-2214.062) (-2207.476) [-2204.541] (-2206.983) * (-2213.548) (-2211.385) [-2214.557] (-2209.336) -- 0:03:09
486500 -- [-2204.889] (-2209.073) (-2212.552) (-2204.600) * (-2208.382) [-2210.996] (-2201.983) (-2208.977) -- 0:03:08
487000 -- [-2205.622] (-2202.479) (-2217.372) (-2207.183) * (-2202.651) (-2209.135) (-2203.379) [-2206.848] -- 0:03:08
487500 -- (-2203.126) (-2207.402) [-2198.447] (-2208.865) * [-2202.324] (-2221.563) (-2212.317) (-2203.828) -- 0:03:08
488000 -- (-2211.764) (-2206.151) (-2205.633) [-2204.744] * (-2209.581) (-2210.476) (-2209.578) [-2206.127] -- 0:03:07
488500 -- (-2203.461) (-2207.381) (-2208.816) [-2203.557] * (-2204.497) (-2210.231) (-2209.614) [-2204.777] -- 0:03:08
489000 -- (-2203.306) (-2209.126) [-2203.222] (-2208.288) * (-2202.477) (-2217.324) [-2208.852] (-2202.625) -- 0:03:08
489500 -- [-2205.451] (-2207.496) (-2206.526) (-2203.655) * (-2206.084) (-2211.958) [-2209.128] (-2203.095) -- 0:03:07
490000 -- (-2208.682) (-2204.947) (-2213.915) [-2212.098] * (-2212.415) [-2206.837] (-2207.847) (-2217.946) -- 0:03:07
Average standard deviation of split frequencies: 0.008487
490500 -- (-2211.588) [-2209.258] (-2205.484) (-2214.486) * [-2213.065] (-2216.141) (-2202.086) (-2208.417) -- 0:03:06
491000 -- [-2202.591] (-2215.369) (-2213.496) (-2205.053) * [-2207.737] (-2207.086) (-2201.216) (-2213.207) -- 0:03:07
491500 -- (-2203.980) (-2212.576) (-2220.664) [-2211.639] * [-2210.312] (-2201.099) (-2211.561) (-2205.560) -- 0:03:07
492000 -- (-2202.521) [-2204.196] (-2207.340) (-2202.883) * (-2200.627) (-2204.094) (-2206.006) [-2211.888] -- 0:03:06
492500 -- (-2204.030) [-2200.986] (-2203.419) (-2208.323) * [-2205.798] (-2205.572) (-2211.661) (-2203.515) -- 0:03:06
493000 -- (-2204.970) (-2207.624) [-2205.292] (-2209.569) * (-2208.433) [-2202.169] (-2205.709) (-2209.992) -- 0:03:06
493500 -- (-2207.233) (-2212.390) [-2205.221] (-2204.920) * (-2209.382) (-2208.461) [-2214.173] (-2202.284) -- 0:03:05
494000 -- (-2206.576) (-2211.429) (-2213.174) [-2199.786] * (-2215.791) [-2209.869] (-2202.354) (-2216.050) -- 0:03:06
494500 -- [-2203.380] (-2209.905) (-2201.638) (-2209.906) * (-2205.899) [-2208.054] (-2199.094) (-2211.960) -- 0:03:06
495000 -- [-2208.166] (-2207.024) (-2202.476) (-2208.937) * [-2200.473] (-2212.130) (-2205.185) (-2205.398) -- 0:03:05
Average standard deviation of split frequencies: 0.008395
495500 -- (-2207.052) (-2206.891) (-2204.831) [-2203.157] * [-2204.487] (-2198.699) (-2207.442) (-2209.689) -- 0:03:05
496000 -- (-2202.230) (-2211.974) [-2205.040] (-2202.916) * (-2208.108) [-2204.107] (-2212.289) (-2206.526) -- 0:03:04
496500 -- (-2206.704) [-2209.442] (-2208.789) (-2211.629) * (-2206.620) (-2202.853) (-2206.831) [-2208.627] -- 0:03:05
497000 -- [-2209.380] (-2202.425) (-2207.889) (-2207.737) * (-2205.919) (-2209.246) [-2203.710] (-2209.263) -- 0:03:05
497500 -- (-2210.927) (-2212.288) [-2207.328] (-2202.515) * [-2214.092] (-2222.098) (-2207.579) (-2218.387) -- 0:03:04
498000 -- [-2210.231] (-2207.110) (-2214.809) (-2211.177) * (-2208.536) (-2210.796) [-2204.379] (-2217.240) -- 0:03:04
498500 -- (-2212.020) (-2210.085) [-2214.213] (-2204.525) * [-2203.721] (-2213.002) (-2208.108) (-2210.382) -- 0:03:04
499000 -- (-2209.686) [-2206.536] (-2206.587) (-2204.729) * [-2207.470] (-2214.528) (-2213.809) (-2203.542) -- 0:03:03
499500 -- (-2200.957) [-2208.920] (-2214.831) (-2211.914) * (-2213.851) [-2209.350] (-2208.543) (-2212.079) -- 0:03:04
500000 -- (-2214.603) (-2204.078) [-2204.405] (-2211.811) * (-2208.925) [-2205.850] (-2210.357) (-2208.985) -- 0:03:04
Average standard deviation of split frequencies: 0.007062
500500 -- [-2202.782] (-2200.341) (-2209.153) (-2206.409) * [-2204.599] (-2199.913) (-2205.092) (-2205.869) -- 0:03:03
501000 -- (-2201.257) (-2203.498) [-2202.419] (-2205.388) * (-2203.896) [-2208.682] (-2205.389) (-2224.882) -- 0:03:03
501500 -- (-2209.687) [-2214.801] (-2209.485) (-2200.344) * (-2211.402) [-2204.287] (-2205.286) (-2211.524) -- 0:03:02
502000 -- (-2215.482) [-2209.506] (-2211.557) (-2211.683) * (-2209.933) (-2203.926) (-2205.852) [-2206.269] -- 0:03:03
502500 -- [-2209.157] (-2211.174) (-2203.416) (-2202.209) * (-2218.017) [-2204.520] (-2209.097) (-2207.276) -- 0:03:03
503000 -- [-2202.514] (-2207.074) (-2210.366) (-2210.558) * (-2229.131) (-2203.184) (-2211.137) [-2206.054] -- 0:03:02
503500 -- [-2205.293] (-2213.692) (-2214.369) (-2208.793) * (-2207.764) [-2208.302] (-2200.312) (-2204.379) -- 0:03:02
504000 -- (-2207.558) (-2210.459) [-2215.566] (-2211.347) * (-2210.040) [-2208.399] (-2205.360) (-2206.814) -- 0:03:02
504500 -- (-2204.992) [-2212.005] (-2212.549) (-2212.601) * (-2211.225) [-2205.332] (-2209.335) (-2203.162) -- 0:03:01
505000 -- (-2219.346) [-2202.956] (-2203.669) (-2205.683) * (-2211.313) [-2213.981] (-2203.996) (-2213.169) -- 0:03:02
Average standard deviation of split frequencies: 0.006654
505500 -- (-2211.854) [-2204.702] (-2209.262) (-2204.752) * [-2208.125] (-2200.495) (-2217.864) (-2211.239) -- 0:03:01
506000 -- (-2205.881) (-2205.879) [-2207.368] (-2205.838) * (-2207.740) (-2203.139) (-2208.210) [-2207.446] -- 0:03:01
506500 -- (-2205.408) (-2201.199) [-2208.238] (-2205.251) * (-2216.979) (-2212.480) (-2206.764) [-2207.066] -- 0:03:01
507000 -- (-2211.133) [-2207.408] (-2211.110) (-2224.376) * (-2208.703) [-2201.830] (-2212.286) (-2209.907) -- 0:03:00
507500 -- (-2202.881) [-2215.059] (-2209.254) (-2204.701) * (-2203.313) (-2205.213) (-2204.212) [-2208.399] -- 0:03:01
508000 -- (-2206.434) (-2210.049) [-2203.301] (-2202.381) * [-2204.730] (-2210.107) (-2204.107) (-2206.478) -- 0:03:01
508500 -- [-2202.479] (-2204.223) (-2207.238) (-2203.986) * (-2213.038) (-2207.210) [-2220.442] (-2209.938) -- 0:03:00
509000 -- (-2215.412) [-2210.507] (-2207.926) (-2212.461) * [-2208.089] (-2211.753) (-2217.699) (-2209.394) -- 0:03:00
509500 -- (-2203.153) (-2206.773) (-2206.004) [-2213.521] * (-2209.876) (-2215.916) (-2207.664) [-2200.386] -- 0:03:00
510000 -- [-2206.195] (-2208.753) (-2208.741) (-2212.210) * [-2209.554] (-2203.282) (-2205.741) (-2205.567) -- 0:02:59
Average standard deviation of split frequencies: 0.006330
510500 -- [-2205.765] (-2210.746) (-2204.325) (-2214.347) * (-2206.285) (-2212.292) (-2216.688) [-2203.909] -- 0:03:00
511000 -- (-2207.089) (-2218.748) [-2201.167] (-2210.463) * (-2210.662) (-2210.277) [-2209.919] (-2203.101) -- 0:02:59
511500 -- (-2204.119) (-2209.395) [-2209.558] (-2208.035) * [-2203.105] (-2219.150) (-2204.204) (-2207.723) -- 0:02:59
512000 -- (-2206.843) (-2211.290) [-2207.471] (-2218.777) * (-2213.848) (-2216.355) (-2201.756) [-2206.585] -- 0:02:59
512500 -- (-2223.172) [-2202.882] (-2210.796) (-2212.471) * (-2211.561) [-2211.834] (-2207.397) (-2205.239) -- 0:02:58
513000 -- (-2210.156) (-2218.383) (-2206.341) [-2213.789] * [-2206.095] (-2211.203) (-2206.239) (-2216.688) -- 0:02:59
513500 -- [-2204.652] (-2205.705) (-2214.079) (-2213.265) * (-2215.255) (-2206.833) [-2202.394] (-2207.739) -- 0:02:59
514000 -- [-2202.225] (-2210.794) (-2201.213) (-2212.435) * (-2205.498) [-2207.090] (-2219.317) (-2218.006) -- 0:02:58
514500 -- (-2212.673) [-2206.412] (-2209.005) (-2218.828) * [-2205.404] (-2204.571) (-2207.430) (-2205.465) -- 0:02:58
515000 -- (-2205.920) (-2203.642) [-2203.762] (-2217.417) * (-2206.347) [-2203.911] (-2208.297) (-2209.314) -- 0:02:57
Average standard deviation of split frequencies: 0.006265
515500 -- (-2203.791) [-2204.099] (-2213.940) (-2210.113) * (-2204.664) (-2207.355) [-2198.363] (-2208.933) -- 0:02:57
516000 -- (-2206.213) (-2210.120) [-2211.258] (-2206.012) * [-2202.643] (-2205.847) (-2208.604) (-2213.013) -- 0:02:58
516500 -- (-2210.520) (-2220.309) [-2208.823] (-2206.772) * (-2210.936) (-2210.693) [-2205.920] (-2206.111) -- 0:02:57
517000 -- (-2199.429) (-2209.081) (-2213.608) [-2212.809] * (-2208.730) (-2202.317) (-2211.537) [-2205.126] -- 0:02:57
517500 -- [-2203.553] (-2222.724) (-2200.221) (-2207.676) * [-2210.256] (-2208.098) (-2212.245) (-2215.057) -- 0:02:57
518000 -- (-2206.827) (-2211.423) [-2204.928] (-2202.239) * (-2209.398) [-2207.328] (-2207.971) (-2203.881) -- 0:02:56
518500 -- [-2208.318] (-2205.200) (-2213.934) (-2201.123) * (-2204.578) [-2205.113] (-2205.009) (-2210.654) -- 0:02:57
519000 -- (-2205.863) (-2209.831) (-2201.168) [-2212.744] * (-2211.458) (-2203.843) (-2212.222) [-2211.886] -- 0:02:57
519500 -- (-2212.221) [-2202.468] (-2207.018) (-2211.312) * (-2213.845) [-2206.946] (-2200.989) (-2206.036) -- 0:02:56
520000 -- (-2215.013) (-2205.250) (-2208.183) [-2203.664] * [-2205.258] (-2208.621) (-2211.470) (-2206.437) -- 0:02:56
Average standard deviation of split frequencies: 0.006467
520500 -- (-2212.670) (-2207.446) (-2217.212) [-2201.035] * (-2207.049) (-2214.549) [-2208.053] (-2211.951) -- 0:02:55
521000 -- [-2204.498] (-2205.094) (-2214.086) (-2205.057) * (-2208.213) (-2208.123) [-2204.703] (-2200.747) -- 0:02:55
521500 -- (-2206.519) (-2204.906) (-2205.292) [-2203.294] * (-2211.636) (-2203.738) [-2209.032] (-2204.976) -- 0:02:56
522000 -- (-2208.078) (-2211.032) (-2207.731) [-2200.847] * (-2205.846) [-2205.721] (-2209.496) (-2208.959) -- 0:02:55
522500 -- (-2205.042) (-2205.537) (-2208.255) [-2202.957] * (-2206.417) (-2205.942) (-2211.201) [-2208.048] -- 0:02:55
523000 -- (-2198.855) (-2206.348) (-2204.935) [-2203.436] * [-2205.666] (-2203.739) (-2206.287) (-2203.892) -- 0:02:55
523500 -- (-2209.013) [-2205.172] (-2206.124) (-2212.012) * (-2203.062) [-2203.696] (-2206.092) (-2207.345) -- 0:02:54
524000 -- [-2204.912] (-2208.215) (-2204.395) (-2211.006) * (-2206.807) (-2211.602) [-2208.219] (-2205.214) -- 0:02:55
524500 -- [-2202.709] (-2213.194) (-2211.497) (-2212.000) * (-2207.800) [-2215.192] (-2212.160) (-2204.373) -- 0:02:54
525000 -- (-2204.977) [-2202.829] (-2205.948) (-2219.811) * (-2202.447) [-2207.968] (-2208.411) (-2201.410) -- 0:02:54
Average standard deviation of split frequencies: 0.006914
525500 -- (-2211.875) (-2210.942) (-2203.198) [-2210.389] * [-2210.740] (-2206.525) (-2216.480) (-2210.439) -- 0:02:54
526000 -- (-2200.363) [-2207.043] (-2202.818) (-2205.934) * (-2209.431) (-2206.368) [-2201.306] (-2212.376) -- 0:02:53
526500 -- [-2212.301] (-2201.962) (-2201.709) (-2207.086) * [-2202.624] (-2206.665) (-2201.384) (-2207.151) -- 0:02:54
527000 -- (-2212.563) (-2203.773) (-2205.517) [-2204.775] * (-2212.876) (-2205.810) [-2205.505] (-2208.954) -- 0:02:54
527500 -- (-2210.822) (-2205.081) (-2204.646) [-2210.207] * [-2205.314] (-2204.729) (-2204.908) (-2203.369) -- 0:02:53
528000 -- (-2214.998) (-2210.666) (-2210.304) [-2202.553] * (-2222.954) (-2207.304) [-2204.228] (-2205.457) -- 0:02:53
528500 -- (-2204.661) (-2207.578) (-2208.963) [-2208.041] * [-2202.993] (-2210.253) (-2202.578) (-2204.660) -- 0:02:53
529000 -- (-2200.630) (-2208.792) (-2209.081) [-2202.634] * (-2204.163) [-2210.855] (-2216.285) (-2203.802) -- 0:02:52
529500 -- (-2208.796) (-2206.250) (-2205.428) [-2207.924] * (-2212.266) (-2201.669) [-2208.232] (-2206.460) -- 0:02:53
530000 -- [-2205.051] (-2209.563) (-2208.284) (-2207.224) * (-2205.987) (-2209.742) (-2202.922) [-2210.433] -- 0:02:52
Average standard deviation of split frequencies: 0.007234
530500 -- [-2202.156] (-2213.395) (-2214.606) (-2213.805) * (-2212.087) (-2212.568) (-2202.322) [-2202.039] -- 0:02:52
531000 -- (-2202.821) [-2210.948] (-2206.920) (-2210.464) * (-2206.521) (-2203.679) (-2208.470) [-2210.108] -- 0:02:52
531500 -- (-2213.001) (-2205.449) (-2210.963) [-2208.530] * (-2203.993) (-2209.376) [-2213.616] (-2216.235) -- 0:02:51
532000 -- (-2214.653) [-2208.847] (-2209.306) (-2205.534) * (-2211.944) (-2211.055) [-2203.504] (-2205.340) -- 0:02:52
532500 -- [-2205.394] (-2209.892) (-2211.171) (-2211.527) * (-2205.817) (-2210.581) [-2206.052] (-2204.122) -- 0:02:52
533000 -- (-2203.927) (-2202.671) [-2204.255] (-2205.996) * (-2211.824) (-2205.326) (-2201.845) [-2206.240] -- 0:02:51
533500 -- (-2205.420) [-2203.753] (-2210.225) (-2203.313) * (-2209.605) [-2213.180] (-2205.999) (-2208.775) -- 0:02:51
534000 -- [-2204.203] (-2209.479) (-2212.155) (-2204.910) * (-2218.713) (-2211.946) (-2209.458) [-2205.519] -- 0:02:51
534500 -- (-2208.811) (-2207.461) (-2201.106) [-2202.486] * (-2209.376) (-2206.078) [-2213.234] (-2209.150) -- 0:02:50
535000 -- [-2205.711] (-2209.940) (-2204.637) (-2212.658) * (-2203.265) [-2206.008] (-2213.059) (-2208.585) -- 0:02:51
Average standard deviation of split frequencies: 0.007664
535500 -- [-2207.471] (-2206.233) (-2214.033) (-2206.907) * [-2199.740] (-2214.002) (-2207.438) (-2213.448) -- 0:02:50
536000 -- (-2222.018) (-2204.131) (-2211.385) [-2203.470] * [-2204.326] (-2211.626) (-2210.545) (-2207.001) -- 0:02:50
536500 -- [-2200.085] (-2203.990) (-2208.379) (-2205.657) * (-2205.582) [-2203.588] (-2213.144) (-2212.894) -- 0:02:50
537000 -- (-2207.085) (-2220.219) [-2200.873] (-2220.865) * (-2212.936) (-2200.254) [-2206.955] (-2208.374) -- 0:02:49
537500 -- [-2207.601] (-2207.144) (-2203.635) (-2196.752) * (-2207.182) [-2205.380] (-2205.873) (-2207.522) -- 0:02:50
538000 -- [-2210.588] (-2213.228) (-2207.919) (-2202.178) * (-2215.475) [-2208.721] (-2206.242) (-2213.017) -- 0:02:50
538500 -- (-2215.854) (-2209.723) (-2199.366) [-2205.175] * (-2211.240) (-2211.073) [-2207.771] (-2208.560) -- 0:02:49
539000 -- [-2205.632] (-2203.515) (-2205.293) (-2202.674) * (-2211.660) (-2219.637) [-2214.458] (-2208.705) -- 0:02:49
539500 -- (-2206.933) (-2209.611) [-2208.137] (-2202.945) * [-2208.802] (-2208.941) (-2211.858) (-2212.008) -- 0:02:49
540000 -- (-2208.519) [-2204.888] (-2206.978) (-2202.555) * [-2205.055] (-2216.834) (-2206.268) (-2202.624) -- 0:02:48
Average standard deviation of split frequencies: 0.007847
540500 -- (-2204.634) [-2209.513] (-2219.822) (-2206.212) * (-2208.626) (-2207.342) [-2201.092] (-2212.525) -- 0:02:49
541000 -- (-2203.618) (-2203.613) [-2203.983] (-2210.663) * [-2203.033] (-2211.594) (-2204.472) (-2211.057) -- 0:02:48
541500 -- [-2204.683] (-2213.687) (-2209.732) (-2203.563) * (-2209.089) [-2201.074] (-2218.556) (-2203.745) -- 0:02:48
542000 -- (-2205.033) (-2204.200) (-2208.495) [-2199.718] * (-2207.885) [-2203.757] (-2200.650) (-2202.387) -- 0:02:48
542500 -- (-2204.850) [-2213.530] (-2209.581) (-2202.813) * [-2209.833] (-2208.992) (-2201.073) (-2208.992) -- 0:02:47
543000 -- (-2212.387) [-2207.214] (-2209.471) (-2209.746) * (-2214.544) (-2206.340) (-2208.067) [-2200.973] -- 0:02:48
543500 -- (-2207.502) (-2207.999) (-2206.646) [-2214.728] * (-2203.459) [-2206.953] (-2212.115) (-2209.593) -- 0:02:47
544000 -- (-2203.069) [-2208.715] (-2205.906) (-2212.808) * (-2205.621) (-2204.123) [-2202.054] (-2206.594) -- 0:02:47
544500 -- [-2209.059] (-2205.236) (-2210.649) (-2203.835) * (-2226.160) (-2215.194) (-2207.196) [-2199.177] -- 0:02:47
545000 -- (-2209.602) (-2207.514) [-2203.174] (-2209.557) * (-2214.863) (-2206.611) (-2205.701) [-2204.362] -- 0:02:46
Average standard deviation of split frequencies: 0.007770
545500 -- (-2207.337) [-2203.250] (-2205.669) (-2205.227) * [-2204.543] (-2208.818) (-2199.056) (-2205.863) -- 0:02:47
546000 -- (-2210.695) (-2208.432) (-2217.138) [-2206.862] * (-2208.987) [-2206.580] (-2215.213) (-2208.296) -- 0:02:47
546500 -- [-2205.572] (-2206.590) (-2212.085) (-2201.722) * (-2209.700) (-2199.096) (-2211.831) [-2206.845] -- 0:02:46
547000 -- (-2208.916) [-2208.138] (-2208.769) (-2202.340) * [-2208.495] (-2205.492) (-2205.274) (-2215.648) -- 0:02:46
547500 -- (-2216.452) (-2213.388) (-2213.683) [-2206.327] * (-2215.504) [-2201.925] (-2206.051) (-2207.719) -- 0:02:46
548000 -- [-2205.484] (-2203.379) (-2209.711) (-2211.276) * [-2208.237] (-2211.676) (-2204.555) (-2208.680) -- 0:02:45
548500 -- (-2215.580) (-2203.005) (-2206.694) [-2208.604] * (-2211.894) (-2206.964) [-2200.759] (-2203.249) -- 0:02:46
549000 -- (-2203.056) (-2207.451) [-2211.214] (-2209.173) * (-2212.262) [-2207.114] (-2209.135) (-2210.309) -- 0:02:45
549500 -- (-2213.673) (-2205.449) (-2203.411) [-2208.531] * [-2204.779] (-2204.331) (-2209.312) (-2206.134) -- 0:02:45
550000 -- (-2208.688) [-2205.043] (-2208.290) (-2204.768) * (-2210.721) [-2203.965] (-2205.011) (-2209.683) -- 0:02:45
Average standard deviation of split frequencies: 0.008561
550500 -- [-2203.253] (-2205.352) (-2202.244) (-2216.085) * (-2203.668) (-2203.787) [-2206.940] (-2211.214) -- 0:02:44
551000 -- (-2205.869) (-2219.323) (-2211.000) [-2209.798] * (-2209.615) [-2212.430] (-2211.167) (-2202.953) -- 0:02:45
551500 -- (-2203.807) (-2209.096) [-2213.612] (-2219.636) * (-2208.630) (-2217.659) [-2205.108] (-2204.308) -- 0:02:45
552000 -- [-2203.341] (-2214.287) (-2205.779) (-2202.408) * (-2202.207) (-2208.477) (-2206.516) [-2202.892] -- 0:02:44
552500 -- [-2203.908] (-2201.264) (-2212.503) (-2207.374) * [-2201.509] (-2215.399) (-2206.449) (-2207.219) -- 0:02:44
553000 -- (-2207.575) [-2205.451] (-2209.139) (-2211.668) * (-2202.190) (-2210.839) (-2223.873) [-2203.491] -- 0:02:44
553500 -- (-2215.999) [-2205.900] (-2205.356) (-2208.417) * (-2200.810) [-2206.049] (-2210.791) (-2208.665) -- 0:02:43
554000 -- (-2210.104) (-2214.504) [-2203.880] (-2204.297) * (-2201.400) (-2204.700) (-2217.978) [-2199.459] -- 0:02:44
554500 -- (-2218.528) (-2206.347) [-2212.217] (-2203.678) * (-2213.628) (-2203.604) (-2210.885) [-2200.360] -- 0:02:43
555000 -- [-2201.735] (-2212.877) (-2204.810) (-2204.863) * [-2215.445] (-2222.999) (-2207.203) (-2204.517) -- 0:02:43
Average standard deviation of split frequencies: 0.008115
555500 -- [-2205.563] (-2203.815) (-2209.769) (-2212.764) * (-2209.226) [-2205.576] (-2206.061) (-2209.615) -- 0:02:43
556000 -- [-2209.604] (-2209.614) (-2206.179) (-2207.758) * (-2209.031) (-2213.220) (-2205.350) [-2209.847] -- 0:02:42
556500 -- (-2201.463) (-2209.392) [-2203.775] (-2201.937) * (-2222.704) (-2201.765) (-2204.567) [-2205.961] -- 0:02:43
557000 -- (-2198.381) (-2208.047) (-2206.115) [-2198.802] * (-2202.063) (-2212.339) (-2204.199) [-2210.986] -- 0:02:43
557500 -- (-2203.038) (-2204.459) (-2205.086) [-2201.353] * (-2212.762) (-2202.107) (-2204.373) [-2209.671] -- 0:02:42
558000 -- (-2210.487) (-2204.881) [-2202.955] (-2206.974) * (-2208.751) (-2205.391) [-2203.428] (-2221.635) -- 0:02:42
558500 -- (-2212.138) [-2203.399] (-2208.022) (-2208.366) * (-2207.113) [-2203.456] (-2210.887) (-2208.771) -- 0:02:42
559000 -- (-2208.383) (-2202.797) (-2211.169) [-2212.903] * (-2200.411) [-2202.304] (-2206.525) (-2214.745) -- 0:02:41
559500 -- (-2204.394) (-2212.377) [-2200.696] (-2206.153) * (-2209.579) [-2205.516] (-2207.932) (-2206.209) -- 0:02:42
560000 -- (-2206.277) (-2203.924) (-2204.770) [-2202.767] * (-2212.480) (-2208.379) [-2204.406] (-2206.592) -- 0:02:41
Average standard deviation of split frequencies: 0.007807
560500 -- (-2204.811) (-2203.556) (-2204.972) [-2204.369] * (-2210.779) (-2208.956) [-2206.304] (-2208.668) -- 0:02:41
561000 -- (-2202.930) (-2209.526) [-2204.549] (-2207.775) * (-2204.088) [-2205.082] (-2202.955) (-2206.796) -- 0:02:41
561500 -- (-2206.811) (-2208.677) (-2207.787) [-2203.828] * (-2209.768) [-2209.130] (-2204.009) (-2212.091) -- 0:02:40
562000 -- (-2211.126) [-2211.650] (-2205.868) (-2203.019) * (-2212.350) (-2207.630) (-2205.469) [-2209.053] -- 0:02:41
562500 -- [-2205.976] (-2211.889) (-2206.763) (-2210.375) * (-2213.563) [-2203.922] (-2203.632) (-2216.550) -- 0:02:41
563000 -- (-2210.496) [-2201.010] (-2207.823) (-2214.651) * (-2203.815) [-2207.129] (-2208.677) (-2213.989) -- 0:02:40
563500 -- (-2214.421) [-2202.577] (-2206.955) (-2222.613) * (-2204.093) [-2203.792] (-2219.368) (-2213.629) -- 0:02:40
564000 -- (-2209.787) (-2204.357) (-2204.383) [-2204.361] * (-2209.887) [-2208.088] (-2209.295) (-2218.027) -- 0:02:40
564500 -- (-2219.866) (-2206.387) [-2214.120] (-2211.284) * [-2209.091] (-2211.343) (-2205.512) (-2205.655) -- 0:02:39
565000 -- [-2208.544] (-2211.245) (-2208.122) (-2207.640) * (-2209.080) [-2208.924] (-2211.192) (-2215.115) -- 0:02:40
Average standard deviation of split frequencies: 0.007972
565500 -- (-2208.232) (-2207.461) [-2209.873] (-2209.225) * (-2212.848) (-2208.885) (-2203.189) [-2201.198] -- 0:02:39
566000 -- (-2212.237) (-2208.497) [-2205.187] (-2205.047) * [-2208.189] (-2205.619) (-2201.895) (-2204.233) -- 0:02:39
566500 -- (-2203.331) (-2209.152) (-2206.553) [-2209.012] * (-2204.994) [-2208.069] (-2209.796) (-2204.770) -- 0:02:39
567000 -- (-2205.461) (-2224.176) (-2208.311) [-2217.642] * (-2203.700) (-2210.452) (-2205.004) [-2205.980] -- 0:02:39
567500 -- [-2202.331] (-2209.259) (-2210.149) (-2208.044) * (-2206.825) (-2220.323) (-2215.008) [-2207.125] -- 0:02:39
568000 -- [-2200.958] (-2214.562) (-2207.498) (-2207.232) * (-2212.350) [-2202.492] (-2208.494) (-2210.543) -- 0:02:38
568500 -- (-2205.125) (-2200.634) [-2208.628] (-2204.283) * [-2202.468] (-2216.076) (-2216.585) (-2207.308) -- 0:02:38
569000 -- (-2205.948) [-2209.195] (-2213.394) (-2215.872) * (-2207.051) [-2204.573] (-2209.310) (-2213.311) -- 0:02:38
569500 -- (-2212.555) [-2209.055] (-2206.743) (-2205.081) * [-2212.431] (-2200.123) (-2207.463) (-2205.889) -- 0:02:38
570000 -- (-2213.445) [-2206.183] (-2208.580) (-2209.051) * [-2204.707] (-2205.946) (-2211.383) (-2206.719) -- 0:02:38
Average standard deviation of split frequencies: 0.007907
570500 -- [-2207.892] (-2203.483) (-2202.311) (-2209.842) * (-2204.958) (-2203.624) (-2204.017) [-2207.123] -- 0:02:38
571000 -- [-2212.603] (-2214.290) (-2219.911) (-2223.455) * (-2209.253) (-2209.313) (-2207.520) [-2205.693] -- 0:02:37
571500 -- (-2206.102) [-2202.204] (-2208.585) (-2210.359) * (-2217.379) (-2206.546) [-2205.447] (-2205.171) -- 0:02:37
572000 -- (-2210.936) (-2205.606) (-2219.852) [-2208.082] * (-2210.990) (-2212.169) [-2206.405] (-2205.535) -- 0:02:37
572500 -- (-2204.144) [-2205.634] (-2207.717) (-2207.952) * (-2215.910) (-2209.310) (-2208.762) [-2206.400] -- 0:02:37
573000 -- (-2206.806) (-2209.600) (-2211.524) [-2201.088] * (-2204.576) (-2203.149) [-2210.514] (-2208.591) -- 0:02:37
573500 -- (-2209.457) (-2214.086) (-2203.943) [-2200.511] * [-2208.394] (-2202.652) (-2210.581) (-2211.139) -- 0:02:36
574000 -- [-2208.703] (-2207.156) (-2200.134) (-2202.154) * (-2216.083) (-2211.088) (-2203.956) [-2205.431] -- 0:02:36
574500 -- [-2209.151] (-2211.757) (-2211.171) (-2206.214) * (-2207.022) (-2206.430) (-2202.144) [-2209.735] -- 0:02:36
575000 -- (-2205.725) (-2212.799) (-2208.598) [-2213.123] * (-2211.889) (-2206.175) (-2216.486) [-2203.043] -- 0:02:36
Average standard deviation of split frequencies: 0.007833
575500 -- (-2203.949) [-2206.970] (-2210.685) (-2209.952) * (-2204.937) (-2210.433) [-2211.561] (-2209.442) -- 0:02:36
576000 -- (-2211.166) (-2208.217) [-2206.522] (-2211.110) * (-2208.991) (-2210.909) (-2210.276) [-2205.517] -- 0:02:36
576500 -- (-2208.916) (-2200.671) [-2205.956] (-2214.262) * [-2208.145] (-2210.572) (-2200.315) (-2206.329) -- 0:02:35
577000 -- (-2206.630) (-2209.940) (-2209.364) [-2204.717] * (-2217.917) (-2209.374) (-2208.728) [-2202.709] -- 0:02:35
577500 -- (-2207.952) (-2204.378) [-2210.897] (-2215.897) * (-2210.785) (-2211.557) (-2214.702) [-2205.928] -- 0:02:35
578000 -- (-2215.341) (-2211.944) [-2211.111] (-2208.792) * (-2220.062) (-2208.634) (-2207.222) [-2209.788] -- 0:02:35
578500 -- (-2201.971) (-2208.818) [-2210.254] (-2207.171) * (-2201.784) [-2199.667] (-2208.082) (-2206.559) -- 0:02:35
579000 -- [-2201.254] (-2203.905) (-2211.196) (-2211.454) * (-2208.381) (-2210.772) (-2212.571) [-2202.685] -- 0:02:34
579500 -- [-2206.055] (-2204.294) (-2214.063) (-2209.738) * (-2204.034) [-2201.829] (-2207.808) (-2208.105) -- 0:02:34
580000 -- (-2212.854) [-2206.724] (-2207.021) (-2203.989) * (-2211.661) (-2199.737) (-2209.730) [-2206.378] -- 0:02:34
Average standard deviation of split frequencies: 0.007770
580500 -- (-2214.407) (-2200.734) [-2211.967] (-2208.735) * (-2208.513) [-2209.055] (-2209.523) (-2206.443) -- 0:02:34
581000 -- [-2203.251] (-2207.002) (-2205.011) (-2207.661) * (-2210.733) [-2203.653] (-2219.156) (-2203.929) -- 0:02:34
581500 -- [-2207.674] (-2211.527) (-2205.411) (-2207.047) * (-2206.624) (-2206.170) (-2209.784) [-2204.886] -- 0:02:34
582000 -- [-2201.682] (-2209.223) (-2202.992) (-2202.849) * (-2218.485) (-2208.321) [-2206.744] (-2202.335) -- 0:02:33
582500 -- (-2215.146) (-2201.791) (-2203.536) [-2210.980] * (-2215.120) [-2211.776] (-2202.417) (-2206.658) -- 0:02:33
583000 -- (-2220.663) (-2205.947) [-2202.333] (-2209.401) * (-2207.885) (-2217.765) [-2203.523] (-2210.268) -- 0:02:33
583500 -- (-2211.676) [-2203.790] (-2200.488) (-2211.114) * [-2211.078] (-2204.473) (-2205.634) (-2210.796) -- 0:02:33
584000 -- (-2207.667) [-2210.563] (-2205.845) (-2212.002) * (-2210.598) (-2204.380) (-2212.568) [-2205.675] -- 0:02:33
584500 -- [-2203.719] (-2212.926) (-2203.225) (-2205.308) * (-2208.397) (-2206.224) (-2206.922) [-2204.322] -- 0:02:32
585000 -- [-2210.841] (-2207.208) (-2211.808) (-2202.343) * [-2204.455] (-2209.576) (-2203.142) (-2209.927) -- 0:02:32
Average standard deviation of split frequencies: 0.006895
585500 -- [-2211.326] (-2206.522) (-2207.179) (-2201.839) * [-2204.084] (-2205.633) (-2208.397) (-2208.726) -- 0:02:32
586000 -- (-2209.459) (-2208.346) [-2201.963] (-2203.426) * [-2204.673] (-2204.441) (-2215.489) (-2213.449) -- 0:02:32
586500 -- (-2205.596) (-2203.663) [-2199.719] (-2206.726) * (-2204.942) [-2211.062] (-2206.979) (-2212.659) -- 0:02:32
587000 -- (-2224.749) [-2206.512] (-2212.653) (-2210.742) * (-2220.902) [-2208.741] (-2206.124) (-2205.985) -- 0:02:31
587500 -- (-2220.166) [-2209.223] (-2210.250) (-2211.474) * [-2202.845] (-2208.968) (-2210.547) (-2202.952) -- 0:02:31
588000 -- (-2204.381) (-2214.984) [-2203.852] (-2221.350) * (-2208.871) (-2209.338) (-2208.078) [-2205.428] -- 0:02:31
588500 -- [-2208.525] (-2212.792) (-2205.756) (-2212.700) * [-2203.248] (-2206.513) (-2212.153) (-2206.902) -- 0:02:31
589000 -- (-2203.482) [-2202.382] (-2205.927) (-2204.395) * (-2203.025) [-2201.329] (-2211.633) (-2208.924) -- 0:02:31
589500 -- (-2205.637) (-2209.832) [-2205.092] (-2205.261) * (-2207.782) (-2202.883) (-2213.831) [-2214.467] -- 0:02:31
590000 -- [-2202.784] (-2207.996) (-2210.501) (-2204.714) * (-2208.953) (-2206.389) (-2203.201) [-2202.795] -- 0:02:30
Average standard deviation of split frequencies: 0.007183
590500 -- [-2203.843] (-2211.566) (-2208.903) (-2201.935) * (-2213.117) [-2203.761] (-2208.158) (-2208.622) -- 0:02:30
591000 -- (-2206.990) [-2210.243] (-2205.603) (-2203.413) * (-2207.643) (-2210.618) (-2202.905) [-2212.932] -- 0:02:30
591500 -- (-2209.600) (-2208.184) [-2198.818] (-2203.180) * (-2204.970) (-2208.219) (-2207.699) [-2205.910] -- 0:02:30
592000 -- (-2208.586) (-2218.296) (-2205.066) [-2214.153] * [-2213.182] (-2199.148) (-2210.914) (-2206.231) -- 0:02:30
592500 -- [-2209.858] (-2224.120) (-2206.624) (-2210.934) * (-2206.345) (-2212.671) [-2210.108] (-2205.139) -- 0:02:29
593000 -- (-2206.635) [-2207.994] (-2209.062) (-2209.367) * (-2213.217) (-2214.590) (-2208.822) [-2205.662] -- 0:02:29
593500 -- (-2204.212) [-2202.910] (-2209.962) (-2213.641) * (-2206.833) (-2209.788) [-2205.047] (-2199.804) -- 0:02:29
594000 -- (-2202.779) (-2212.622) (-2205.984) [-2200.313] * (-2214.610) [-2206.700] (-2211.635) (-2207.273) -- 0:02:29
594500 -- [-2202.948] (-2216.989) (-2211.767) (-2214.163) * (-2213.695) (-2207.296) (-2204.793) [-2201.275] -- 0:02:29
595000 -- (-2197.312) (-2217.032) (-2207.759) [-2207.585] * (-2212.548) (-2208.822) (-2206.065) [-2200.989] -- 0:02:29
Average standard deviation of split frequencies: 0.007570
595500 -- [-2201.186] (-2209.745) (-2205.174) (-2198.656) * (-2203.088) (-2208.852) (-2204.466) [-2209.069] -- 0:02:28
596000 -- (-2209.776) (-2220.646) [-2209.008] (-2212.602) * [-2202.734] (-2204.935) (-2204.505) (-2206.125) -- 0:02:28
596500 -- (-2222.139) [-2217.454] (-2208.665) (-2219.066) * (-2206.457) (-2203.707) (-2202.853) [-2203.362] -- 0:02:28
597000 -- [-2206.054] (-2218.939) (-2202.460) (-2206.617) * (-2207.238) [-2202.580] (-2206.989) (-2213.255) -- 0:02:28
597500 -- (-2203.516) [-2208.492] (-2198.248) (-2203.285) * (-2207.305) [-2208.732] (-2207.654) (-2206.146) -- 0:02:28
598000 -- (-2200.173) [-2205.448] (-2203.025) (-2205.577) * [-2208.735] (-2207.721) (-2215.700) (-2214.376) -- 0:02:27
598500 -- (-2206.476) (-2214.248) (-2206.411) [-2206.199] * (-2204.118) (-2204.266) (-2218.912) [-2205.097] -- 0:02:27
599000 -- (-2206.346) (-2203.565) [-2209.988] (-2209.805) * [-2204.660] (-2199.114) (-2217.538) (-2215.717) -- 0:02:27
599500 -- (-2207.772) (-2204.459) (-2208.052) [-2201.478] * (-2216.879) [-2201.702] (-2213.827) (-2210.566) -- 0:02:27
600000 -- (-2203.615) (-2203.971) (-2205.935) [-2200.035] * (-2202.270) (-2202.075) (-2206.632) [-2209.450] -- 0:02:27
Average standard deviation of split frequencies: 0.007287
600500 -- (-2203.599) (-2209.681) (-2199.122) [-2203.715] * (-2205.562) (-2208.756) [-2204.514] (-2205.804) -- 0:02:27
601000 -- (-2211.410) (-2206.359) [-2206.347] (-2215.855) * [-2200.189] (-2203.388) (-2218.751) (-2203.164) -- 0:02:26
601500 -- (-2202.520) (-2200.947) (-2209.952) [-2200.658] * (-2217.921) (-2205.533) (-2212.117) [-2202.574] -- 0:02:26
602000 -- (-2204.039) (-2211.501) [-2208.013] (-2204.205) * (-2212.289) (-2210.721) [-2204.065] (-2206.728) -- 0:02:26
602500 -- [-2210.137] (-2217.101) (-2211.539) (-2200.601) * (-2211.930) (-2209.249) (-2206.533) [-2205.952] -- 0:02:26
603000 -- [-2205.698] (-2206.122) (-2213.823) (-2210.790) * (-2204.814) [-2207.636] (-2207.299) (-2203.122) -- 0:02:26
603500 -- (-2204.265) [-2205.649] (-2206.602) (-2205.841) * [-2205.947] (-2208.071) (-2207.121) (-2206.387) -- 0:02:25
604000 -- [-2200.864] (-2210.814) (-2217.193) (-2202.854) * (-2206.533) [-2201.740] (-2209.283) (-2208.783) -- 0:02:25
604500 -- (-2202.077) [-2205.879] (-2203.977) (-2210.711) * [-2206.890] (-2205.060) (-2202.284) (-2200.020) -- 0:02:25
605000 -- (-2205.304) (-2206.766) [-2201.585] (-2211.144) * (-2209.445) (-2211.306) [-2211.425] (-2208.035) -- 0:02:25
Average standard deviation of split frequencies: 0.007334
605500 -- (-2206.786) [-2208.749] (-2207.546) (-2210.846) * (-2202.320) (-2204.985) [-2204.403] (-2205.883) -- 0:02:25
606000 -- (-2203.808) (-2215.791) [-2211.126] (-2204.356) * [-2206.044] (-2210.127) (-2206.188) (-2202.490) -- 0:02:24
606500 -- (-2210.586) (-2207.378) [-2205.571] (-2208.122) * (-2207.383) (-2210.607) (-2212.414) [-2206.559] -- 0:02:24
607000 -- (-2209.819) (-2210.736) (-2216.412) [-2201.310] * (-2205.028) (-2209.597) [-2214.167] (-2206.785) -- 0:02:24
607500 -- [-2209.195] (-2211.945) (-2205.354) (-2215.054) * (-2207.847) [-2207.823] (-2208.946) (-2208.554) -- 0:02:24
608000 -- [-2207.926] (-2202.666) (-2205.495) (-2208.634) * [-2211.707] (-2203.985) (-2217.670) (-2211.860) -- 0:02:24
608500 -- (-2200.615) [-2207.660] (-2202.520) (-2203.471) * (-2213.813) (-2203.896) (-2215.259) [-2207.004] -- 0:02:24
609000 -- (-2209.014) [-2208.866] (-2205.186) (-2219.452) * [-2204.876] (-2207.888) (-2201.549) (-2202.970) -- 0:02:23
609500 -- [-2204.696] (-2205.089) (-2212.300) (-2226.804) * [-2203.988] (-2206.043) (-2213.413) (-2209.629) -- 0:02:23
610000 -- [-2202.674] (-2203.689) (-2208.337) (-2213.349) * (-2210.147) (-2208.203) [-2206.288] (-2204.134) -- 0:02:23
Average standard deviation of split frequencies: 0.007830
610500 -- (-2208.037) (-2206.395) [-2208.743] (-2206.696) * (-2213.303) (-2211.739) (-2203.301) [-2205.571] -- 0:02:23
611000 -- [-2202.094] (-2209.085) (-2210.743) (-2214.283) * [-2210.385] (-2202.378) (-2208.825) (-2204.365) -- 0:02:23
611500 -- (-2207.285) (-2204.255) (-2206.445) [-2204.167] * (-2205.979) (-2213.627) (-2213.385) [-2208.522] -- 0:02:22
612000 -- (-2208.591) (-2202.316) [-2208.657] (-2201.151) * (-2202.243) [-2212.569] (-2210.092) (-2210.875) -- 0:02:22
612500 -- [-2206.698] (-2212.673) (-2204.812) (-2207.633) * [-2202.795] (-2211.350) (-2212.518) (-2209.636) -- 0:02:22
613000 -- (-2211.164) [-2206.727] (-2212.510) (-2209.805) * [-2202.494] (-2208.890) (-2203.964) (-2209.226) -- 0:02:22
613500 -- [-2208.359] (-2210.109) (-2204.120) (-2200.785) * (-2202.829) [-2206.315] (-2211.648) (-2205.029) -- 0:02:22
614000 -- (-2217.098) [-2209.834] (-2206.179) (-2209.852) * (-2204.346) (-2207.629) [-2208.390] (-2208.341) -- 0:02:22
614500 -- (-2211.919) [-2208.353] (-2208.820) (-2210.721) * (-2215.787) [-2204.861] (-2206.849) (-2207.440) -- 0:02:21
615000 -- (-2205.419) (-2209.363) (-2205.158) [-2204.476] * [-2210.324] (-2215.318) (-2208.185) (-2202.126) -- 0:02:21
Average standard deviation of split frequencies: 0.008309
615500 -- [-2204.734] (-2205.742) (-2205.226) (-2206.792) * (-2208.170) (-2210.542) (-2217.114) [-2201.802] -- 0:02:21
616000 -- (-2212.119) [-2199.292] (-2203.776) (-2208.799) * (-2209.629) (-2211.819) (-2215.063) [-2209.159] -- 0:02:21
616500 -- (-2208.572) (-2209.352) (-2211.538) [-2204.545] * (-2207.198) (-2211.252) (-2209.946) [-2200.102] -- 0:02:21
617000 -- [-2209.839] (-2208.606) (-2216.917) (-2209.089) * [-2203.312] (-2213.222) (-2220.771) (-2207.113) -- 0:02:20
617500 -- (-2208.554) [-2208.684] (-2200.059) (-2210.288) * (-2207.834) (-2219.088) (-2209.600) [-2204.508] -- 0:02:20
618000 -- [-2202.793] (-2208.549) (-2205.416) (-2218.978) * [-2201.222] (-2210.793) (-2207.152) (-2202.916) -- 0:02:20
618500 -- (-2204.138) [-2203.358] (-2229.902) (-2207.575) * (-2209.052) (-2215.225) (-2209.141) [-2205.367] -- 0:02:20
619000 -- [-2202.663] (-2210.095) (-2214.929) (-2211.820) * (-2203.849) (-2222.604) [-2202.001] (-2210.088) -- 0:02:20
619500 -- (-2215.226) (-2207.158) (-2206.148) [-2206.372] * (-2209.994) (-2208.841) [-2202.404] (-2209.671) -- 0:02:20
620000 -- (-2209.671) (-2205.347) [-2212.058] (-2200.246) * [-2207.749] (-2211.852) (-2206.592) (-2212.798) -- 0:02:19
Average standard deviation of split frequencies: 0.008138
620500 -- (-2208.494) [-2207.444] (-2213.571) (-2202.543) * (-2209.189) (-2216.023) [-2206.631] (-2207.632) -- 0:02:19
621000 -- [-2207.387] (-2213.300) (-2207.389) (-2202.261) * (-2218.714) [-2202.375] (-2209.974) (-2208.744) -- 0:02:19
621500 -- (-2206.121) (-2218.411) [-2211.727] (-2199.696) * (-2202.730) (-2211.001) [-2207.336] (-2206.501) -- 0:02:19
622000 -- (-2206.089) (-2199.979) (-2212.817) [-2209.718] * (-2206.489) (-2214.213) [-2205.301] (-2206.677) -- 0:02:19
622500 -- (-2212.661) [-2207.024] (-2206.789) (-2211.473) * (-2200.453) [-2204.470] (-2211.486) (-2206.771) -- 0:02:18
623000 -- (-2214.149) (-2214.186) [-2204.750] (-2208.171) * (-2203.787) (-2204.452) (-2212.093) [-2205.061] -- 0:02:18
623500 -- (-2212.144) (-2210.609) (-2203.740) [-2208.239] * (-2214.121) (-2203.536) (-2215.311) [-2201.575] -- 0:02:18
624000 -- (-2204.548) (-2209.289) (-2217.226) [-2201.403] * [-2209.985] (-2207.252) (-2203.843) (-2209.327) -- 0:02:18
624500 -- (-2205.941) [-2202.639] (-2205.166) (-2202.783) * (-2209.080) [-2206.559] (-2201.679) (-2204.836) -- 0:02:18
625000 -- (-2208.597) (-2203.782) (-2206.758) [-2208.252] * (-2205.226) (-2207.364) (-2215.923) [-2207.536] -- 0:02:18
Average standard deviation of split frequencies: 0.008391
625500 -- (-2209.102) (-2199.838) (-2216.721) [-2201.893] * (-2206.421) [-2205.511] (-2202.975) (-2199.645) -- 0:02:17
626000 -- (-2209.276) (-2209.079) [-2214.103] (-2204.160) * (-2209.394) [-2210.664] (-2203.747) (-2203.623) -- 0:02:17
626500 -- (-2210.498) [-2207.684] (-2218.080) (-2207.112) * (-2205.645) (-2206.734) (-2206.577) [-2201.840] -- 0:02:17
627000 -- (-2205.823) [-2209.280] (-2215.388) (-2210.879) * (-2220.272) (-2205.897) (-2207.410) [-2203.552] -- 0:02:17
627500 -- (-2210.737) [-2218.486] (-2211.160) (-2215.887) * (-2206.454) [-2205.264] (-2209.864) (-2204.300) -- 0:02:17
628000 -- [-2206.218] (-2207.382) (-2201.728) (-2207.973) * (-2212.647) (-2210.193) [-2215.965] (-2216.310) -- 0:02:16
628500 -- (-2208.724) (-2206.872) (-2203.305) [-2209.145] * (-2203.125) (-2201.349) [-2211.388] (-2208.198) -- 0:02:16
629000 -- (-2206.896) (-2203.181) [-2200.323] (-2203.195) * (-2207.068) [-2206.473] (-2209.353) (-2220.774) -- 0:02:16
629500 -- (-2208.472) (-2203.760) [-2202.586] (-2200.388) * (-2208.912) [-2200.149] (-2208.743) (-2211.510) -- 0:02:16
630000 -- (-2217.735) (-2203.912) (-2202.540) [-2209.867] * [-2201.733] (-2211.313) (-2216.236) (-2211.299) -- 0:02:16
Average standard deviation of split frequencies: 0.008222
630500 -- (-2210.688) (-2205.087) (-2202.112) [-2211.025] * (-2203.577) (-2204.562) [-2210.601] (-2208.786) -- 0:02:15
631000 -- [-2205.175] (-2205.107) (-2207.503) (-2211.076) * (-2202.274) [-2207.426] (-2210.577) (-2206.756) -- 0:02:15
631500 -- [-2211.634] (-2213.020) (-2210.631) (-2219.109) * [-2206.895] (-2203.131) (-2206.269) (-2205.780) -- 0:02:15
632000 -- (-2202.701) [-2202.243] (-2212.461) (-2211.159) * (-2203.112) [-2199.406] (-2207.678) (-2214.426) -- 0:02:15
632500 -- (-2211.699) [-2207.433] (-2206.993) (-2205.731) * (-2211.875) [-2211.108] (-2208.770) (-2211.569) -- 0:02:15
633000 -- [-2203.282] (-2203.993) (-2214.636) (-2213.391) * (-2214.255) [-2207.140] (-2201.506) (-2213.294) -- 0:02:15
633500 -- [-2202.614] (-2209.057) (-2209.000) (-2205.012) * (-2206.556) (-2208.086) [-2208.062] (-2205.111) -- 0:02:14
634000 -- (-2205.594) [-2208.390] (-2203.929) (-2207.374) * (-2207.433) (-2216.641) [-2207.673] (-2212.639) -- 0:02:14
634500 -- (-2214.968) (-2205.715) [-2207.705] (-2209.125) * [-2206.461] (-2206.199) (-2213.363) (-2206.297) -- 0:02:14
635000 -- [-2202.989] (-2215.309) (-2207.411) (-2213.544) * [-2202.399] (-2224.081) (-2210.752) (-2203.578) -- 0:02:14
Average standard deviation of split frequencies: 0.008047
635500 -- (-2208.637) (-2208.762) [-2201.406] (-2210.138) * [-2206.707] (-2218.218) (-2206.986) (-2208.348) -- 0:02:14
636000 -- [-2204.809] (-2213.812) (-2207.806) (-2208.679) * (-2205.305) [-2205.661] (-2203.768) (-2201.837) -- 0:02:13
636500 -- [-2201.350] (-2206.556) (-2211.936) (-2212.633) * (-2200.929) (-2210.169) (-2204.101) [-2212.306] -- 0:02:13
637000 -- [-2203.919] (-2199.706) (-2201.686) (-2210.535) * (-2216.789) (-2206.976) [-2207.728] (-2212.243) -- 0:02:13
637500 -- (-2202.221) [-2206.225] (-2203.964) (-2205.470) * (-2218.592) (-2215.737) [-2214.577] (-2205.364) -- 0:02:13
638000 -- (-2213.542) [-2215.003] (-2204.222) (-2219.291) * (-2222.025) (-2202.544) [-2200.758] (-2205.488) -- 0:02:13
638500 -- (-2209.182) [-2209.127] (-2205.604) (-2218.891) * (-2219.648) (-2204.227) [-2203.431] (-2204.590) -- 0:02:13
639000 -- (-2213.958) (-2205.469) [-2209.482] (-2209.125) * (-2208.947) (-2209.513) (-2214.942) [-2202.823] -- 0:02:12
639500 -- (-2198.988) [-2207.639] (-2203.227) (-2217.064) * (-2203.112) (-2206.070) [-2205.130] (-2203.347) -- 0:02:12
640000 -- (-2207.043) (-2210.333) [-2205.216] (-2215.273) * (-2217.876) [-2208.991] (-2211.289) (-2212.769) -- 0:02:12
Average standard deviation of split frequencies: 0.008409
640500 -- (-2205.083) (-2207.588) [-2200.790] (-2212.737) * (-2212.693) (-2207.680) (-2207.618) [-2203.026] -- 0:02:12
641000 -- (-2206.541) (-2200.551) (-2212.785) [-2213.955] * (-2207.163) (-2215.886) [-2207.408] (-2201.262) -- 0:02:12
641500 -- (-2205.956) (-2211.852) (-2215.959) [-2210.513] * (-2212.857) (-2209.423) [-2207.882] (-2201.646) -- 0:02:11
642000 -- (-2213.478) [-2201.723] (-2207.990) (-2201.644) * (-2201.708) [-2196.735] (-2212.396) (-2206.302) -- 0:02:11
642500 -- (-2207.331) [-2206.245] (-2213.911) (-2208.114) * (-2209.179) (-2217.560) [-2209.562] (-2215.179) -- 0:02:11
643000 -- (-2200.317) [-2208.292] (-2204.539) (-2223.904) * (-2205.363) (-2216.581) (-2215.204) [-2201.932] -- 0:02:11
643500 -- (-2212.046) [-2209.285] (-2209.447) (-2214.225) * (-2209.784) (-2210.114) (-2210.526) [-2202.206] -- 0:02:11
644000 -- (-2209.506) [-2207.168] (-2201.312) (-2201.232) * (-2209.569) (-2205.937) [-2204.114] (-2209.808) -- 0:02:11
644500 -- (-2208.069) [-2208.458] (-2205.687) (-2211.020) * (-2214.922) [-2202.831] (-2206.551) (-2212.891) -- 0:02:10
645000 -- (-2203.548) [-2201.777] (-2206.028) (-2209.809) * (-2210.353) (-2212.157) [-2211.550] (-2219.115) -- 0:02:10
Average standard deviation of split frequencies: 0.008444
645500 -- (-2215.630) (-2204.099) [-2207.424] (-2210.678) * [-2206.058] (-2199.655) (-2206.094) (-2217.832) -- 0:02:10
646000 -- (-2218.447) (-2207.097) (-2205.026) [-2219.338] * [-2213.351] (-2206.353) (-2209.103) (-2207.882) -- 0:02:10
646500 -- (-2208.396) (-2214.472) (-2209.496) [-2205.101] * (-2203.806) [-2208.637] (-2215.506) (-2210.834) -- 0:02:10
647000 -- (-2211.692) (-2204.006) [-2202.988] (-2227.876) * (-2201.079) (-2206.390) (-2201.310) [-2202.762] -- 0:02:09
647500 -- [-2206.208] (-2208.544) (-2214.822) (-2221.162) * (-2203.949) (-2209.548) (-2214.076) [-2205.005] -- 0:02:09
648000 -- (-2205.542) [-2205.564] (-2209.577) (-2214.303) * (-2205.013) (-2207.650) [-2200.461] (-2209.626) -- 0:02:09
648500 -- [-2204.887] (-2213.288) (-2213.612) (-2209.548) * [-2206.457] (-2203.815) (-2214.495) (-2209.206) -- 0:02:09
649000 -- (-2207.180) (-2211.527) (-2200.882) [-2208.461] * (-2206.398) (-2213.001) [-2209.543] (-2203.842) -- 0:02:09
649500 -- (-2206.355) [-2206.581] (-2212.369) (-2210.933) * (-2203.680) (-2203.149) (-2204.033) [-2208.741] -- 0:02:08
650000 -- [-2207.040] (-2198.856) (-2202.333) (-2216.462) * (-2203.528) (-2204.086) (-2213.531) [-2206.671] -- 0:02:09
Average standard deviation of split frequencies: 0.007866
650500 -- (-2215.214) (-2208.683) [-2208.784] (-2206.427) * (-2216.269) (-2220.572) [-2202.260] (-2217.602) -- 0:02:08
651000 -- (-2210.015) [-2206.454] (-2202.470) (-2212.347) * [-2203.833] (-2202.704) (-2205.375) (-2212.459) -- 0:02:08
651500 -- (-2204.861) (-2203.975) [-2209.517] (-2206.097) * (-2209.107) (-2204.900) [-2206.816] (-2205.044) -- 0:02:08
652000 -- (-2213.572) [-2212.190] (-2210.729) (-2207.371) * (-2202.902) (-2210.144) (-2199.658) [-2206.464] -- 0:02:08
652500 -- (-2203.659) [-2213.716] (-2209.929) (-2209.913) * (-2203.522) (-2208.649) (-2202.552) [-2205.089] -- 0:02:08
653000 -- (-2204.867) (-2204.981) (-2219.898) [-2205.209] * (-2211.225) (-2203.596) [-2206.851] (-2207.388) -- 0:02:08
653500 -- (-2198.056) (-2210.644) (-2219.514) [-2203.986] * (-2202.436) (-2203.767) (-2203.089) [-2211.332] -- 0:02:07
654000 -- (-2206.099) (-2209.278) [-2201.813] (-2201.960) * (-2202.293) (-2214.095) (-2207.050) [-2204.753] -- 0:02:07
654500 -- (-2200.566) (-2210.374) (-2206.624) [-2202.052] * (-2204.282) (-2204.505) (-2207.217) [-2201.158] -- 0:02:07
655000 -- (-2207.618) (-2209.220) (-2208.818) [-2202.113] * [-2207.387] (-2209.700) (-2211.204) (-2210.889) -- 0:02:07
Average standard deviation of split frequencies: 0.007905
655500 -- [-2202.159] (-2211.425) (-2210.188) (-2206.689) * (-2211.423) (-2209.815) [-2206.639] (-2212.515) -- 0:02:07
656000 -- (-2200.614) [-2204.815] (-2200.632) (-2206.034) * [-2205.486] (-2211.274) (-2210.981) (-2211.251) -- 0:02:06
656500 -- (-2210.123) [-2202.173] (-2206.464) (-2207.173) * [-2205.486] (-2216.456) (-2213.990) (-2209.270) -- 0:02:06
657000 -- [-2206.994] (-2210.889) (-2207.943) (-2220.949) * (-2211.643) (-2216.029) [-2204.383] (-2201.024) -- 0:02:06
657500 -- [-2203.358] (-2207.196) (-2209.781) (-2214.107) * [-2209.870] (-2209.804) (-2205.735) (-2206.956) -- 0:02:06
658000 -- [-2200.875] (-2211.588) (-2209.524) (-2212.064) * [-2210.306] (-2206.705) (-2209.239) (-2214.113) -- 0:02:06
658500 -- [-2204.450] (-2210.403) (-2207.128) (-2205.061) * [-2203.365] (-2210.979) (-2212.620) (-2217.337) -- 0:02:06
659000 -- (-2210.474) [-2205.463] (-2208.168) (-2205.351) * (-2206.132) [-2208.901] (-2206.206) (-2210.570) -- 0:02:05
659500 -- (-2209.228) (-2205.334) (-2208.868) [-2203.787] * (-2203.167) (-2212.096) [-2204.116] (-2205.893) -- 0:02:05
660000 -- [-2207.155] (-2212.548) (-2213.599) (-2225.950) * [-2204.228] (-2213.061) (-2218.174) (-2210.952) -- 0:02:05
Average standard deviation of split frequencies: 0.007849
660500 -- [-2202.617] (-2208.631) (-2213.070) (-2204.463) * [-2203.288] (-2219.981) (-2211.446) (-2211.372) -- 0:02:05
661000 -- [-2204.689] (-2212.382) (-2213.016) (-2216.790) * (-2206.410) (-2213.184) (-2203.965) [-2202.578] -- 0:02:05
661500 -- (-2200.019) (-2202.398) (-2210.941) [-2212.299] * [-2204.047] (-2204.796) (-2210.070) (-2206.554) -- 0:02:04
662000 -- (-2206.488) [-2205.918] (-2207.692) (-2213.817) * [-2200.822] (-2202.399) (-2214.276) (-2212.890) -- 0:02:04
662500 -- (-2199.206) (-2211.595) (-2205.145) [-2199.743] * (-2208.827) (-2200.707) (-2201.375) [-2206.788] -- 0:02:04
663000 -- (-2212.377) [-2209.750] (-2206.608) (-2211.497) * [-2203.864] (-2209.521) (-2204.971) (-2207.385) -- 0:02:04
663500 -- (-2206.272) (-2210.712) (-2209.628) [-2203.657] * (-2203.252) (-2207.310) (-2202.921) [-2202.045] -- 0:02:04
664000 -- (-2214.146) [-2208.793] (-2208.223) (-2210.720) * (-2200.811) (-2206.912) (-2198.408) [-2208.037] -- 0:02:03
664500 -- (-2212.564) (-2209.074) (-2203.122) [-2210.172] * (-2206.549) (-2202.105) (-2209.897) [-2207.739] -- 0:02:03
665000 -- (-2212.239) [-2204.339] (-2203.673) (-2206.295) * (-2207.976) (-2205.979) (-2206.899) [-2205.636] -- 0:02:03
Average standard deviation of split frequencies: 0.007483
665500 -- (-2213.414) (-2208.172) (-2207.873) [-2206.288] * (-2204.936) [-2203.723] (-2209.703) (-2211.607) -- 0:02:03
666000 -- (-2208.950) (-2215.244) [-2203.426] (-2206.599) * (-2208.865) (-2206.254) [-2212.164] (-2212.387) -- 0:02:03
666500 -- (-2209.169) [-2208.016] (-2217.819) (-2201.263) * (-2211.417) (-2209.552) [-2203.324] (-2203.519) -- 0:02:03
667000 -- (-2207.978) [-2206.464] (-2204.554) (-2205.725) * (-2209.724) (-2212.070) [-2197.376] (-2204.913) -- 0:02:02
667500 -- (-2208.333) (-2204.134) (-2212.816) [-2207.098] * (-2205.311) (-2208.781) (-2203.523) [-2201.377] -- 0:02:03
668000 -- [-2200.077] (-2207.598) (-2203.261) (-2210.807) * (-2207.999) (-2207.326) (-2208.061) [-2203.056] -- 0:02:02
668500 -- (-2210.876) (-2209.403) (-2204.374) [-2206.440] * (-2210.005) (-2207.311) [-2210.670] (-2209.451) -- 0:02:02
669000 -- (-2208.002) [-2205.112] (-2201.982) (-2206.448) * (-2215.982) (-2207.197) (-2208.740) [-2200.972] -- 0:02:02
669500 -- (-2202.489) [-2202.148] (-2203.840) (-2208.906) * (-2209.151) [-2206.585] (-2204.084) (-2210.124) -- 0:02:01
670000 -- (-2219.543) (-2221.600) [-2201.379] (-2209.308) * (-2216.728) (-2210.160) (-2210.519) [-2204.633] -- 0:02:02
Average standard deviation of split frequencies: 0.007933
670500 -- [-2200.405] (-2211.168) (-2204.354) (-2205.271) * (-2201.299) [-2203.854] (-2210.603) (-2211.034) -- 0:02:01
671000 -- (-2203.426) [-2207.376] (-2211.425) (-2204.920) * (-2213.507) [-2210.676] (-2205.466) (-2211.577) -- 0:02:01
671500 -- [-2204.814] (-2215.203) (-2214.609) (-2204.284) * (-2209.179) (-2204.291) (-2207.658) [-2203.242] -- 0:02:01
672000 -- (-2209.640) (-2203.224) (-2211.176) [-2206.380] * (-2205.048) (-2217.464) (-2210.256) [-2202.064] -- 0:02:01
672500 -- [-2212.037] (-2204.368) (-2208.797) (-2205.313) * (-2211.208) (-2211.155) [-2206.563] (-2205.935) -- 0:02:01
673000 -- (-2213.163) [-2210.761] (-2206.396) (-2211.637) * (-2208.966) [-2204.245] (-2207.314) (-2201.348) -- 0:02:00
673500 -- (-2209.270) [-2215.881] (-2208.729) (-2200.140) * (-2211.338) [-2204.100] (-2216.396) (-2207.126) -- 0:02:00
674000 -- (-2203.723) [-2206.081] (-2203.787) (-2208.482) * (-2210.496) [-2211.155] (-2212.244) (-2211.134) -- 0:02:00
674500 -- (-2203.639) (-2214.276) (-2217.008) [-2202.589] * [-2210.606] (-2210.509) (-2215.412) (-2211.566) -- 0:02:00
675000 -- (-2209.204) (-2216.737) [-2207.522] (-2203.496) * (-2201.106) (-2213.103) (-2206.354) [-2208.289] -- 0:02:00
Average standard deviation of split frequencies: 0.007970
675500 -- (-2207.406) (-2202.879) [-2206.207] (-2207.333) * (-2200.373) (-2207.282) [-2205.230] (-2219.184) -- 0:02:00
676000 -- (-2208.984) [-2208.197] (-2203.695) (-2205.043) * (-2210.193) [-2205.207] (-2209.252) (-2210.647) -- 0:02:00
676500 -- (-2208.692) [-2208.632] (-2201.511) (-2211.824) * (-2216.305) (-2211.689) (-2207.264) [-2201.617] -- 0:02:00
677000 -- (-2204.569) (-2211.000) [-2204.982] (-2209.078) * (-2209.647) [-2200.411] (-2208.184) (-2205.972) -- 0:01:59
677500 -- (-2213.003) (-2210.591) [-2205.143] (-2212.062) * [-2202.472] (-2213.500) (-2202.636) (-2209.225) -- 0:01:59
678000 -- (-2205.939) (-2208.766) (-2206.588) [-2208.450] * [-2202.074] (-2210.444) (-2204.504) (-2206.601) -- 0:01:59
678500 -- (-2207.692) (-2210.046) [-2202.259] (-2213.358) * (-2210.256) (-2206.476) (-2208.712) [-2204.021] -- 0:01:59
679000 -- (-2203.670) [-2202.433] (-2202.723) (-2210.482) * (-2212.346) (-2214.675) (-2216.544) [-2212.175] -- 0:01:59
679500 -- (-2209.724) (-2205.328) [-2210.554] (-2202.785) * (-2210.772) [-2214.948] (-2202.784) (-2210.351) -- 0:01:58
680000 -- (-2209.678) [-2204.623] (-2209.599) (-2211.406) * (-2203.245) (-2214.029) [-2205.833] (-2201.149) -- 0:01:58
Average standard deviation of split frequencies: 0.007717
680500 -- (-2206.815) [-2203.477] (-2203.642) (-2208.729) * (-2204.192) [-2201.998] (-2213.268) (-2202.202) -- 0:01:58
681000 -- (-2200.808) (-2205.287) [-2199.500] (-2207.622) * (-2201.832) (-2208.412) (-2206.342) [-2205.931] -- 0:01:58
681500 -- (-2212.802) (-2205.183) [-2203.953] (-2213.249) * (-2210.506) (-2219.971) (-2209.226) [-2205.327] -- 0:01:58
682000 -- [-2202.306] (-2213.095) (-2206.252) (-2209.343) * (-2211.130) (-2205.570) [-2204.182] (-2206.218) -- 0:01:57
682500 -- [-2210.206] (-2211.543) (-2216.456) (-2203.729) * [-2208.302] (-2205.453) (-2203.451) (-2208.971) -- 0:01:57
683000 -- (-2201.770) (-2203.528) (-2207.408) [-2200.912] * (-2206.982) [-2202.900] (-2204.113) (-2213.853) -- 0:01:57
683500 -- (-2205.156) [-2205.357] (-2203.370) (-2204.081) * [-2204.653] (-2208.597) (-2207.688) (-2207.976) -- 0:01:57
684000 -- (-2213.218) (-2205.504) (-2204.604) [-2209.877] * (-2213.701) [-2207.868] (-2213.736) (-2202.913) -- 0:01:57
684500 -- (-2208.031) (-2206.580) [-2203.103] (-2217.803) * (-2211.009) (-2205.794) (-2213.846) [-2203.229] -- 0:01:57
685000 -- (-2205.067) [-2202.349] (-2208.664) (-2214.186) * (-2212.703) (-2203.772) (-2205.643) [-2209.454] -- 0:01:57
Average standard deviation of split frequencies: 0.007559
685500 -- (-2206.189) [-2212.526] (-2215.192) (-2208.376) * (-2207.343) [-2206.236] (-2204.462) (-2209.965) -- 0:01:56
686000 -- (-2205.432) (-2209.390) [-2203.748] (-2208.813) * (-2204.432) (-2216.894) [-2200.580] (-2201.770) -- 0:01:56
686500 -- (-2207.583) (-2207.458) [-2206.628] (-2205.073) * (-2216.418) (-2199.559) [-2198.732] (-2211.278) -- 0:01:56
687000 -- (-2212.530) [-2206.380] (-2208.382) (-2217.909) * (-2212.463) (-2203.464) (-2207.751) [-2200.282] -- 0:01:56
687500 -- (-2212.275) [-2204.143] (-2203.226) (-2210.558) * (-2204.601) (-2208.635) (-2208.518) [-2206.866] -- 0:01:56
688000 -- (-2207.672) (-2209.503) (-2203.217) [-2208.452] * (-2205.389) [-2208.344] (-2204.846) (-2214.495) -- 0:01:56
688500 -- [-2199.255] (-2217.502) (-2204.489) (-2204.720) * [-2210.886] (-2212.047) (-2212.494) (-2198.499) -- 0:01:55
689000 -- (-2219.619) (-2208.989) [-2206.747] (-2206.413) * (-2206.344) (-2209.772) (-2206.950) [-2207.174] -- 0:01:56
689500 -- (-2214.138) (-2210.587) [-2205.314] (-2209.033) * (-2207.167) [-2206.441] (-2209.434) (-2205.416) -- 0:01:55
690000 -- (-2206.660) (-2207.316) [-2205.766] (-2207.171) * (-2212.287) [-2204.902] (-2207.299) (-2209.931) -- 0:01:55
Average standard deviation of split frequencies: 0.007800
690500 -- (-2203.369) (-2200.397) [-2206.389] (-2198.582) * (-2204.638) (-2207.555) (-2208.851) [-2210.042] -- 0:01:55
691000 -- (-2205.833) (-2209.182) (-2205.534) [-2213.166] * (-2206.271) (-2209.221) (-2204.915) [-2196.847] -- 0:01:54
691500 -- [-2211.662] (-2202.083) (-2217.731) (-2205.031) * (-2203.417) [-2209.212] (-2208.646) (-2204.421) -- 0:01:55
692000 -- (-2205.215) (-2211.828) (-2209.229) [-2204.117] * [-2208.829] (-2204.437) (-2210.300) (-2202.942) -- 0:01:54
692500 -- (-2205.755) [-2203.290] (-2205.999) (-2209.931) * (-2217.709) [-2215.320] (-2210.629) (-2212.827) -- 0:01:54
693000 -- (-2207.043) [-2213.009] (-2205.547) (-2209.980) * (-2206.388) (-2206.779) [-2202.641] (-2207.183) -- 0:01:54
693500 -- (-2214.644) (-2215.149) (-2208.325) [-2210.726] * (-2207.074) (-2215.701) (-2204.200) [-2204.531] -- 0:01:54
694000 -- (-2212.918) (-2210.280) (-2210.799) [-2210.940] * [-2203.290] (-2209.923) (-2213.513) (-2205.600) -- 0:01:54
694500 -- (-2205.398) (-2223.450) [-2209.893] (-2208.160) * (-2208.819) (-2199.061) [-2205.742] (-2205.017) -- 0:01:53
695000 -- (-2211.860) (-2209.522) (-2213.936) [-2207.491] * (-2203.626) (-2206.579) [-2205.521] (-2208.229) -- 0:01:53
Average standard deviation of split frequencies: 0.007934
695500 -- [-2210.726] (-2210.491) (-2213.041) (-2207.021) * (-2206.070) (-2206.076) (-2203.266) [-2201.629] -- 0:01:53
696000 -- (-2210.723) [-2206.969] (-2205.982) (-2215.732) * (-2211.292) [-2203.468] (-2202.688) (-2200.527) -- 0:01:53
696500 -- (-2209.478) [-2203.234] (-2207.594) (-2211.961) * (-2218.374) (-2205.238) (-2207.169) [-2205.482] -- 0:01:53
697000 -- [-2204.713] (-2202.825) (-2204.206) (-2210.281) * (-2203.683) [-2205.749] (-2209.251) (-2210.083) -- 0:01:53
697500 -- (-2201.306) [-2206.189] (-2210.057) (-2217.312) * (-2216.559) (-2209.571) (-2204.131) [-2204.797] -- 0:01:52
698000 -- [-2205.235] (-2207.615) (-2203.336) (-2205.106) * (-2214.034) (-2200.701) (-2206.340) [-2208.425] -- 0:01:52
698500 -- (-2209.019) [-2204.678] (-2210.781) (-2216.860) * (-2207.088) [-2205.832] (-2217.199) (-2209.075) -- 0:01:52
699000 -- (-2208.515) (-2200.040) [-2211.346] (-2203.089) * [-2203.872] (-2203.801) (-2207.650) (-2210.630) -- 0:01:52
699500 -- (-2210.481) (-2202.628) (-2207.530) [-2202.831] * (-2214.260) (-2199.455) [-2204.792] (-2199.471) -- 0:01:52
700000 -- (-2218.009) [-2204.655] (-2206.519) (-2203.313) * (-2207.649) (-2206.937) [-2201.860] (-2207.795) -- 0:01:51
Average standard deviation of split frequencies: 0.007497
700500 -- (-2209.964) (-2211.246) (-2208.314) [-2212.964] * (-2207.707) (-2220.274) [-2204.876] (-2208.905) -- 0:01:51
701000 -- [-2204.336] (-2212.797) (-2210.975) (-2219.796) * (-2214.685) (-2219.327) [-2205.983] (-2208.253) -- 0:01:51
701500 -- (-2203.529) [-2213.902] (-2210.842) (-2207.305) * (-2208.272) [-2212.504] (-2210.744) (-2209.532) -- 0:01:51
702000 -- (-2207.700) (-2204.355) (-2209.900) [-2205.394] * (-2209.711) (-2205.309) (-2209.162) [-2199.037] -- 0:01:51
702500 -- (-2216.384) (-2202.985) [-2206.739] (-2206.760) * (-2199.923) (-2201.657) (-2208.914) [-2204.460] -- 0:01:50
703000 -- (-2204.876) (-2206.277) (-2208.820) [-2204.425] * (-2202.892) (-2206.795) [-2211.593] (-2212.572) -- 0:01:50
703500 -- (-2206.017) [-2208.831] (-2216.684) (-2208.567) * (-2204.249) [-2209.912] (-2207.258) (-2213.030) -- 0:01:50
704000 -- (-2210.460) (-2219.729) (-2210.679) [-2215.022] * (-2203.145) (-2220.283) (-2209.336) [-2203.703] -- 0:01:50
704500 -- (-2210.233) [-2203.667] (-2214.612) (-2218.244) * [-2217.631] (-2215.776) (-2208.545) (-2209.197) -- 0:01:50
705000 -- (-2216.607) [-2203.420] (-2206.443) (-2205.632) * (-2210.238) [-2207.600] (-2210.169) (-2201.379) -- 0:01:50
Average standard deviation of split frequencies: 0.007631
705500 -- (-2216.929) (-2211.226) (-2215.115) [-2203.176] * (-2205.149) [-2207.592] (-2206.141) (-2201.160) -- 0:01:49
706000 -- (-2215.703) (-2205.021) [-2209.179] (-2202.519) * [-2203.944] (-2205.983) (-2208.634) (-2206.674) -- 0:01:49
706500 -- (-2206.950) (-2211.282) (-2206.750) [-2203.313] * (-2219.442) (-2206.438) (-2210.127) [-2202.699] -- 0:01:49
707000 -- (-2211.246) (-2206.259) (-2208.181) [-2205.687] * (-2207.173) [-2200.021] (-2208.178) (-2204.534) -- 0:01:49
707500 -- (-2201.678) [-2204.033] (-2213.192) (-2208.344) * (-2206.754) [-2207.585] (-2201.874) (-2210.001) -- 0:01:49
708000 -- (-2202.944) (-2201.651) [-2205.161] (-2205.240) * (-2205.922) [-2210.269] (-2216.710) (-2204.562) -- 0:01:48
708500 -- (-2205.356) [-2203.518] (-2211.145) (-2204.579) * (-2205.200) [-2204.670] (-2209.258) (-2211.445) -- 0:01:48
709000 -- (-2208.216) [-2202.310] (-2205.379) (-2204.815) * (-2204.803) [-2202.486] (-2205.146) (-2206.123) -- 0:01:48
709500 -- (-2204.253) [-2200.728] (-2207.305) (-2210.845) * [-2199.789] (-2206.230) (-2208.913) (-2202.455) -- 0:01:48
710000 -- (-2206.933) (-2203.776) (-2213.774) [-2210.443] * (-2199.025) (-2208.052) [-2209.269] (-2209.215) -- 0:01:48
Average standard deviation of split frequencies: 0.007581
710500 -- (-2204.817) [-2204.672] (-2208.787) (-2204.402) * (-2204.953) (-2206.003) (-2211.630) [-2202.362] -- 0:01:47
711000 -- [-2206.420] (-2221.093) (-2206.639) (-2209.209) * (-2215.439) (-2200.519) (-2205.174) [-2199.789] -- 0:01:47
711500 -- [-2198.794] (-2206.817) (-2203.130) (-2203.126) * (-2213.402) (-2216.096) (-2211.972) [-2205.173] -- 0:01:47
712000 -- (-2208.258) (-2203.789) [-2205.912] (-2213.340) * (-2212.570) (-2205.447) [-2207.046] (-2203.048) -- 0:01:47
712500 -- (-2208.580) (-2212.674) [-2205.744] (-2201.616) * [-2205.073] (-2209.985) (-2208.510) (-2208.203) -- 0:01:47
713000 -- (-2208.387) [-2201.610] (-2204.734) (-2206.623) * (-2205.525) [-2203.964] (-2209.831) (-2214.117) -- 0:01:47
713500 -- (-2203.919) (-2210.907) (-2203.158) [-2200.605] * [-2202.357] (-2207.136) (-2208.898) (-2204.163) -- 0:01:46
714000 -- [-2208.190] (-2209.712) (-2204.171) (-2202.820) * (-2205.438) (-2219.437) [-2207.736] (-2202.397) -- 0:01:46
714500 -- (-2216.921) (-2203.470) (-2206.023) [-2200.027] * (-2216.997) [-2205.453] (-2209.860) (-2210.113) -- 0:01:46
715000 -- (-2208.886) [-2211.331] (-2207.691) (-2200.358) * (-2207.077) [-2202.507] (-2204.690) (-2204.488) -- 0:01:46
Average standard deviation of split frequencies: 0.006960
715500 -- (-2211.184) [-2205.158] (-2210.309) (-2209.515) * [-2204.041] (-2208.785) (-2207.881) (-2210.981) -- 0:01:46
716000 -- [-2202.662] (-2206.419) (-2213.964) (-2206.220) * [-2210.318] (-2206.438) (-2207.785) (-2206.157) -- 0:01:45
716500 -- (-2204.618) [-2208.662] (-2208.389) (-2201.810) * (-2211.541) (-2207.573) [-2209.097] (-2212.290) -- 0:01:45
717000 -- (-2206.045) [-2208.232] (-2207.964) (-2209.617) * (-2212.972) (-2204.199) [-2206.501] (-2213.392) -- 0:01:45
717500 -- (-2205.640) (-2215.856) (-2213.316) [-2213.270] * (-2207.583) (-2204.466) (-2202.654) [-2205.224] -- 0:01:45
718000 -- [-2204.022] (-2211.324) (-2205.745) (-2205.153) * (-2205.326) (-2213.277) [-2206.892] (-2209.952) -- 0:01:45
718500 -- (-2214.755) (-2206.168) (-2205.745) [-2207.457] * [-2201.036] (-2209.169) (-2204.611) (-2207.630) -- 0:01:44
719000 -- [-2202.749] (-2210.860) (-2206.017) (-2205.693) * (-2206.745) (-2207.444) [-2200.451] (-2214.385) -- 0:01:44
719500 -- [-2209.383] (-2203.356) (-2209.139) (-2214.312) * [-2203.293] (-2211.691) (-2200.320) (-2208.980) -- 0:01:44
720000 -- [-2202.887] (-2207.102) (-2206.777) (-2206.009) * (-2207.670) (-2204.193) (-2204.098) [-2203.245] -- 0:01:44
Average standard deviation of split frequencies: 0.006354
720500 -- (-2202.646) [-2208.723] (-2209.139) (-2202.386) * (-2202.413) [-2205.321] (-2202.388) (-2203.357) -- 0:01:44
721000 -- (-2202.872) (-2204.978) [-2202.072] (-2205.352) * (-2204.336) (-2202.735) (-2212.230) [-2206.898] -- 0:01:44
721500 -- (-2205.262) [-2202.304] (-2205.887) (-2204.395) * (-2201.368) (-2214.887) [-2201.565] (-2203.759) -- 0:01:43
722000 -- [-2200.452] (-2207.939) (-2210.639) (-2204.952) * [-2211.311] (-2205.937) (-2209.110) (-2205.057) -- 0:01:43
722500 -- (-2213.222) [-2203.233] (-2209.075) (-2211.564) * (-2209.689) [-2215.820] (-2212.630) (-2217.310) -- 0:01:43
723000 -- [-2203.377] (-2212.971) (-2205.068) (-2208.174) * (-2219.832) (-2208.055) [-2209.671] (-2218.426) -- 0:01:43
723500 -- [-2211.281] (-2213.635) (-2210.871) (-2212.638) * (-2217.383) [-2203.983] (-2204.956) (-2206.647) -- 0:01:43
724000 -- (-2212.457) (-2207.485) [-2204.882] (-2206.742) * [-2206.363] (-2205.123) (-2211.402) (-2205.140) -- 0:01:42
724500 -- [-2207.849] (-2205.405) (-2208.422) (-2213.804) * (-2211.242) (-2213.933) (-2207.465) [-2201.336] -- 0:01:43
725000 -- (-2204.993) (-2211.308) [-2206.085] (-2207.460) * [-2203.510] (-2203.338) (-2205.000) (-2206.191) -- 0:01:42
Average standard deviation of split frequencies: 0.006493
725500 -- [-2207.456] (-2208.237) (-2207.179) (-2201.194) * (-2212.779) [-2207.981] (-2208.299) (-2215.734) -- 0:01:42
726000 -- (-2210.269) (-2206.631) [-2202.131] (-2204.236) * (-2207.494) (-2207.812) [-2200.670] (-2217.787) -- 0:01:42
726500 -- (-2215.836) (-2212.518) (-2207.444) [-2205.769] * [-2204.300] (-2211.213) (-2209.634) (-2204.003) -- 0:01:42
727000 -- (-2212.172) [-2209.756] (-2218.338) (-2205.653) * (-2205.500) (-2220.639) [-2211.691] (-2209.099) -- 0:01:42
727500 -- (-2214.331) (-2209.530) (-2210.188) [-2201.725] * (-2209.093) (-2220.555) (-2213.983) [-2206.170] -- 0:01:41
728000 -- (-2210.204) (-2214.572) [-2206.418] (-2203.715) * (-2210.516) (-2212.637) (-2200.111) [-2210.270] -- 0:01:41
728500 -- [-2205.609] (-2203.416) (-2200.061) (-2211.744) * (-2212.373) (-2204.958) [-2202.934] (-2208.456) -- 0:01:41
729000 -- [-2210.208] (-2206.006) (-2207.131) (-2204.062) * (-2205.796) (-2204.824) (-2210.763) [-2205.560] -- 0:01:41
729500 -- (-2205.893) (-2214.080) [-2202.021] (-2211.584) * (-2205.286) (-2213.032) [-2206.461] (-2209.163) -- 0:01:41
730000 -- (-2208.032) (-2218.383) (-2208.270) [-2212.207] * (-2201.068) [-2204.387] (-2211.340) (-2210.780) -- 0:01:40
Average standard deviation of split frequencies: 0.006820
730500 -- (-2205.011) (-2210.124) (-2208.766) [-2202.406] * (-2210.501) (-2206.504) [-2209.057] (-2214.234) -- 0:01:40
731000 -- (-2203.743) (-2204.228) (-2207.073) [-2212.124] * (-2203.923) (-2204.074) (-2198.698) [-2204.749] -- 0:01:40
731500 -- (-2208.802) (-2213.131) (-2214.267) [-2202.869] * [-2211.827] (-2200.616) (-2207.014) (-2215.334) -- 0:01:40
732000 -- (-2213.805) [-2209.048] (-2210.836) (-2209.257) * [-2203.089] (-2201.625) (-2200.240) (-2210.161) -- 0:01:39
732500 -- [-2204.270] (-2212.613) (-2212.983) (-2209.555) * (-2207.864) (-2205.780) [-2208.041] (-2202.085) -- 0:01:40
733000 -- [-2213.139] (-2203.940) (-2212.331) (-2211.718) * [-2209.232] (-2218.081) (-2208.058) (-2207.294) -- 0:01:39
733500 -- (-2214.505) (-2208.224) (-2210.290) [-2207.492] * [-2205.668] (-2211.819) (-2217.575) (-2204.468) -- 0:01:39
734000 -- (-2206.504) [-2208.560] (-2208.947) (-2218.137) * (-2210.500) (-2213.992) (-2210.311) [-2208.815] -- 0:01:39
734500 -- (-2201.873) (-2204.727) [-2209.432] (-2212.560) * (-2204.294) (-2206.574) [-2210.682] (-2210.959) -- 0:01:39
735000 -- (-2207.967) [-2206.113] (-2208.325) (-2212.889) * (-2208.025) (-2206.450) [-2209.495] (-2211.199) -- 0:01:39
Average standard deviation of split frequencies: 0.006862
735500 -- (-2207.302) [-2208.620] (-2203.797) (-2204.518) * (-2209.082) (-2207.594) (-2206.238) [-2213.619] -- 0:01:38
736000 -- (-2205.676) (-2217.190) (-2213.973) [-2210.603] * [-2208.150] (-2211.783) (-2205.841) (-2214.698) -- 0:01:38
736500 -- [-2207.273] (-2205.248) (-2205.241) (-2210.244) * (-2204.367) (-2205.426) (-2203.010) [-2206.630] -- 0:01:38
737000 -- [-2208.559] (-2210.980) (-2213.852) (-2206.629) * (-2203.633) [-2207.823] (-2206.183) (-2207.187) -- 0:01:38
737500 -- (-2208.370) (-2215.400) (-2205.212) [-2211.394] * (-2210.271) [-2204.205] (-2210.402) (-2208.576) -- 0:01:37
738000 -- [-2203.682] (-2203.222) (-2209.880) (-2219.706) * [-2202.992] (-2206.747) (-2207.273) (-2212.604) -- 0:01:37
738500 -- (-2203.341) (-2210.489) (-2210.568) [-2211.826] * (-2205.920) (-2204.216) (-2215.914) [-2210.034] -- 0:01:37
739000 -- (-2203.686) (-2201.926) [-2211.580] (-2206.882) * (-2207.578) [-2198.075] (-2214.122) (-2210.727) -- 0:01:37
739500 -- (-2216.235) (-2203.303) [-2207.186] (-2199.740) * [-2208.242] (-2208.366) (-2208.842) (-2210.109) -- 0:01:37
740000 -- (-2208.241) (-2204.728) [-2211.870] (-2202.630) * (-2211.587) [-2203.443] (-2201.636) (-2204.971) -- 0:01:36
Average standard deviation of split frequencies: 0.006546
740500 -- (-2210.140) [-2201.978] (-2206.248) (-2204.777) * (-2204.472) (-2204.557) [-2203.443] (-2205.472) -- 0:01:37
741000 -- (-2214.527) (-2205.870) (-2205.306) [-2201.773] * (-2205.066) [-2205.911] (-2200.630) (-2208.470) -- 0:01:36
741500 -- (-2213.379) [-2205.999] (-2213.162) (-2216.262) * (-2211.940) (-2212.212) [-2206.843] (-2207.551) -- 0:01:36
742000 -- [-2204.107] (-2207.699) (-2204.870) (-2209.479) * (-2210.361) [-2204.102] (-2210.855) (-2205.435) -- 0:01:36
742500 -- (-2218.483) (-2213.311) [-2208.819] (-2212.780) * (-2204.545) (-2202.820) (-2210.826) [-2199.654] -- 0:01:36
743000 -- (-2211.442) (-2210.353) [-2213.096] (-2207.544) * (-2210.008) (-2210.110) (-2202.770) [-2206.194] -- 0:01:36
743500 -- [-2208.625] (-2209.998) (-2210.594) (-2205.455) * [-2208.659] (-2216.650) (-2206.109) (-2207.281) -- 0:01:35
744000 -- (-2211.182) (-2213.349) (-2209.682) [-2207.925] * (-2209.044) [-2207.828] (-2200.795) (-2210.414) -- 0:01:35
744500 -- (-2206.822) (-2205.332) (-2214.799) [-2204.703] * [-2211.717] (-2207.381) (-2205.192) (-2214.213) -- 0:01:35
745000 -- (-2210.269) [-2206.003] (-2203.285) (-2207.321) * (-2215.317) [-2202.274] (-2203.828) (-2209.229) -- 0:01:35
Average standard deviation of split frequencies: 0.007132
745500 -- [-2206.786] (-2214.060) (-2210.147) (-2215.992) * (-2200.702) (-2204.437) [-2206.248] (-2213.473) -- 0:01:34
746000 -- (-2203.578) (-2213.784) (-2209.719) [-2206.549] * (-2211.538) [-2205.692] (-2217.144) (-2212.323) -- 0:01:34
746500 -- (-2203.080) (-2208.990) (-2202.458) [-2210.778] * [-2201.200] (-2209.194) (-2205.566) (-2207.283) -- 0:01:34
747000 -- [-2210.279] (-2207.060) (-2213.796) (-2206.961) * (-2203.569) (-2207.758) [-2205.816] (-2207.753) -- 0:01:34
747500 -- (-2200.943) (-2208.609) [-2207.014] (-2205.955) * [-2204.664] (-2204.440) (-2204.827) (-2204.095) -- 0:01:34
748000 -- [-2204.504] (-2206.802) (-2212.206) (-2207.986) * (-2203.767) (-2218.434) [-2205.472] (-2207.008) -- 0:01:33
748500 -- (-2208.917) (-2214.007) [-2210.110] (-2203.422) * (-2206.392) (-2215.646) [-2206.026] (-2206.010) -- 0:01:34
749000 -- (-2207.481) [-2202.843] (-2211.831) (-2202.835) * [-2204.242] (-2204.212) (-2211.296) (-2225.855) -- 0:01:33
749500 -- [-2204.055] (-2210.871) (-2211.012) (-2211.269) * (-2202.556) [-2215.215] (-2202.338) (-2207.189) -- 0:01:33
750000 -- (-2213.779) (-2223.426) [-2206.411] (-2202.953) * [-2206.020] (-2202.476) (-2214.006) (-2207.183) -- 0:01:33
Average standard deviation of split frequencies: 0.006998
750500 -- [-2213.963] (-2205.261) (-2203.993) (-2207.354) * [-2202.133] (-2209.649) (-2216.645) (-2208.096) -- 0:01:33
751000 -- (-2208.165) [-2204.129] (-2212.920) (-2203.562) * [-2209.141] (-2209.569) (-2212.558) (-2201.917) -- 0:01:33
751500 -- [-2206.880] (-2206.090) (-2208.952) (-2207.210) * (-2209.800) [-2205.246] (-2209.255) (-2204.770) -- 0:01:32
752000 -- [-2208.112] (-2204.097) (-2211.197) (-2210.569) * (-2205.430) (-2209.352) (-2207.182) [-2200.515] -- 0:01:32
752500 -- (-2203.386) [-2206.277] (-2207.158) (-2203.600) * [-2208.222] (-2208.752) (-2207.248) (-2215.253) -- 0:01:32
753000 -- (-2218.066) [-2201.715] (-2209.686) (-2204.291) * (-2205.120) (-2206.537) (-2210.642) [-2208.637] -- 0:01:32
753500 -- (-2221.805) (-2202.897) (-2210.998) [-2207.410] * (-2204.109) [-2204.429] (-2217.825) (-2207.535) -- 0:01:31
754000 -- (-2208.548) [-2204.993] (-2210.684) (-2203.825) * [-2207.232] (-2206.615) (-2215.736) (-2205.242) -- 0:01:32
754500 -- (-2210.953) [-2204.840] (-2208.017) (-2209.696) * [-2207.766] (-2207.074) (-2210.085) (-2212.880) -- 0:01:31
755000 -- (-2208.578) (-2208.556) (-2202.547) [-2202.805] * (-2212.093) (-2204.375) (-2210.730) [-2209.196] -- 0:01:31
Average standard deviation of split frequencies: 0.006681
755500 -- (-2209.815) (-2213.292) [-2206.461] (-2208.395) * (-2200.861) (-2218.926) (-2204.346) [-2203.600] -- 0:01:31
756000 -- (-2210.084) [-2205.181] (-2206.639) (-2206.697) * (-2209.762) [-2202.208] (-2207.698) (-2204.219) -- 0:01:31
756500 -- (-2210.405) (-2210.965) [-2202.856] (-2207.062) * [-2207.576] (-2209.088) (-2209.203) (-2213.258) -- 0:01:31
757000 -- (-2206.761) [-2206.219] (-2206.991) (-2207.745) * (-2205.566) [-2210.191] (-2208.941) (-2209.369) -- 0:01:30
757500 -- (-2210.188) (-2210.185) [-2210.310] (-2203.239) * (-2208.361) [-2214.306] (-2214.619) (-2208.525) -- 0:01:30
758000 -- (-2212.833) (-2204.146) (-2214.878) [-2203.487] * (-2206.180) (-2207.726) [-2213.656] (-2211.094) -- 0:01:30
758500 -- (-2205.750) (-2204.356) (-2205.492) [-2199.520] * (-2212.058) [-2203.418] (-2207.654) (-2213.642) -- 0:01:30
759000 -- [-2212.637] (-2205.331) (-2211.102) (-2206.448) * (-2215.227) (-2208.781) [-2200.707] (-2207.168) -- 0:01:30
759500 -- [-2205.521] (-2216.812) (-2204.370) (-2201.652) * (-2205.569) (-2202.109) [-2211.504] (-2206.039) -- 0:01:29
760000 -- (-2205.135) (-2213.608) (-2207.810) [-2211.039] * (-2212.002) (-2203.581) [-2211.610] (-2206.936) -- 0:01:29
Average standard deviation of split frequencies: 0.006714
760500 -- [-2210.625] (-2215.260) (-2208.969) (-2216.160) * (-2214.805) (-2206.062) (-2218.652) [-2213.510] -- 0:01:29
761000 -- (-2203.059) [-2201.657] (-2206.544) (-2219.060) * (-2210.096) (-2212.831) (-2203.992) [-2202.383] -- 0:01:29
761500 -- [-2204.309] (-2213.664) (-2205.424) (-2212.043) * (-2203.388) (-2214.943) (-2210.883) [-2202.679] -- 0:01:28
762000 -- (-2212.542) (-2204.183) [-2202.570] (-2201.457) * [-2206.791] (-2205.889) (-2211.336) (-2210.668) -- 0:01:29
762500 -- (-2205.425) [-2199.880] (-2202.933) (-2210.897) * (-2209.495) (-2210.699) (-2209.314) [-2203.546] -- 0:01:28
763000 -- (-2222.373) (-2209.992) (-2209.488) [-2208.151] * (-2204.398) (-2202.949) [-2208.270] (-2208.329) -- 0:01:28
763500 -- (-2210.703) (-2209.991) (-2203.977) [-2205.986] * (-2199.365) (-2209.671) (-2211.027) [-2203.737] -- 0:01:28
764000 -- (-2205.351) [-2205.644] (-2201.897) (-2212.951) * [-2203.547] (-2203.509) (-2212.112) (-2212.617) -- 0:01:28
764500 -- (-2206.985) (-2211.886) [-2204.682] (-2203.809) * (-2207.589) (-2209.277) (-2211.341) [-2212.617] -- 0:01:28
765000 -- (-2217.761) (-2216.708) (-2200.544) [-2200.391] * (-2213.195) (-2211.537) (-2201.122) [-2203.163] -- 0:01:27
Average standard deviation of split frequencies: 0.006872
765500 -- [-2207.462] (-2215.298) (-2216.939) (-2206.493) * [-2202.467] (-2220.149) (-2210.135) (-2204.450) -- 0:01:27
766000 -- [-2205.481] (-2203.992) (-2209.089) (-2206.126) * (-2213.148) [-2205.082] (-2206.759) (-2210.290) -- 0:01:27
766500 -- (-2200.561) [-2204.755] (-2200.775) (-2216.703) * (-2214.780) (-2206.813) (-2206.345) [-2206.393] -- 0:01:27
767000 -- [-2205.719] (-2210.391) (-2203.529) (-2214.115) * (-2212.584) (-2210.856) [-2200.288] (-2204.395) -- 0:01:27
767500 -- (-2210.051) [-2201.339] (-2200.130) (-2201.819) * (-2211.815) (-2205.173) [-2203.550] (-2217.610) -- 0:01:26
768000 -- (-2206.094) [-2203.550] (-2202.724) (-2207.987) * (-2212.211) [-2208.382] (-2202.897) (-2209.899) -- 0:01:26
768500 -- (-2216.168) (-2202.818) [-2206.082] (-2206.107) * (-2202.599) (-2222.787) [-2209.806] (-2201.776) -- 0:01:26
769000 -- (-2205.736) (-2209.656) (-2210.372) [-2207.049] * (-2210.964) [-2199.106] (-2208.122) (-2206.711) -- 0:01:26
769500 -- (-2208.575) (-2210.220) (-2206.616) [-2209.782] * (-2212.730) (-2204.483) [-2204.990] (-2203.647) -- 0:01:26
770000 -- (-2207.973) (-2207.118) (-2205.120) [-2205.145] * (-2204.293) (-2210.993) (-2218.104) [-2202.095] -- 0:01:26
Average standard deviation of split frequencies: 0.006219
770500 -- (-2206.093) [-2211.067] (-2207.181) (-2208.399) * (-2209.589) (-2206.050) [-2206.420] (-2208.819) -- 0:01:25
771000 -- (-2209.135) [-2202.461] (-2206.883) (-2218.943) * (-2209.569) (-2206.725) [-2209.909] (-2203.333) -- 0:01:25
771500 -- (-2212.357) (-2209.824) [-2202.306] (-2213.300) * (-2210.935) [-2205.097] (-2208.995) (-2203.298) -- 0:01:25
772000 -- [-2209.264] (-2210.158) (-2208.056) (-2218.504) * (-2211.999) [-2206.012] (-2204.431) (-2211.702) -- 0:01:25
772500 -- (-2201.788) [-2215.750] (-2203.505) (-2209.076) * (-2202.110) (-2209.400) [-2200.801] (-2201.165) -- 0:01:25
773000 -- (-2205.883) (-2206.199) [-2205.139] (-2211.168) * (-2208.070) (-2208.933) [-2214.979] (-2203.141) -- 0:01:24
773500 -- (-2212.839) [-2200.525] (-2206.114) (-2210.435) * (-2216.194) (-2212.977) [-2206.746] (-2204.944) -- 0:01:24
774000 -- [-2207.197] (-2205.212) (-2210.374) (-2210.829) * (-2208.300) (-2207.238) (-2208.479) [-2204.520] -- 0:01:24
774500 -- [-2201.565] (-2207.884) (-2216.348) (-2211.957) * [-2202.972] (-2216.008) (-2212.037) (-2212.075) -- 0:01:24
775000 -- (-2217.491) (-2204.669) (-2210.699) [-2203.792] * (-2205.557) (-2210.144) (-2205.810) [-2205.129] -- 0:01:24
Average standard deviation of split frequencies: 0.006480
775500 -- [-2203.091] (-2209.869) (-2211.338) (-2217.562) * [-2207.902] (-2212.298) (-2215.077) (-2205.804) -- 0:01:23
776000 -- [-2210.897] (-2209.054) (-2217.391) (-2208.707) * [-2209.418] (-2215.554) (-2215.157) (-2204.660) -- 0:01:23
776500 -- (-2209.311) [-2200.838] (-2210.866) (-2209.587) * (-2211.558) [-2210.544] (-2206.796) (-2203.087) -- 0:01:23
777000 -- [-2203.720] (-2203.603) (-2212.123) (-2211.257) * (-2210.204) (-2218.305) (-2216.227) [-2205.271] -- 0:01:23
777500 -- (-2212.230) (-2207.738) [-2210.820] (-2206.564) * (-2217.657) [-2207.132] (-2210.824) (-2211.269) -- 0:01:23
778000 -- (-2211.889) [-2205.727] (-2211.926) (-2200.085) * [-2212.685] (-2215.266) (-2211.055) (-2199.500) -- 0:01:23
778500 -- (-2201.744) (-2205.694) (-2209.271) [-2204.176] * (-2215.799) [-2208.971] (-2208.950) (-2205.968) -- 0:01:22
779000 -- [-2208.783] (-2211.265) (-2211.519) (-2205.364) * [-2205.290] (-2203.173) (-2210.503) (-2217.055) -- 0:01:22
779500 -- (-2204.380) [-2205.970] (-2214.238) (-2220.953) * (-2202.083) (-2210.506) [-2206.270] (-2208.845) -- 0:01:22
780000 -- (-2208.219) [-2205.326] (-2210.897) (-2209.890) * [-2204.598] (-2205.457) (-2210.437) (-2205.058) -- 0:01:22
Average standard deviation of split frequencies: 0.006340
780500 -- (-2208.254) [-2211.277] (-2217.309) (-2207.660) * [-2211.187] (-2209.571) (-2215.451) (-2205.976) -- 0:01:22
781000 -- (-2201.170) (-2205.059) [-2202.855] (-2206.251) * (-2203.423) (-2205.622) (-2207.777) [-2209.021] -- 0:01:21
781500 -- (-2205.470) (-2213.886) (-2213.045) [-2202.336] * [-2206.314] (-2209.913) (-2209.726) (-2205.436) -- 0:01:21
782000 -- (-2202.811) [-2208.306] (-2212.968) (-2214.003) * (-2203.807) [-2199.303] (-2215.887) (-2204.949) -- 0:01:21
782500 -- [-2211.682] (-2203.826) (-2211.466) (-2210.005) * [-2205.081] (-2202.712) (-2207.356) (-2199.306) -- 0:01:21
783000 -- (-2212.220) (-2210.874) (-2203.798) [-2203.857] * (-2204.531) (-2211.257) [-2204.184] (-2207.045) -- 0:01:21
783500 -- (-2208.467) [-2209.582] (-2207.672) (-2207.824) * (-2205.394) [-2205.346] (-2208.273) (-2199.043) -- 0:01:20
784000 -- (-2221.323) (-2201.860) (-2215.087) [-2201.987] * [-2206.397] (-2204.746) (-2209.101) (-2209.813) -- 0:01:20
784500 -- (-2214.257) (-2205.915) [-2205.194] (-2214.528) * (-2207.334) (-2208.807) (-2221.214) [-2207.125] -- 0:01:20
785000 -- [-2216.068] (-2210.247) (-2210.450) (-2214.001) * (-2208.621) [-2200.830] (-2211.218) (-2213.858) -- 0:01:20
Average standard deviation of split frequencies: 0.005798
785500 -- [-2207.511] (-2221.460) (-2207.238) (-2213.324) * (-2202.137) (-2205.170) [-2205.613] (-2208.679) -- 0:01:20
786000 -- (-2217.811) (-2208.548) (-2211.172) [-2203.133] * [-2205.507] (-2208.960) (-2206.426) (-2211.263) -- 0:01:20
786500 -- [-2206.234] (-2208.394) (-2204.424) (-2215.399) * (-2219.292) [-2205.747] (-2214.226) (-2208.364) -- 0:01:19
787000 -- [-2201.691] (-2212.021) (-2202.072) (-2214.258) * [-2202.180] (-2217.145) (-2208.855) (-2210.056) -- 0:01:19
787500 -- (-2208.478) (-2217.941) (-2213.155) [-2207.977] * (-2207.394) (-2203.850) (-2204.172) [-2207.176] -- 0:01:19
788000 -- [-2200.903] (-2212.749) (-2211.620) (-2199.213) * (-2202.738) [-2204.609] (-2207.338) (-2218.276) -- 0:01:19
788500 -- [-2208.134] (-2211.373) (-2212.463) (-2209.295) * (-2207.037) (-2211.155) (-2216.911) [-2216.202] -- 0:01:19
789000 -- (-2202.945) [-2200.626] (-2214.872) (-2205.694) * (-2211.804) (-2203.252) [-2202.407] (-2208.498) -- 0:01:18
789500 -- [-2203.385] (-2203.135) (-2211.523) (-2208.134) * (-2202.472) [-2203.180] (-2206.628) (-2203.651) -- 0:01:18
790000 -- (-2214.755) (-2204.578) [-2208.824] (-2201.121) * [-2205.143] (-2206.091) (-2211.024) (-2214.529) -- 0:01:18
Average standard deviation of split frequencies: 0.005465
790500 -- (-2207.605) (-2222.185) (-2210.216) [-2203.275] * [-2200.941] (-2207.800) (-2209.350) (-2206.141) -- 0:01:18
791000 -- (-2208.065) [-2207.888] (-2203.567) (-2212.760) * [-2213.634] (-2217.927) (-2206.816) (-2205.437) -- 0:01:18
791500 -- [-2203.881] (-2206.856) (-2202.516) (-2219.217) * [-2206.815] (-2208.498) (-2204.929) (-2208.916) -- 0:01:17
792000 -- (-2202.026) [-2203.889] (-2204.461) (-2209.875) * (-2204.926) [-2204.296] (-2201.236) (-2208.833) -- 0:01:17
792500 -- (-2207.837) (-2212.374) [-2209.013] (-2206.590) * (-2206.468) (-2207.690) [-2203.733] (-2215.941) -- 0:01:17
793000 -- (-2199.956) [-2208.813] (-2206.946) (-2217.552) * [-2204.453] (-2203.794) (-2206.037) (-2199.281) -- 0:01:17
793500 -- (-2205.624) (-2207.477) [-2203.944] (-2205.126) * [-2203.213] (-2206.000) (-2205.319) (-2204.665) -- 0:01:17
794000 -- [-2205.327] (-2205.351) (-2205.648) (-2207.042) * [-2208.387] (-2203.322) (-2206.260) (-2205.843) -- 0:01:17
794500 -- (-2206.345) (-2210.937) (-2210.614) [-2206.697] * (-2210.860) (-2203.503) (-2205.093) [-2204.186] -- 0:01:16
795000 -- (-2205.566) (-2203.821) [-2211.488] (-2204.151) * (-2205.249) [-2201.171] (-2207.148) (-2207.311) -- 0:01:16
Average standard deviation of split frequencies: 0.004836
795500 -- (-2206.306) (-2211.341) [-2197.076] (-2215.395) * (-2208.990) (-2213.791) [-2205.806] (-2206.968) -- 0:01:16
796000 -- (-2201.224) (-2212.571) (-2201.928) [-2204.922] * (-2205.993) (-2205.674) (-2207.081) [-2205.912] -- 0:01:16
796500 -- (-2208.318) [-2202.248] (-2210.774) (-2209.141) * [-2207.731] (-2208.588) (-2208.182) (-2209.765) -- 0:01:16
797000 -- (-2214.564) (-2206.988) [-2208.440] (-2202.352) * [-2209.283] (-2207.599) (-2206.322) (-2211.236) -- 0:01:15
797500 -- (-2210.486) [-2209.721] (-2203.423) (-2214.726) * (-2205.504) (-2210.641) [-2202.756] (-2207.437) -- 0:01:15
798000 -- (-2207.183) [-2213.844] (-2203.213) (-2211.640) * (-2203.085) [-2203.501] (-2209.789) (-2214.941) -- 0:01:15
798500 -- (-2203.455) (-2215.860) (-2202.857) [-2211.895] * (-2205.812) (-2202.189) [-2202.792] (-2206.172) -- 0:01:15
799000 -- (-2212.189) (-2209.804) [-2204.840] (-2203.650) * [-2202.254] (-2205.526) (-2209.495) (-2201.738) -- 0:01:15
799500 -- (-2209.406) (-2207.873) (-2206.376) [-2208.401] * (-2203.162) (-2210.380) [-2213.117] (-2204.311) -- 0:01:14
800000 -- (-2208.906) (-2204.050) (-2211.212) [-2208.251] * (-2205.730) (-2206.576) (-2217.017) [-2203.383] -- 0:01:15
Average standard deviation of split frequencies: 0.005005
800500 -- (-2209.244) (-2206.105) [-2202.689] (-2206.680) * (-2213.362) [-2206.781] (-2213.796) (-2212.152) -- 0:01:14
801000 -- [-2208.718] (-2211.229) (-2214.775) (-2204.604) * (-2207.988) (-2210.804) [-2204.268] (-2203.769) -- 0:01:14
801500 -- [-2202.586] (-2207.805) (-2215.959) (-2210.985) * (-2209.244) (-2213.717) (-2202.703) [-2204.505] -- 0:01:14
802000 -- (-2209.090) (-2201.850) (-2204.796) [-2207.610] * (-2207.187) (-2206.374) (-2204.950) [-2209.204] -- 0:01:14
802500 -- (-2211.641) [-2200.988] (-2205.993) (-2207.382) * [-2207.596] (-2208.002) (-2202.596) (-2206.178) -- 0:01:14
803000 -- (-2209.865) [-2207.991] (-2212.324) (-2209.654) * (-2206.633) [-2207.339] (-2204.009) (-2206.268) -- 0:01:13
803500 -- (-2217.705) (-2204.854) (-2209.316) [-2205.965] * (-2203.099) (-2207.109) [-2213.262] (-2208.844) -- 0:01:13
804000 -- [-2214.026] (-2206.940) (-2215.895) (-2208.793) * [-2202.767] (-2207.749) (-2220.927) (-2203.495) -- 0:01:13
804500 -- (-2206.445) (-2207.588) [-2209.983] (-2208.723) * (-2201.839) (-2210.772) (-2201.544) [-2197.593] -- 0:01:13
805000 -- (-2210.142) [-2210.817] (-2213.318) (-2212.662) * (-2207.859) [-2205.191] (-2206.909) (-2206.111) -- 0:01:13
Average standard deviation of split frequencies: 0.005264
805500 -- (-2220.036) (-2206.845) [-2203.297] (-2206.743) * [-2201.009] (-2209.722) (-2206.520) (-2207.474) -- 0:01:12
806000 -- (-2200.210) (-2220.547) (-2208.428) [-2202.007] * (-2209.207) (-2208.188) [-2201.637] (-2206.140) -- 0:01:12
806500 -- [-2201.941] (-2216.374) (-2217.711) (-2209.675) * (-2217.278) (-2212.057) [-2206.601] (-2206.745) -- 0:01:12
807000 -- (-2214.183) [-2204.421] (-2206.738) (-2205.716) * (-2206.182) (-2205.402) (-2223.036) [-2205.385] -- 0:01:12
807500 -- (-2211.374) (-2206.215) (-2214.493) [-2211.317] * (-2209.961) [-2204.203] (-2213.845) (-2213.952) -- 0:01:12
808000 -- (-2202.815) [-2206.629] (-2201.054) (-2215.474) * (-2209.134) (-2204.735) (-2217.485) [-2204.366] -- 0:01:12
808500 -- (-2206.080) [-2204.903] (-2202.096) (-2206.424) * (-2215.216) (-2204.151) (-2212.582) [-2206.056] -- 0:01:11
809000 -- (-2202.153) (-2204.785) [-2204.238] (-2214.200) * (-2206.306) [-2204.961] (-2207.215) (-2211.259) -- 0:01:11
809500 -- (-2202.115) (-2204.966) [-2200.996] (-2209.703) * (-2208.223) (-2204.158) [-2202.920] (-2208.058) -- 0:01:11
810000 -- (-2206.166) [-2203.872] (-2206.649) (-2206.567) * [-2207.784] (-2210.766) (-2206.692) (-2202.936) -- 0:01:11
Average standard deviation of split frequencies: 0.005234
810500 -- (-2205.680) (-2208.760) [-2206.244] (-2199.214) * (-2207.061) (-2210.670) (-2205.461) [-2213.701] -- 0:01:11
811000 -- [-2204.272] (-2198.742) (-2209.859) (-2209.842) * (-2201.424) (-2202.778) (-2218.634) [-2210.961] -- 0:01:10
811500 -- (-2210.436) [-2211.412] (-2205.950) (-2205.397) * (-2209.472) (-2213.339) [-2204.097] (-2208.582) -- 0:01:10
812000 -- (-2204.324) (-2206.563) [-2200.591] (-2201.847) * (-2210.204) (-2212.565) (-2211.806) [-2214.722] -- 0:01:10
812500 -- (-2205.742) (-2215.038) (-2208.138) [-2210.587] * (-2209.837) (-2210.088) (-2205.289) [-2202.642] -- 0:01:10
813000 -- [-2210.228] (-2209.305) (-2200.880) (-2206.701) * (-2210.999) (-2207.022) (-2216.375) [-2207.752] -- 0:01:10
813500 -- (-2213.292) (-2206.045) (-2202.375) [-2201.285] * (-2209.136) (-2209.652) [-2208.890] (-2209.811) -- 0:01:09
814000 -- (-2211.262) [-2199.481] (-2206.372) (-2204.944) * (-2204.401) (-2207.466) (-2213.966) [-2207.340] -- 0:01:09
814500 -- [-2204.250] (-2200.233) (-2209.482) (-2203.554) * (-2207.223) [-2204.614] (-2209.187) (-2205.727) -- 0:01:09
815000 -- (-2204.743) [-2205.095] (-2202.950) (-2207.248) * (-2208.963) (-2216.278) (-2214.196) [-2205.414] -- 0:01:09
Average standard deviation of split frequencies: 0.004910
815500 -- (-2208.322) (-2210.203) [-2202.560] (-2201.530) * (-2204.571) (-2212.178) [-2206.531] (-2209.919) -- 0:01:09
816000 -- (-2205.124) (-2208.425) (-2217.219) [-2205.403] * (-2215.944) [-2212.375] (-2207.510) (-2209.830) -- 0:01:09
816500 -- [-2202.292] (-2202.628) (-2206.833) (-2202.135) * (-2208.036) (-2204.953) [-2207.526] (-2214.500) -- 0:01:08
817000 -- (-2201.901) [-2205.147] (-2203.381) (-2208.561) * (-2206.288) (-2211.473) (-2206.088) [-2207.283] -- 0:01:08
817500 -- (-2200.524) [-2208.827] (-2211.024) (-2212.457) * (-2212.453) (-2207.234) (-2202.907) [-2214.022] -- 0:01:08
818000 -- [-2210.751] (-2211.851) (-2209.747) (-2203.561) * [-2203.257] (-2206.382) (-2209.491) (-2206.035) -- 0:01:08
818500 -- [-2203.602] (-2207.232) (-2213.424) (-2213.923) * (-2209.684) (-2209.175) [-2206.512] (-2207.044) -- 0:01:08
819000 -- (-2209.800) [-2208.592] (-2203.152) (-2213.093) * (-2209.586) (-2210.007) (-2218.880) [-2207.511] -- 0:01:07
819500 -- (-2205.668) (-2208.922) (-2200.954) [-2203.160] * (-2203.356) (-2213.089) [-2202.511] (-2212.826) -- 0:01:07
820000 -- (-2208.992) [-2211.591] (-2213.881) (-2209.708) * [-2206.990] (-2209.144) (-2205.853) (-2207.829) -- 0:01:07
Average standard deviation of split frequencies: 0.004691
820500 -- (-2209.197) (-2210.092) (-2210.529) [-2207.564] * (-2210.042) (-2217.618) [-2204.442] (-2213.524) -- 0:01:07
821000 -- (-2207.479) (-2208.298) [-2203.723] (-2203.909) * [-2201.975] (-2211.423) (-2209.619) (-2217.466) -- 0:01:07
821500 -- [-2213.138] (-2209.636) (-2211.017) (-2204.711) * (-2210.870) [-2204.120] (-2202.918) (-2208.943) -- 0:01:06
822000 -- (-2206.040) (-2208.480) [-2208.987] (-2208.924) * (-2206.951) [-2205.422] (-2213.361) (-2202.457) -- 0:01:06
822500 -- [-2205.280] (-2210.457) (-2209.167) (-2212.433) * (-2201.661) (-2203.488) [-2201.562] (-2201.403) -- 0:01:06
823000 -- (-2202.827) (-2206.580) (-2199.812) [-2206.697] * (-2207.872) (-2212.214) [-2211.205] (-2212.270) -- 0:01:06
823500 -- (-2209.723) (-2214.567) (-2205.258) [-2209.033] * (-2212.267) (-2205.791) [-2205.034] (-2201.978) -- 0:01:06
824000 -- [-2203.852] (-2210.084) (-2212.768) (-2206.160) * (-2205.479) (-2205.742) [-2211.831] (-2209.265) -- 0:01:06
824500 -- (-2209.589) [-2204.526] (-2218.998) (-2211.022) * (-2205.110) (-2206.056) (-2203.866) [-2206.402] -- 0:01:05
825000 -- [-2205.179] (-2220.591) (-2206.791) (-2202.733) * [-2206.683] (-2213.253) (-2219.405) (-2205.519) -- 0:01:05
Average standard deviation of split frequencies: 0.004375
825500 -- [-2203.757] (-2212.701) (-2212.663) (-2206.651) * [-2213.417] (-2205.220) (-2211.142) (-2208.388) -- 0:01:05
826000 -- (-2211.258) (-2215.015) [-2212.627] (-2205.252) * (-2212.524) (-2203.428) [-2208.960] (-2208.440) -- 0:01:05
826500 -- [-2206.715] (-2211.714) (-2208.743) (-2203.330) * (-2209.856) [-2200.885] (-2212.536) (-2211.068) -- 0:01:05
827000 -- [-2202.872] (-2212.148) (-2213.795) (-2213.962) * [-2211.122] (-2209.167) (-2202.248) (-2213.675) -- 0:01:04
827500 -- (-2202.857) (-2210.151) [-2211.214] (-2202.321) * [-2217.928] (-2204.982) (-2205.392) (-2219.780) -- 0:01:04
828000 -- (-2205.464) (-2200.374) [-2206.278] (-2206.295) * (-2219.884) [-2203.720] (-2211.307) (-2213.219) -- 0:01:04
828500 -- (-2210.807) (-2201.515) [-2204.582] (-2206.952) * [-2205.624] (-2206.586) (-2209.241) (-2211.061) -- 0:01:04
829000 -- [-2202.854] (-2210.514) (-2215.940) (-2214.036) * (-2208.634) (-2210.056) [-2200.456] (-2200.391) -- 0:01:04
829500 -- [-2204.039] (-2206.775) (-2212.893) (-2203.055) * (-2201.700) [-2206.880] (-2212.738) (-2203.458) -- 0:01:03
830000 -- (-2212.447) (-2203.053) [-2217.136] (-2214.664) * [-2204.892] (-2207.500) (-2203.863) (-2213.517) -- 0:01:03
Average standard deviation of split frequencies: 0.004351
830500 -- (-2214.202) [-2205.954] (-2216.806) (-2210.169) * (-2216.360) (-2214.135) [-2203.743] (-2207.990) -- 0:01:03
831000 -- (-2221.783) (-2205.641) [-2210.281] (-2209.513) * (-2205.737) (-2217.590) [-2203.999] (-2205.956) -- 0:01:03
831500 -- (-2222.915) (-2204.637) (-2211.412) [-2209.308] * (-2207.123) [-2204.540] (-2205.190) (-2207.133) -- 0:01:03
832000 -- (-2205.871) (-2203.252) (-2211.985) [-2210.044] * (-2208.841) [-2209.635] (-2208.674) (-2208.990) -- 0:01:03
832500 -- [-2202.572] (-2209.645) (-2220.467) (-2211.098) * (-2204.893) (-2212.425) [-2206.713] (-2208.940) -- 0:01:02
833000 -- [-2199.631] (-2211.500) (-2205.103) (-2206.819) * (-2209.338) [-2207.351] (-2208.808) (-2214.844) -- 0:01:02
833500 -- (-2212.436) (-2205.925) [-2209.803] (-2202.939) * [-2205.155] (-2215.253) (-2213.315) (-2202.889) -- 0:01:02
834000 -- (-2217.165) (-2205.196) [-2207.178] (-2206.024) * (-2213.473) (-2205.126) (-2207.931) [-2201.473] -- 0:01:02
834500 -- (-2204.492) (-2212.800) (-2206.714) [-2200.625] * [-2202.527] (-2209.934) (-2205.798) (-2204.476) -- 0:01:02
835000 -- (-2206.401) [-2202.075] (-2203.610) (-2208.976) * [-2205.534] (-2211.130) (-2206.095) (-2203.667) -- 0:01:01
Average standard deviation of split frequencies: 0.003853
835500 -- (-2205.297) (-2207.934) (-2210.566) [-2208.968] * (-2212.747) (-2207.169) [-2209.973] (-2206.301) -- 0:01:01
836000 -- [-2205.874] (-2208.127) (-2206.731) (-2204.583) * (-2200.941) (-2205.412) [-2203.160] (-2214.412) -- 0:01:01
836500 -- [-2201.465] (-2202.769) (-2204.953) (-2208.615) * (-2200.969) (-2207.542) (-2208.506) [-2207.440] -- 0:01:01
837000 -- (-2218.159) [-2206.704] (-2209.987) (-2213.907) * [-2208.183] (-2203.520) (-2223.955) (-2205.429) -- 0:01:01
837500 -- (-2205.208) [-2205.160] (-2213.606) (-2204.013) * (-2214.762) [-2203.628] (-2206.211) (-2207.747) -- 0:01:00
838000 -- (-2209.212) (-2216.348) (-2217.408) [-2208.163] * (-2206.554) [-2207.516] (-2204.516) (-2216.416) -- 0:01:00
838500 -- (-2206.445) [-2202.690] (-2205.110) (-2216.445) * (-2209.098) (-2203.644) [-2203.463] (-2208.596) -- 0:01:00
839000 -- (-2202.305) (-2204.842) [-2204.786] (-2207.998) * (-2216.175) (-2209.631) (-2207.345) [-2208.995] -- 0:01:00
839500 -- (-2207.686) [-2210.868] (-2204.076) (-2208.975) * (-2213.132) (-2210.434) (-2207.074) [-2211.518] -- 0:01:00
840000 -- (-2205.776) (-2205.663) [-2203.821] (-2210.345) * [-2204.763] (-2207.411) (-2208.446) (-2216.913) -- 0:01:00
Average standard deviation of split frequencies: 0.004393
840500 -- [-2211.782] (-2205.304) (-2207.536) (-2214.288) * [-2206.352] (-2200.319) (-2219.054) (-2206.675) -- 0:00:59
841000 -- (-2216.885) [-2204.650] (-2200.383) (-2205.596) * (-2208.639) (-2206.861) (-2208.344) [-2212.580] -- 0:00:59
841500 -- (-2216.711) (-2216.280) (-2211.267) [-2205.595] * (-2201.952) (-2206.852) (-2212.697) [-2204.642] -- 0:00:59
842000 -- (-2212.341) (-2212.456) [-2205.761] (-2208.295) * (-2207.912) [-2211.203] (-2202.414) (-2205.136) -- 0:00:59
842500 -- [-2202.927] (-2211.864) (-2217.511) (-2202.684) * (-2202.806) (-2211.481) (-2210.342) [-2206.999] -- 0:00:59
843000 -- (-2206.931) (-2209.823) [-2206.081] (-2200.028) * [-2207.158] (-2204.778) (-2202.964) (-2214.886) -- 0:00:58
843500 -- (-2214.778) (-2208.347) [-2204.327] (-2211.898) * (-2218.567) (-2219.252) [-2201.359] (-2214.623) -- 0:00:58
844000 -- (-2207.637) (-2207.988) [-2202.311] (-2217.229) * (-2216.404) (-2211.039) (-2220.052) [-2211.765] -- 0:00:58
844500 -- (-2208.116) (-2210.660) (-2212.040) [-2214.268] * (-2198.835) (-2210.444) [-2207.110] (-2211.731) -- 0:00:58
845000 -- (-2203.325) (-2203.871) (-2204.922) [-2207.487] * (-2210.000) (-2204.002) [-2211.174] (-2207.751) -- 0:00:58
Average standard deviation of split frequencies: 0.004458
845500 -- (-2203.307) (-2201.750) (-2206.409) [-2205.538] * (-2204.077) [-2209.565] (-2207.798) (-2204.627) -- 0:00:57
846000 -- (-2208.321) (-2211.911) (-2202.297) [-2197.850] * (-2209.059) (-2207.629) (-2208.090) [-2209.736] -- 0:00:57
846500 -- (-2205.266) [-2207.672] (-2205.564) (-2213.192) * (-2221.953) (-2207.337) (-2211.013) [-2205.302] -- 0:00:57
847000 -- (-2206.452) (-2209.429) (-2202.480) [-2207.651] * [-2201.561] (-2216.967) (-2211.369) (-2208.047) -- 0:00:57
847500 -- (-2211.104) (-2206.858) [-2204.853] (-2212.387) * [-2201.913] (-2213.995) (-2211.498) (-2203.641) -- 0:00:57
848000 -- (-2216.289) [-2209.816] (-2208.567) (-2212.243) * (-2211.043) (-2208.313) (-2205.084) [-2203.439] -- 0:00:57
848500 -- (-2212.204) (-2205.367) [-2203.140] (-2206.997) * (-2208.844) (-2207.455) (-2209.652) [-2202.192] -- 0:00:56
849000 -- (-2208.952) (-2208.065) [-2200.702] (-2212.354) * [-2204.442] (-2200.878) (-2214.125) (-2201.454) -- 0:00:56
849500 -- (-2215.590) (-2214.388) (-2207.035) [-2210.965] * (-2208.802) (-2205.502) (-2213.646) [-2209.388] -- 0:00:56
850000 -- [-2219.668] (-2207.518) (-2207.052) (-2205.935) * (-2213.365) (-2212.364) [-2207.314] (-2203.957) -- 0:00:56
Average standard deviation of split frequencies: 0.004156
850500 -- (-2214.193) (-2217.892) (-2209.471) [-2204.116] * (-2211.978) (-2208.013) (-2208.975) [-2202.908] -- 0:00:56
851000 -- (-2207.385) [-2201.611] (-2206.599) (-2208.908) * (-2220.780) (-2204.706) (-2212.413) [-2205.090] -- 0:00:55
851500 -- (-2219.354) (-2217.240) (-2201.774) [-2207.911] * [-2208.883] (-2209.043) (-2214.217) (-2213.274) -- 0:00:55
852000 -- [-2209.799] (-2208.444) (-2206.827) (-2205.613) * [-2208.042] (-2210.052) (-2217.735) (-2206.705) -- 0:00:55
852500 -- (-2202.481) (-2209.479) [-2204.492] (-2207.755) * (-2220.835) (-2213.852) (-2213.687) [-2200.816] -- 0:00:55
853000 -- [-2211.453] (-2219.229) (-2211.527) (-2205.343) * (-2218.900) (-2209.418) [-2205.133] (-2210.378) -- 0:00:55
853500 -- [-2214.243] (-2211.672) (-2213.617) (-2208.969) * (-2209.717) (-2216.057) [-2204.593] (-2201.037) -- 0:00:54
854000 -- (-2212.126) (-2206.539) (-2206.488) [-2201.074] * (-2206.123) (-2214.404) [-2208.837] (-2204.544) -- 0:00:54
854500 -- (-2214.417) [-2205.054] (-2207.546) (-2206.963) * [-2206.719] (-2215.712) (-2207.912) (-2202.895) -- 0:00:54
855000 -- (-2211.830) [-2207.834] (-2208.043) (-2210.995) * [-2207.704] (-2206.503) (-2204.435) (-2207.825) -- 0:00:54
Average standard deviation of split frequencies: 0.004681
855500 -- (-2209.336) (-2209.147) (-2205.050) [-2211.556] * (-2214.662) (-2211.371) [-2203.836] (-2211.992) -- 0:00:54
856000 -- (-2206.427) (-2208.234) (-2210.170) [-2207.362] * (-2211.254) [-2202.378] (-2216.201) (-2210.855) -- 0:00:54
856500 -- [-2202.051] (-2205.322) (-2208.594) (-2211.520) * (-2206.651) (-2208.837) [-2212.689] (-2218.474) -- 0:00:53
857000 -- [-2202.808] (-2212.967) (-2212.279) (-2208.585) * (-2202.113) (-2204.021) (-2212.461) [-2209.942] -- 0:00:53
857500 -- [-2212.844] (-2209.993) (-2207.826) (-2216.246) * [-2206.051] (-2211.788) (-2211.326) (-2216.642) -- 0:00:53
858000 -- (-2209.094) [-2203.225] (-2209.229) (-2199.176) * [-2206.730] (-2211.667) (-2204.194) (-2204.963) -- 0:00:53
858500 -- [-2204.310] (-2211.335) (-2211.741) (-2205.409) * (-2212.758) (-2209.042) (-2213.593) [-2206.346] -- 0:00:53
859000 -- (-2218.786) (-2207.799) [-2199.142] (-2202.671) * (-2202.801) [-2208.000] (-2204.857) (-2201.742) -- 0:00:52
859500 -- (-2207.781) [-2206.611] (-2209.726) (-2205.660) * [-2201.870] (-2208.483) (-2204.781) (-2209.046) -- 0:00:52
860000 -- (-2202.732) (-2216.379) (-2208.672) [-2206.354] * (-2205.245) (-2216.820) (-2204.427) [-2208.852] -- 0:00:52
Average standard deviation of split frequencies: 0.004838
860500 -- (-2199.884) (-2208.467) [-2207.218] (-2214.342) * (-2201.949) (-2213.668) [-2207.165] (-2199.729) -- 0:00:52
861000 -- (-2214.845) (-2203.357) [-2202.679] (-2199.730) * (-2209.828) (-2207.118) (-2205.057) [-2203.956] -- 0:00:52
861500 -- (-2214.365) (-2205.257) (-2200.737) [-2202.664] * (-2208.623) [-2201.045] (-2213.973) (-2212.222) -- 0:00:51
862000 -- (-2212.981) (-2200.059) (-2209.601) [-2207.239] * (-2213.862) (-2206.841) (-2205.802) [-2213.395] -- 0:00:51
862500 -- (-2230.356) (-2208.997) [-2209.657] (-2208.692) * (-2211.232) (-2200.095) (-2212.404) [-2202.330] -- 0:00:51
863000 -- (-2213.877) (-2206.888) (-2208.015) [-2203.460] * (-2209.001) (-2206.573) (-2212.578) [-2209.821] -- 0:00:51
863500 -- (-2212.698) [-2213.035] (-2203.426) (-2210.153) * (-2203.772) (-2212.331) (-2220.104) [-2201.773] -- 0:00:51
864000 -- [-2202.554] (-2211.422) (-2210.446) (-2204.489) * [-2203.378] (-2214.691) (-2213.011) (-2203.770) -- 0:00:51
864500 -- (-2203.492) (-2206.498) (-2201.323) [-2215.684] * (-2203.343) [-2199.391] (-2205.369) (-2204.308) -- 0:00:50
865000 -- [-2207.766] (-2208.525) (-2206.323) (-2208.891) * (-2204.163) (-2201.071) (-2211.698) [-2206.064] -- 0:00:50
Average standard deviation of split frequencies: 0.004355
865500 -- (-2202.971) (-2204.363) [-2202.496] (-2210.700) * (-2210.600) (-2208.907) (-2205.213) [-2204.485] -- 0:00:50
866000 -- (-2205.198) [-2204.965] (-2204.442) (-2213.254) * (-2209.194) (-2206.479) (-2203.928) [-2203.997] -- 0:00:50
866500 -- (-2208.433) (-2203.404) (-2210.003) [-2213.727] * (-2217.580) (-2208.535) (-2200.881) [-2210.516] -- 0:00:50
867000 -- (-2209.154) [-2201.914] (-2202.670) (-2215.551) * (-2221.068) (-2207.158) [-2201.832] (-2204.847) -- 0:00:49
867500 -- (-2214.143) (-2203.162) (-2211.813) [-2203.909] * (-2206.284) (-2208.290) (-2215.247) [-2207.091] -- 0:00:49
868000 -- [-2206.068] (-2206.714) (-2214.341) (-2207.376) * (-2207.999) [-2207.167] (-2208.900) (-2215.428) -- 0:00:49
868500 -- (-2205.424) (-2205.831) (-2209.747) [-2201.618] * (-2213.592) (-2207.770) (-2203.814) [-2200.459] -- 0:00:49
869000 -- (-2208.304) (-2209.418) [-2205.611] (-2203.560) * (-2208.078) (-2210.983) (-2212.890) [-2202.888] -- 0:00:49
869500 -- (-2211.822) (-2210.652) (-2211.182) [-2200.659] * (-2207.050) [-2199.675] (-2212.830) (-2208.930) -- 0:00:48
870000 -- (-2215.224) (-2210.377) [-2210.675] (-2211.002) * [-2204.037] (-2214.176) (-2211.900) (-2205.548) -- 0:00:48
Average standard deviation of split frequencies: 0.004331
870500 -- (-2206.002) [-2205.453] (-2212.526) (-2205.887) * (-2204.986) (-2210.744) (-2205.715) [-2212.268] -- 0:00:48
871000 -- (-2201.014) (-2211.949) [-2202.940] (-2207.614) * (-2212.477) (-2216.163) (-2202.915) [-2203.227] -- 0:00:48
871500 -- (-2203.405) (-2216.582) [-2202.372] (-2209.238) * (-2207.767) (-2210.080) (-2203.605) [-2207.715] -- 0:00:48
872000 -- (-2207.880) (-2205.451) (-2208.916) [-2203.638] * (-2211.239) (-2216.969) (-2208.995) [-2206.316] -- 0:00:48
872500 -- [-2208.966] (-2217.127) (-2203.407) (-2210.405) * (-2213.404) (-2203.681) (-2213.041) [-2207.983] -- 0:00:47
873000 -- [-2211.148] (-2205.294) (-2213.902) (-2213.342) * (-2205.871) [-2206.545] (-2207.639) (-2205.037) -- 0:00:47
873500 -- (-2208.270) (-2215.188) (-2204.907) [-2209.937] * (-2204.704) (-2206.497) [-2207.285] (-2219.381) -- 0:00:47
874000 -- (-2207.746) [-2208.844] (-2207.583) (-2223.628) * [-2208.288] (-2207.624) (-2205.044) (-2211.148) -- 0:00:47
874500 -- (-2208.845) (-2205.807) [-2210.103] (-2209.311) * (-2212.198) (-2210.689) (-2210.615) [-2201.472] -- 0:00:47
875000 -- (-2209.311) (-2203.825) (-2210.904) [-2210.206] * (-2202.973) [-2207.914] (-2213.413) (-2208.794) -- 0:00:46
Average standard deviation of split frequencies: 0.004126
875500 -- (-2208.537) [-2204.393] (-2205.909) (-2208.407) * [-2209.572] (-2213.521) (-2203.083) (-2212.068) -- 0:00:46
876000 -- (-2210.261) (-2210.319) [-2207.116] (-2206.374) * [-2205.443] (-2212.993) (-2212.448) (-2213.217) -- 0:00:46
876500 -- (-2212.646) (-2203.806) [-2208.342] (-2202.772) * (-2208.221) (-2208.019) (-2208.938) [-2208.897] -- 0:00:46
877000 -- (-2216.868) [-2213.750] (-2209.348) (-2211.326) * [-2201.832] (-2213.162) (-2214.240) (-2208.569) -- 0:00:46
877500 -- (-2210.288) (-2207.761) (-2205.172) [-2208.292] * (-2208.904) (-2208.152) [-2203.497] (-2212.683) -- 0:00:45
878000 -- [-2211.739] (-2210.613) (-2205.321) (-2209.502) * (-2201.083) (-2208.484) [-2210.759] (-2218.907) -- 0:00:45
878500 -- (-2212.564) [-2205.701] (-2208.213) (-2213.187) * (-2209.605) (-2207.101) (-2207.530) [-2202.681] -- 0:00:45
879000 -- (-2209.621) [-2204.077] (-2207.136) (-2206.166) * (-2209.952) [-2204.133] (-2206.808) (-2204.942) -- 0:00:45
879500 -- (-2204.483) [-2201.386] (-2211.994) (-2207.488) * (-2203.350) [-2200.236] (-2205.386) (-2201.733) -- 0:00:45
880000 -- (-2210.782) (-2207.333) (-2210.102) [-2203.336] * (-2207.771) [-2201.603] (-2207.589) (-2213.787) -- 0:00:45
Average standard deviation of split frequencies: 0.004371
880500 -- (-2215.596) [-2205.303] (-2218.452) (-2201.501) * [-2208.657] (-2209.489) (-2205.746) (-2209.034) -- 0:00:44
881000 -- (-2210.820) (-2200.695) (-2204.613) [-2204.059] * (-2208.635) (-2211.229) (-2204.480) [-2202.842] -- 0:00:44
881500 -- (-2206.972) (-2209.265) [-2209.855] (-2212.597) * (-2210.117) [-2205.127] (-2207.998) (-2210.809) -- 0:00:44
882000 -- (-2210.885) (-2210.430) (-2209.727) [-2207.046] * (-2207.074) (-2203.948) (-2216.819) [-2211.148] -- 0:00:44
882500 -- (-2202.029) (-2205.612) (-2203.904) [-2203.384] * (-2213.186) (-2202.741) (-2204.238) [-2202.738] -- 0:00:44
883000 -- (-2206.925) (-2206.503) [-2205.544] (-2212.929) * (-2205.992) [-2210.898] (-2204.604) (-2207.243) -- 0:00:43
883500 -- (-2211.054) (-2203.755) [-2206.132] (-2218.390) * (-2208.393) [-2205.675] (-2203.468) (-2205.351) -- 0:00:43
884000 -- (-2203.094) (-2205.447) [-2201.979] (-2207.767) * (-2215.250) [-2207.210] (-2206.705) (-2205.192) -- 0:00:43
884500 -- (-2208.461) (-2212.004) [-2206.473] (-2214.918) * (-2210.583) [-2206.296] (-2207.569) (-2219.600) -- 0:00:43
885000 -- (-2207.798) (-2206.158) [-2207.167] (-2208.165) * [-2205.902] (-2203.865) (-2206.806) (-2204.861) -- 0:00:43
Average standard deviation of split frequencies: 0.004345
885500 -- (-2205.864) [-2201.232] (-2203.587) (-2204.464) * (-2212.337) [-2201.622] (-2207.430) (-2208.968) -- 0:00:42
886000 -- (-2205.745) (-2219.654) (-2203.167) [-2212.598] * (-2207.306) (-2209.294) [-2204.968] (-2208.623) -- 0:00:42
886500 -- [-2208.319] (-2210.397) (-2221.961) (-2209.736) * [-2203.438] (-2206.264) (-2200.985) (-2201.897) -- 0:00:42
887000 -- [-2204.874] (-2218.167) (-2213.998) (-2213.020) * (-2208.539) [-2200.239] (-2207.835) (-2201.893) -- 0:00:42
887500 -- [-2205.203] (-2213.085) (-2208.888) (-2206.956) * (-2211.342) (-2203.918) (-2212.786) [-2203.208] -- 0:00:42
888000 -- (-2207.837) (-2204.736) (-2212.776) [-2207.973] * (-2203.197) (-2204.390) [-2207.909] (-2202.501) -- 0:00:42
888500 -- (-2213.107) (-2208.083) [-2206.693] (-2203.151) * (-2214.096) (-2203.350) (-2212.549) [-2207.422] -- 0:00:41
889000 -- (-2206.231) (-2210.076) (-2207.271) [-2204.286] * (-2204.780) (-2209.862) (-2212.530) [-2204.068] -- 0:00:41
889500 -- (-2205.906) [-2200.989] (-2205.814) (-2212.066) * (-2211.938) (-2210.254) (-2205.595) [-2205.552] -- 0:00:41
890000 -- (-2204.537) [-2202.534] (-2200.034) (-2203.704) * [-2202.801] (-2215.065) (-2210.724) (-2202.633) -- 0:00:41
Average standard deviation of split frequencies: 0.005066
890500 -- (-2208.843) (-2215.314) [-2200.567] (-2207.024) * (-2203.565) (-2215.578) [-2204.878] (-2211.877) -- 0:00:41
891000 -- (-2206.896) (-2205.638) [-2203.729] (-2211.203) * (-2213.690) (-2206.316) [-2202.797] (-2205.439) -- 0:00:40
891500 -- (-2210.526) [-2209.178] (-2204.063) (-2206.467) * (-2204.546) [-2204.861] (-2201.332) (-2211.178) -- 0:00:40
892000 -- (-2209.620) (-2205.890) [-2209.734] (-2210.400) * (-2204.600) (-2217.497) [-2209.997] (-2207.044) -- 0:00:40
892500 -- [-2204.704] (-2204.861) (-2209.918) (-2207.661) * [-2206.113] (-2212.259) (-2210.235) (-2210.204) -- 0:00:40
893000 -- [-2200.960] (-2199.058) (-2211.621) (-2203.425) * (-2200.928) (-2206.259) [-2202.664] (-2210.771) -- 0:00:40
893500 -- [-2204.963] (-2203.751) (-2206.804) (-2215.077) * [-2202.145] (-2206.360) (-2207.797) (-2206.627) -- 0:00:39
894000 -- (-2207.447) (-2203.800) [-2205.983] (-2205.938) * [-2210.516] (-2209.747) (-2215.546) (-2210.382) -- 0:00:39
894500 -- (-2209.095) [-2206.076] (-2207.736) (-2203.065) * [-2201.669] (-2209.994) (-2213.109) (-2210.322) -- 0:00:39
895000 -- (-2219.894) (-2216.367) [-2209.608] (-2206.370) * [-2204.024] (-2216.038) (-2206.153) (-2206.644) -- 0:00:39
Average standard deviation of split frequencies: 0.004209
895500 -- (-2203.226) [-2206.132] (-2200.784) (-2207.155) * (-2215.758) (-2200.726) (-2208.844) [-2205.028] -- 0:00:39
896000 -- (-2205.564) (-2205.161) [-2202.946] (-2215.697) * (-2217.880) [-2213.830] (-2206.716) (-2210.901) -- 0:00:39
896500 -- (-2212.868) [-2200.965] (-2207.968) (-2209.566) * (-2210.093) (-2213.857) [-2211.436] (-2210.452) -- 0:00:38
897000 -- (-2204.845) [-2204.267] (-2209.328) (-2208.155) * (-2210.250) [-2207.453] (-2207.216) (-2207.989) -- 0:00:38
897500 -- (-2202.852) (-2208.236) [-2206.526] (-2208.242) * (-2210.957) [-2207.440] (-2204.726) (-2203.167) -- 0:00:38
898000 -- (-2212.411) (-2213.226) (-2205.197) [-2208.744] * (-2212.823) (-2208.490) (-2218.345) [-2205.125] -- 0:00:38
898500 -- [-2206.744] (-2207.436) (-2211.724) (-2214.090) * (-2211.007) (-2213.061) (-2202.477) [-2199.793] -- 0:00:38
899000 -- [-2206.996] (-2208.493) (-2202.811) (-2214.586) * (-2211.435) (-2217.429) (-2209.377) [-2205.455] -- 0:00:37
899500 -- (-2212.345) (-2210.470) (-2203.108) [-2206.891] * (-2203.422) [-2211.497] (-2210.269) (-2201.751) -- 0:00:37
900000 -- [-2203.718] (-2204.882) (-2202.555) (-2207.275) * (-2217.212) (-2208.809) [-2203.807] (-2206.701) -- 0:00:37
Average standard deviation of split frequencies: 0.004274
900500 -- (-2207.784) (-2202.966) (-2209.342) [-2204.332] * (-2205.433) (-2215.044) [-2208.603] (-2209.744) -- 0:00:37
901000 -- [-2206.200] (-2208.149) (-2201.722) (-2212.387) * [-2210.402] (-2210.704) (-2211.872) (-2205.469) -- 0:00:37
901500 -- (-2208.566) (-2201.214) (-2205.187) [-2204.117] * (-2215.625) (-2212.978) [-2201.831] (-2207.956) -- 0:00:36
902000 -- (-2204.389) (-2207.301) [-2204.068] (-2207.561) * [-2204.753] (-2215.898) (-2203.303) (-2205.249) -- 0:00:36
902500 -- (-2200.513) (-2207.831) (-2203.306) [-2204.489] * (-2223.417) (-2210.351) [-2202.277] (-2203.095) -- 0:00:36
903000 -- (-2201.086) [-2205.965] (-2207.392) (-2215.273) * (-2226.142) (-2208.018) (-2206.357) [-2209.243] -- 0:00:36
903500 -- [-2202.807] (-2212.452) (-2208.916) (-2205.870) * (-2216.624) (-2213.821) [-2206.628] (-2201.083) -- 0:00:36
904000 -- (-2207.305) (-2208.528) (-2210.442) [-2203.175] * (-2213.793) [-2207.720] (-2208.038) (-2206.418) -- 0:00:36
904500 -- [-2213.167] (-2218.884) (-2203.824) (-2210.056) * (-2204.999) (-2206.021) [-2200.614] (-2209.112) -- 0:00:35
905000 -- (-2210.630) (-2206.492) (-2209.716) [-2204.795] * [-2200.555] (-2209.561) (-2205.475) (-2217.510) -- 0:00:35
Average standard deviation of split frequencies: 0.004757
905500 -- (-2209.944) (-2212.443) (-2205.327) [-2218.287] * (-2206.944) [-2212.522] (-2211.530) (-2209.978) -- 0:00:35
906000 -- (-2207.742) (-2203.168) [-2207.569] (-2201.354) * (-2202.014) (-2214.649) [-2207.522] (-2200.775) -- 0:00:35
906500 -- (-2209.595) (-2209.466) [-2210.731] (-2203.374) * (-2204.408) [-2201.818] (-2209.106) (-2207.776) -- 0:00:35
907000 -- (-2216.253) (-2209.531) (-2217.168) [-2204.033] * (-2213.192) (-2200.999) (-2209.898) [-2205.889] -- 0:00:34
907500 -- (-2213.018) (-2208.310) [-2199.803] (-2213.058) * [-2202.155] (-2205.935) (-2203.126) (-2217.034) -- 0:00:34
908000 -- (-2215.441) (-2205.023) [-2205.979] (-2201.663) * [-2209.634] (-2207.170) (-2211.097) (-2205.127) -- 0:00:34
908500 -- (-2209.910) [-2208.590] (-2204.296) (-2202.824) * [-2203.683] (-2214.538) (-2202.639) (-2212.613) -- 0:00:34
909000 -- (-2214.547) (-2213.670) (-2205.002) [-2203.739] * [-2212.695] (-2204.316) (-2201.195) (-2223.687) -- 0:00:34
909500 -- (-2213.693) (-2210.229) (-2205.478) [-2205.066] * (-2207.245) [-2206.661] (-2210.495) (-2207.391) -- 0:00:33
910000 -- (-2216.016) (-2205.819) [-2204.253] (-2219.630) * (-2207.918) (-2205.020) (-2203.093) [-2206.114] -- 0:00:33
Average standard deviation of split frequencies: 0.004363
910500 -- (-2203.101) [-2208.787] (-2206.459) (-2224.406) * (-2210.322) (-2214.615) [-2207.062] (-2206.515) -- 0:00:33
911000 -- [-2205.626] (-2209.951) (-2215.760) (-2203.628) * (-2212.110) (-2207.225) (-2201.882) [-2206.702] -- 0:00:33
911500 -- (-2208.290) [-2209.058] (-2207.410) (-2216.995) * [-2202.278] (-2208.390) (-2205.537) (-2210.404) -- 0:00:33
912000 -- [-2197.794] (-2212.743) (-2216.700) (-2218.653) * [-2204.835] (-2207.929) (-2204.122) (-2213.866) -- 0:00:33
912500 -- (-2208.194) (-2207.913) [-2208.506] (-2210.179) * (-2204.333) (-2206.215) [-2206.860] (-2207.094) -- 0:00:32
913000 -- (-2213.181) (-2208.324) [-2211.956] (-2203.184) * [-2206.634] (-2209.316) (-2207.835) (-2204.533) -- 0:00:32
913500 -- (-2207.854) [-2209.248] (-2200.362) (-2199.674) * [-2202.473] (-2208.037) (-2208.884) (-2207.238) -- 0:00:32
914000 -- (-2209.700) [-2213.392] (-2206.178) (-2200.951) * (-2203.694) (-2207.079) (-2203.637) [-2198.466] -- 0:00:32
914500 -- [-2212.879] (-2215.104) (-2202.157) (-2207.281) * (-2206.375) [-2202.746] (-2202.080) (-2210.494) -- 0:00:32
915000 -- (-2202.499) (-2206.335) [-2205.222] (-2203.680) * [-2207.386] (-2209.240) (-2202.292) (-2204.190) -- 0:00:31
Average standard deviation of split frequencies: 0.004338
915500 -- (-2210.197) [-2207.232] (-2202.068) (-2206.903) * (-2206.754) [-2207.482] (-2219.056) (-2209.881) -- 0:00:31
916000 -- (-2206.734) (-2211.012) (-2219.081) [-2210.642] * (-2211.422) [-2206.844] (-2224.126) (-2223.704) -- 0:00:31
916500 -- (-2205.037) (-2207.224) (-2212.405) [-2209.429] * (-2204.369) (-2208.820) (-2209.938) [-2219.363] -- 0:00:31
917000 -- (-2209.798) (-2208.901) (-2204.412) [-2204.767] * [-2207.245] (-2204.409) (-2206.878) (-2212.268) -- 0:00:31
917500 -- [-2206.758] (-2210.495) (-2209.121) (-2202.255) * [-2200.755] (-2208.530) (-2209.215) (-2208.273) -- 0:00:30
918000 -- [-2209.033] (-2203.711) (-2203.351) (-2204.611) * [-2206.197] (-2207.731) (-2204.363) (-2207.616) -- 0:00:30
918500 -- (-2210.554) (-2208.455) [-2207.789] (-2209.788) * (-2199.414) [-2209.807] (-2208.203) (-2209.245) -- 0:00:30
919000 -- (-2207.555) [-2206.285] (-2202.092) (-2221.785) * (-2199.896) (-2211.917) (-2210.447) [-2215.774] -- 0:00:30
919500 -- [-2205.070] (-2207.653) (-2210.984) (-2205.705) * (-2205.062) (-2207.230) [-2202.126] (-2211.330) -- 0:00:30
920000 -- (-2215.674) [-2200.912] (-2204.612) (-2208.008) * [-2207.888] (-2220.506) (-2207.950) (-2212.877) -- 0:00:30
Average standard deviation of split frequencies: 0.004389
920500 -- (-2207.272) [-2207.135] (-2202.347) (-2210.781) * [-2200.335] (-2202.518) (-2206.440) (-2204.881) -- 0:00:29
921000 -- (-2204.044) (-2200.508) [-2210.724] (-2210.589) * (-2200.695) (-2207.036) [-2204.717] (-2203.254) -- 0:00:29
921500 -- (-2207.773) [-2201.439] (-2216.848) (-2214.269) * [-2201.854] (-2204.789) (-2207.181) (-2211.454) -- 0:00:29
922000 -- (-2210.952) (-2209.185) (-2207.880) [-2211.439] * (-2208.348) [-2204.074] (-2208.520) (-2206.449) -- 0:00:29
922500 -- (-2209.836) [-2202.974] (-2207.358) (-2208.097) * (-2211.846) (-2215.506) (-2212.773) [-2208.123] -- 0:00:29
923000 -- (-2209.658) (-2216.769) (-2207.310) [-2203.175] * [-2205.500] (-2201.264) (-2210.489) (-2207.596) -- 0:00:28
923500 -- (-2209.771) (-2205.317) [-2201.931] (-2203.305) * (-2206.101) (-2217.486) (-2210.764) [-2203.745] -- 0:00:28
924000 -- (-2214.433) [-2211.066] (-2210.970) (-2207.480) * (-2204.293) (-2214.964) (-2209.483) [-2204.771] -- 0:00:28
924500 -- [-2209.984] (-2211.110) (-2206.835) (-2204.292) * [-2207.984] (-2208.937) (-2206.905) (-2205.459) -- 0:00:28
925000 -- (-2212.224) (-2203.559) [-2207.587] (-2208.138) * (-2226.919) [-2205.105] (-2204.640) (-2208.585) -- 0:00:28
Average standard deviation of split frequencies: 0.003854
925500 -- (-2204.758) [-2207.423] (-2201.744) (-2204.090) * (-2209.981) (-2204.170) (-2206.638) [-2203.932] -- 0:00:27
926000 -- (-2213.282) [-2205.318] (-2205.006) (-2212.946) * [-2209.648] (-2207.027) (-2201.642) (-2204.183) -- 0:00:27
926500 -- (-2208.393) [-2201.390] (-2207.390) (-2209.212) * [-2206.186] (-2203.530) (-2207.204) (-2204.741) -- 0:00:27
927000 -- (-2213.953) (-2206.503) (-2205.569) [-2208.490] * (-2206.523) (-2208.880) (-2212.247) [-2202.305] -- 0:00:27
927500 -- [-2212.655] (-2212.094) (-2206.729) (-2207.647) * [-2201.787] (-2205.386) (-2202.549) (-2206.018) -- 0:00:27
928000 -- (-2217.997) [-2202.881] (-2206.012) (-2206.702) * (-2204.146) (-2210.177) (-2201.728) [-2208.977] -- 0:00:27
928500 -- (-2205.765) (-2208.085) (-2211.586) [-2204.330] * [-2210.274] (-2212.627) (-2215.212) (-2202.974) -- 0:00:26
929000 -- (-2206.702) (-2207.650) [-2204.051] (-2207.099) * [-2202.445] (-2213.303) (-2199.567) (-2207.333) -- 0:00:26
929500 -- [-2205.811] (-2209.136) (-2205.688) (-2207.213) * (-2201.814) [-2207.216] (-2202.474) (-2208.303) -- 0:00:26
930000 -- [-2203.242] (-2210.934) (-2206.407) (-2219.189) * (-2216.941) (-2207.893) [-2210.243] (-2210.461) -- 0:00:26
Average standard deviation of split frequencies: 0.003690
930500 -- (-2214.942) (-2205.413) (-2208.317) [-2205.171] * [-2205.347] (-2206.178) (-2210.625) (-2205.237) -- 0:00:26
931000 -- (-2205.331) [-2207.232] (-2202.831) (-2206.589) * (-2202.114) (-2214.095) [-2202.318] (-2201.138) -- 0:00:25
931500 -- (-2206.263) (-2209.478) (-2207.691) [-2204.184] * [-2201.251] (-2201.674) (-2204.727) (-2210.479) -- 0:00:25
932000 -- (-2202.654) [-2212.966] (-2211.671) (-2204.900) * (-2204.979) [-2207.317] (-2209.092) (-2208.944) -- 0:00:25
932500 -- (-2203.881) (-2206.398) (-2209.928) [-2200.462] * (-2209.079) (-2212.414) [-2207.606] (-2207.431) -- 0:00:25
933000 -- [-2207.263] (-2204.523) (-2202.462) (-2208.603) * (-2202.419) [-2204.224] (-2199.394) (-2211.928) -- 0:00:25
933500 -- (-2220.782) (-2211.364) [-2213.644] (-2212.706) * (-2202.355) (-2209.157) (-2208.138) [-2207.772] -- 0:00:24
934000 -- [-2209.584] (-2205.517) (-2208.691) (-2206.520) * (-2204.136) [-2204.399] (-2206.772) (-2214.322) -- 0:00:24
934500 -- (-2207.365) [-2201.595] (-2204.039) (-2207.305) * [-2204.693] (-2213.472) (-2205.125) (-2204.063) -- 0:00:24
935000 -- (-2203.609) (-2198.905) [-2206.575] (-2207.137) * (-2206.958) (-2204.746) [-2206.991] (-2205.771) -- 0:00:24
Average standard deviation of split frequencies: 0.003957
935500 -- (-2213.756) [-2201.090] (-2204.351) (-2212.240) * (-2205.081) (-2204.103) [-2205.561] (-2214.181) -- 0:00:24
936000 -- (-2206.506) (-2208.403) [-2201.210] (-2204.231) * (-2211.533) (-2218.263) (-2207.965) [-2201.565] -- 0:00:24
936500 -- (-2210.643) [-2204.881] (-2200.584) (-2206.734) * [-2214.633] (-2210.752) (-2216.466) (-2202.409) -- 0:00:23
937000 -- [-2206.819] (-2201.979) (-2207.753) (-2213.089) * (-2214.879) (-2205.808) [-2206.750] (-2208.471) -- 0:00:23
937500 -- (-2209.927) (-2208.122) [-2200.349] (-2211.398) * (-2218.615) (-2199.789) (-2211.813) [-2204.451] -- 0:00:23
938000 -- (-2211.648) (-2211.348) [-2205.095] (-2204.750) * (-2209.829) [-2204.553] (-2213.167) (-2201.625) -- 0:00:23
938500 -- [-2207.163] (-2218.202) (-2207.568) (-2207.985) * [-2218.076] (-2212.843) (-2204.270) (-2209.798) -- 0:00:23
939000 -- (-2211.538) (-2204.656) (-2211.720) [-2205.999] * (-2209.917) (-2211.874) (-2221.580) [-2207.065] -- 0:00:22
939500 -- (-2202.847) [-2205.910] (-2214.765) (-2205.388) * (-2210.802) (-2217.818) (-2200.590) [-2208.564] -- 0:00:22
940000 -- (-2202.623) [-2208.164] (-2211.166) (-2204.118) * [-2206.373] (-2208.466) (-2205.166) (-2208.646) -- 0:00:22
Average standard deviation of split frequencies: 0.004224
940500 -- (-2202.924) (-2209.838) (-2211.044) [-2212.080] * (-2212.825) (-2212.301) [-2202.813] (-2204.306) -- 0:00:22
941000 -- [-2204.305] (-2212.759) (-2208.719) (-2207.473) * (-2210.124) (-2217.685) [-2204.581] (-2204.954) -- 0:00:22
941500 -- [-2202.723] (-2203.042) (-2206.264) (-2206.067) * (-2206.668) (-2203.125) [-2205.755] (-2209.804) -- 0:00:21
942000 -- (-2203.899) (-2208.160) (-2202.304) [-2209.817] * (-2208.023) (-2204.479) [-2206.793] (-2204.204) -- 0:00:21
942500 -- [-2206.756] (-2207.513) (-2207.123) (-2205.937) * (-2207.099) [-2205.283] (-2206.016) (-2210.426) -- 0:00:21
943000 -- (-2208.763) [-2203.058] (-2207.917) (-2201.835) * [-2205.213] (-2214.977) (-2218.977) (-2219.452) -- 0:00:21
943500 -- [-2212.125] (-2207.464) (-2217.954) (-2206.868) * [-2208.817] (-2207.341) (-2208.897) (-2207.859) -- 0:00:21
944000 -- (-2213.122) (-2208.901) (-2204.838) [-2201.580] * (-2199.398) (-2212.010) (-2204.824) [-2206.916] -- 0:00:21
944500 -- [-2209.376] (-2218.835) (-2207.031) (-2214.505) * [-2202.461] (-2208.344) (-2204.662) (-2214.339) -- 0:00:20
945000 -- (-2213.609) (-2212.331) [-2200.748] (-2215.457) * [-2202.777] (-2203.332) (-2203.962) (-2202.055) -- 0:00:20
Average standard deviation of split frequencies: 0.004414
945500 -- (-2209.037) (-2206.852) [-2206.290] (-2205.961) * [-2206.642] (-2208.054) (-2207.784) (-2204.780) -- 0:00:20
946000 -- (-2204.637) (-2204.710) (-2203.817) [-2211.471] * (-2204.223) (-2211.233) (-2205.107) [-2197.098] -- 0:00:20
946500 -- (-2214.081) [-2207.980] (-2206.815) (-2203.141) * (-2211.947) (-2211.317) (-2205.518) [-2203.644] -- 0:00:20
947000 -- (-2209.192) [-2210.880] (-2209.981) (-2204.190) * (-2208.342) (-2213.292) (-2218.508) [-2201.149] -- 0:00:19
947500 -- (-2210.351) [-2203.929] (-2207.477) (-2204.925) * (-2202.244) (-2208.293) (-2204.622) [-2207.285] -- 0:00:19
948000 -- (-2212.547) (-2210.762) [-2204.891] (-2206.494) * (-2211.932) [-2205.890] (-2208.467) (-2208.187) -- 0:00:19
948500 -- [-2208.019] (-2206.357) (-2199.909) (-2209.811) * (-2208.149) (-2215.135) (-2211.736) [-2204.103] -- 0:00:19
949000 -- (-2214.664) [-2207.872] (-2208.469) (-2207.109) * (-2201.440) (-2205.807) (-2213.247) [-2205.638] -- 0:00:19
949500 -- (-2216.969) (-2209.847) (-2211.744) [-2205.064] * [-2202.083] (-2204.257) (-2205.060) (-2203.702) -- 0:00:18
950000 -- [-2202.141] (-2204.567) (-2213.483) (-2201.425) * (-2213.266) [-2207.002] (-2209.778) (-2207.041) -- 0:00:18
Average standard deviation of split frequencies: 0.004817
950500 -- (-2216.508) (-2206.632) [-2205.631] (-2203.642) * (-2207.107) (-2210.392) (-2212.801) [-2206.325] -- 0:00:18
951000 -- (-2205.395) (-2220.218) (-2212.479) [-2204.067] * (-2208.836) (-2201.228) [-2203.182] (-2213.377) -- 0:00:18
951500 -- (-2204.360) (-2207.644) (-2212.306) [-2205.459] * (-2214.859) [-2205.312] (-2204.273) (-2207.244) -- 0:00:18
952000 -- [-2204.281] (-2210.445) (-2208.464) (-2202.371) * (-2207.019) (-2208.895) (-2212.346) [-2209.917] -- 0:00:18
952500 -- (-2202.027) [-2207.687] (-2205.445) (-2208.018) * (-2204.499) (-2205.955) (-2209.483) [-2208.191] -- 0:00:17
953000 -- (-2203.617) (-2200.207) (-2204.720) [-2200.723] * (-2200.806) [-2211.608] (-2200.320) (-2213.741) -- 0:00:17
953500 -- (-2218.879) (-2204.466) [-2210.696] (-2204.145) * (-2201.698) (-2207.817) [-2208.329] (-2210.140) -- 0:00:17
954000 -- (-2210.216) [-2203.533] (-2207.349) (-2215.596) * (-2205.481) (-2220.283) (-2214.020) [-2205.030] -- 0:00:17
954500 -- (-2205.706) (-2209.434) (-2200.873) [-2207.635] * [-2206.627] (-2208.592) (-2210.917) (-2211.340) -- 0:00:17
955000 -- [-2201.861] (-2204.151) (-2206.651) (-2201.021) * (-2204.624) (-2212.519) (-2206.919) [-2207.819] -- 0:00:16
Average standard deviation of split frequencies: 0.004438
955500 -- [-2204.119] (-2202.623) (-2208.512) (-2214.682) * (-2212.514) (-2215.922) (-2205.206) [-2201.873] -- 0:00:16
956000 -- [-2198.901] (-2204.919) (-2208.659) (-2209.059) * [-2210.953] (-2205.695) (-2206.010) (-2210.465) -- 0:00:16
956500 -- (-2204.270) (-2209.547) [-2205.368] (-2211.898) * [-2206.095] (-2207.921) (-2212.416) (-2205.920) -- 0:00:16
957000 -- (-2209.930) (-2216.977) (-2205.538) [-2207.206] * [-2202.523] (-2209.761) (-2218.512) (-2213.072) -- 0:00:16
957500 -- (-2209.999) (-2210.187) (-2214.214) [-2206.017] * [-2203.746] (-2211.301) (-2210.238) (-2207.448) -- 0:00:15
958000 -- (-2204.243) (-2215.833) (-2210.741) [-2207.454] * (-2209.905) (-2202.038) (-2205.494) [-2203.989] -- 0:00:15
958500 -- (-2203.013) [-2204.681] (-2216.426) (-2204.176) * (-2212.290) (-2201.337) [-2201.767] (-2210.951) -- 0:00:15
959000 -- (-2202.612) (-2209.769) (-2213.106) [-2205.977] * (-2213.242) (-2209.694) (-2203.415) [-2208.428] -- 0:00:15
959500 -- (-2204.035) [-2205.860] (-2220.265) (-2206.899) * (-2203.452) (-2206.598) [-2201.146] (-2206.466) -- 0:00:15
960000 -- (-2203.987) [-2205.957] (-2207.270) (-2208.770) * (-2208.958) (-2205.604) (-2214.982) [-2204.097] -- 0:00:15
Average standard deviation of split frequencies: 0.004486
960500 -- (-2207.662) (-2204.451) (-2224.321) [-2218.087] * (-2215.785) (-2211.434) (-2206.523) [-2206.554] -- 0:00:14
961000 -- (-2207.735) (-2200.827) (-2206.550) [-2209.046] * (-2208.154) (-2208.792) (-2204.393) [-2205.223] -- 0:00:14
961500 -- (-2205.481) (-2209.268) (-2222.052) [-2202.153] * (-2209.856) (-2204.169) (-2201.556) [-2200.558] -- 0:00:14
962000 -- (-2205.423) [-2210.880] (-2209.605) (-2207.674) * (-2203.583) [-2205.276] (-2211.059) (-2224.949) -- 0:00:14
962500 -- (-2216.133) (-2211.376) [-2206.294] (-2218.493) * (-2208.248) (-2206.922) (-2212.178) [-2208.780] -- 0:00:14
963000 -- (-2205.274) (-2211.567) [-2208.275] (-2210.266) * (-2200.119) (-2205.156) (-2213.469) [-2202.865] -- 0:00:13
963500 -- (-2201.802) [-2212.092] (-2203.036) (-2205.761) * (-2214.206) (-2206.786) (-2201.710) [-2207.155] -- 0:00:13
964000 -- (-2208.210) (-2211.701) (-2210.090) [-2204.078] * (-2206.289) (-2203.139) [-2204.635] (-2202.156) -- 0:00:13
964500 -- [-2207.559] (-2206.721) (-2206.729) (-2208.075) * (-2204.715) (-2208.086) [-2211.352] (-2208.728) -- 0:00:13
965000 -- (-2212.431) (-2208.245) [-2206.964] (-2207.491) * (-2203.568) [-2211.510] (-2206.846) (-2206.697) -- 0:00:13
Average standard deviation of split frequencies: 0.004462
965500 -- [-2207.372] (-2209.557) (-2218.967) (-2202.997) * (-2207.995) (-2210.836) (-2221.054) [-2204.219] -- 0:00:12
966000 -- (-2211.538) [-2210.867] (-2214.707) (-2203.772) * (-2209.727) (-2217.599) [-2209.220] (-2212.823) -- 0:00:12
966500 -- [-2204.700] (-2210.993) (-2208.236) (-2216.493) * (-2216.920) [-2202.348] (-2207.063) (-2209.774) -- 0:00:12
967000 -- (-2199.347) (-2208.715) [-2207.246] (-2208.967) * (-2215.424) [-2205.909] (-2200.740) (-2210.229) -- 0:00:12
967500 -- (-2206.152) [-2208.856] (-2211.289) (-2211.835) * (-2209.533) (-2210.973) (-2201.192) [-2209.011] -- 0:00:12
968000 -- (-2212.260) (-2208.612) (-2214.655) [-2200.997] * (-2211.328) [-2205.362] (-2208.323) (-2202.581) -- 0:00:12
968500 -- (-2205.486) [-2211.917] (-2208.982) (-2199.973) * (-2217.727) [-2204.118] (-2206.526) (-2216.431) -- 0:00:11
969000 -- (-2215.856) (-2210.294) (-2207.488) [-2205.396] * [-2213.360] (-2211.903) (-2215.357) (-2209.939) -- 0:00:11
969500 -- (-2209.762) [-2208.260] (-2205.107) (-2211.009) * (-2207.427) [-2199.010] (-2198.622) (-2209.234) -- 0:00:11
970000 -- [-2202.716] (-2202.408) (-2202.859) (-2212.785) * (-2209.249) (-2213.038) (-2215.873) [-2203.450] -- 0:00:11
Average standard deviation of split frequencies: 0.004510
970500 -- (-2200.758) (-2206.129) (-2212.134) [-2209.595] * (-2207.013) [-2200.069] (-2204.771) (-2208.773) -- 0:00:11
971000 -- (-2205.677) (-2213.548) (-2206.879) [-2197.641] * (-2206.357) (-2208.876) (-2209.567) [-2205.702] -- 0:00:10
971500 -- [-2208.143] (-2210.009) (-2203.434) (-2207.835) * (-2212.445) (-2204.587) [-2208.970] (-2212.527) -- 0:00:10
972000 -- (-2207.208) (-2205.333) [-2206.579] (-2213.907) * [-2205.412] (-2212.245) (-2208.904) (-2216.775) -- 0:00:10
972500 -- (-2201.328) [-2208.605] (-2219.796) (-2203.939) * [-2212.606] (-2210.395) (-2217.939) (-2205.345) -- 0:00:10
973000 -- (-2201.270) [-2198.654] (-2207.576) (-2211.244) * (-2207.922) (-2209.355) [-2209.691] (-2201.876) -- 0:00:10
973500 -- (-2218.459) [-2211.404] (-2206.817) (-2206.196) * [-2205.554] (-2207.658) (-2209.980) (-2215.025) -- 0:00:09
974000 -- (-2207.248) (-2211.196) (-2208.485) [-2206.705] * [-2205.426] (-2200.568) (-2205.862) (-2219.761) -- 0:00:09
974500 -- [-2199.201] (-2208.181) (-2205.070) (-2209.640) * [-2210.915] (-2207.269) (-2203.554) (-2201.961) -- 0:00:09
975000 -- (-2203.959) (-2201.711) (-2209.990) [-2208.658] * (-2206.680) (-2208.347) (-2206.272) [-2202.232] -- 0:00:09
Average standard deviation of split frequencies: 0.004692
975500 -- (-2202.247) (-2210.006) (-2226.262) [-2213.678] * (-2207.209) (-2206.530) (-2207.599) [-2210.255] -- 0:00:09
976000 -- (-2203.709) (-2204.800) [-2212.021] (-2204.889) * (-2208.583) [-2203.599] (-2202.408) (-2216.490) -- 0:00:09
976500 -- (-2211.198) (-2206.254) [-2214.453] (-2201.338) * [-2211.608] (-2212.028) (-2204.875) (-2216.439) -- 0:00:08
977000 -- (-2203.954) (-2212.719) (-2207.243) [-2204.912] * (-2209.669) (-2211.888) [-2205.760] (-2207.963) -- 0:00:08
977500 -- (-2206.322) (-2206.646) (-2208.013) [-2199.590] * (-2205.987) [-2212.128] (-2212.579) (-2218.672) -- 0:00:08
978000 -- (-2206.210) (-2211.812) (-2202.708) [-2205.845] * (-2202.001) (-2209.427) (-2211.077) [-2203.798] -- 0:00:08
978500 -- (-2205.755) [-2207.422] (-2204.851) (-2203.391) * [-2210.020] (-2210.985) (-2202.021) (-2207.364) -- 0:00:08
979000 -- (-2212.251) [-2207.210] (-2208.499) (-2206.458) * [-2210.951] (-2206.158) (-2204.307) (-2213.620) -- 0:00:07
979500 -- (-2207.723) (-2210.015) (-2206.224) [-2206.334] * (-2209.698) (-2202.153) [-2203.957] (-2212.804) -- 0:00:07
980000 -- [-2203.631] (-2209.649) (-2211.398) (-2215.040) * (-2209.598) (-2199.383) [-2207.929] (-2213.867) -- 0:00:07
Average standard deviation of split frequencies: 0.005082
980500 -- (-2215.435) [-2209.540] (-2209.681) (-2202.900) * (-2212.197) [-2202.278] (-2212.067) (-2206.640) -- 0:00:07
981000 -- [-2205.694] (-2202.571) (-2206.105) (-2213.797) * (-2212.459) [-2205.020] (-2201.841) (-2200.694) -- 0:00:07
981500 -- (-2205.411) [-2206.340] (-2210.016) (-2201.515) * (-2214.252) [-2211.251] (-2207.633) (-2211.204) -- 0:00:06
982000 -- (-2205.939) [-2205.454] (-2205.642) (-2212.259) * (-2211.991) (-2207.729) (-2206.549) [-2204.866] -- 0:00:06
982500 -- (-2204.652) [-2202.591] (-2210.556) (-2207.610) * (-2218.218) [-2205.838] (-2199.365) (-2212.685) -- 0:00:06
983000 -- (-2204.723) (-2205.104) [-2216.800] (-2216.387) * (-2204.825) (-2210.347) (-2207.082) [-2199.400] -- 0:00:06
983500 -- [-2204.121] (-2202.220) (-2206.113) (-2209.844) * [-2206.822] (-2206.723) (-2204.227) (-2200.455) -- 0:00:06
984000 -- (-2219.257) [-2206.283] (-2212.787) (-2211.016) * (-2209.064) (-2205.435) (-2209.344) [-2210.079] -- 0:00:06
984500 -- [-2206.601] (-2209.560) (-2209.843) (-2211.432) * (-2211.576) (-2203.309) (-2205.950) [-2203.896] -- 0:00:05
985000 -- [-2206.011] (-2201.120) (-2213.572) (-2208.143) * [-2200.688] (-2207.386) (-2206.060) (-2206.892) -- 0:00:05
Average standard deviation of split frequencies: 0.004986
985500 -- (-2202.925) [-2205.948] (-2209.883) (-2206.165) * (-2212.271) (-2207.917) (-2211.308) [-2210.438] -- 0:00:05
986000 -- [-2209.571] (-2204.108) (-2207.983) (-2202.413) * (-2210.701) [-2202.503] (-2213.050) (-2209.422) -- 0:00:05
986500 -- (-2216.219) [-2212.504] (-2204.496) (-2198.320) * (-2205.380) [-2208.872] (-2202.196) (-2201.256) -- 0:00:05
987000 -- (-2209.678) (-2225.627) (-2208.689) [-2206.994] * (-2198.963) (-2203.562) (-2212.587) [-2205.225] -- 0:00:04
987500 -- (-2211.122) (-2220.044) [-2206.954] (-2208.384) * [-2203.423] (-2202.880) (-2207.365) (-2208.804) -- 0:00:04
988000 -- [-2204.235] (-2206.163) (-2204.780) (-2207.020) * (-2211.308) (-2208.855) (-2205.714) [-2209.795] -- 0:00:04
988500 -- (-2197.202) (-2202.345) [-2205.455] (-2209.124) * (-2209.250) (-2200.389) [-2207.493] (-2204.904) -- 0:00:04
989000 -- (-2210.450) [-2197.816] (-2206.699) (-2206.220) * (-2213.288) [-2203.581] (-2206.613) (-2213.162) -- 0:00:04
989500 -- [-2202.769] (-2210.319) (-2209.000) (-2209.092) * [-2207.091] (-2209.556) (-2209.758) (-2211.727) -- 0:00:03
990000 -- [-2210.346] (-2203.543) (-2213.733) (-2201.781) * (-2213.166) (-2205.127) [-2210.520] (-2211.045) -- 0:00:03
Average standard deviation of split frequencies: 0.004826
990500 -- [-2204.455] (-2207.368) (-2212.584) (-2211.356) * (-2201.690) [-2207.702] (-2213.104) (-2203.392) -- 0:00:03
991000 -- [-2209.294] (-2214.824) (-2208.218) (-2210.843) * (-2204.270) (-2213.041) (-2207.083) [-2203.418] -- 0:00:03
991500 -- (-2215.026) [-2208.702] (-2203.547) (-2204.233) * (-2212.008) (-2219.687) [-2207.671] (-2209.356) -- 0:00:03
992000 -- (-2210.136) (-2209.177) (-2206.044) [-2207.629] * (-2201.994) (-2214.897) [-2211.693] (-2202.615) -- 0:00:03
992500 -- (-2215.423) (-2210.173) [-2204.353] (-2214.084) * (-2203.932) (-2208.777) (-2210.529) [-2209.882] -- 0:00:02
993000 -- (-2210.433) (-2202.506) (-2204.222) [-2203.594] * [-2200.884] (-2208.216) (-2203.282) (-2207.959) -- 0:00:02
993500 -- (-2205.358) (-2207.230) [-2213.866] (-2207.004) * [-2212.519] (-2209.922) (-2203.138) (-2204.354) -- 0:00:02
994000 -- [-2203.510] (-2202.790) (-2209.327) (-2210.307) * (-2212.822) (-2204.029) (-2203.592) [-2205.960] -- 0:00:02
994500 -- (-2200.827) [-2209.781] (-2205.182) (-2209.236) * (-2216.564) (-2215.794) [-2201.186] (-2204.794) -- 0:00:02
995000 -- (-2207.004) (-2207.377) (-2203.337) [-2207.374] * (-2210.860) [-2202.800] (-2214.291) (-2206.595) -- 0:00:01
Average standard deviation of split frequencies: 0.004260
995500 -- (-2210.131) (-2202.464) [-2202.610] (-2208.456) * (-2203.390) (-2201.668) (-2208.384) [-2201.747] -- 0:00:01
996000 -- (-2212.155) (-2207.227) [-2202.830] (-2208.042) * (-2204.257) [-2206.015] (-2206.092) (-2201.125) -- 0:00:01
996500 -- (-2205.003) (-2213.487) (-2203.560) [-2206.088] * (-2200.630) (-2207.512) [-2203.877] (-2211.837) -- 0:00:01
997000 -- (-2205.594) (-2204.600) [-2207.561] (-2210.592) * (-2204.248) (-2204.171) (-2207.718) [-2201.484] -- 0:00:01
997500 -- (-2215.818) (-2211.264) (-2208.193) [-2205.249] * (-2215.439) (-2211.398) [-2201.607] (-2205.056) -- 0:00:00
998000 -- (-2204.504) [-2212.760] (-2201.942) (-2205.102) * [-2208.455] (-2203.664) (-2206.695) (-2206.561) -- 0:00:00
998500 -- (-2200.930) (-2212.177) [-2202.391] (-2209.755) * [-2207.892] (-2204.667) (-2211.668) (-2203.170) -- 0:00:00
999000 -- (-2199.464) (-2213.026) [-2202.346] (-2205.884) * (-2208.430) (-2206.901) [-2203.377] (-2206.807) -- 0:00:00
999500 -- [-2202.484] (-2206.495) (-2205.883) (-2201.794) * (-2201.514) (-2200.091) [-2204.698] (-2208.883) -- 0:00:00
1000000 -- (-2215.890) (-2211.744) (-2206.223) [-2212.824] * (-2202.373) (-2210.522) (-2199.302) [-2206.717] -- 0:00:00
Average standard deviation of split frequencies: 0.004173
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2215.889689 -- 14.620780
Chain 1 -- -2215.889689 -- 14.620780
Chain 2 -- -2211.743573 -- 14.445327
Chain 2 -- -2211.743579 -- 14.445327
Chain 3 -- -2206.223082 -- 11.055070
Chain 3 -- -2206.223078 -- 11.055070
Chain 4 -- -2212.824039 -- 13.186258
Chain 4 -- -2212.824031 -- 13.186258
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2202.372769 -- 9.341864
Chain 1 -- -2202.372781 -- 9.341864
Chain 2 -- -2210.522014 -- 12.545394
Chain 2 -- -2210.522014 -- 12.545394
Chain 3 -- -2199.301639 -- 8.250629
Chain 3 -- -2199.301650 -- 8.250629
Chain 4 -- -2206.717233 -- 10.679175
Chain 4 -- -2206.717198 -- 10.679175
Analysis completed in 6 mins 15 seconds
Analysis used 374.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2195.43
Likelihood of best state for "cold" chain of run 2 was -2195.40
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
43.5 % ( 26 %) Dirichlet(Revmat{all})
58.3 % ( 44 %) Slider(Revmat{all})
26.1 % ( 22 %) Dirichlet(Pi{all})
27.9 % ( 27 %) Slider(Pi{all})
30.3 % ( 24 %) Multiplier(Alpha{1,2})
42.5 % ( 23 %) Multiplier(Alpha{3})
55.4 % ( 29 %) Slider(Pinvar{all})
4.8 % ( 4 %) ExtSPR(Tau{all},V{all})
2.1 % ( 4 %) ExtTBR(Tau{all},V{all})
8.3 % ( 3 %) NNI(Tau{all},V{all})
11.7 % ( 5 %) ParsSPR(Tau{all},V{all})
26.2 % ( 27 %) Multiplier(V{all})
33.4 % ( 33 %) Nodeslider(V{all})
25.3 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
42.1 % ( 28 %) Dirichlet(Revmat{all})
58.9 % ( 39 %) Slider(Revmat{all})
26.2 % ( 19 %) Dirichlet(Pi{all})
28.1 % ( 26 %) Slider(Pi{all})
30.2 % ( 21 %) Multiplier(Alpha{1,2})
42.8 % ( 29 %) Multiplier(Alpha{3})
55.5 % ( 21 %) Slider(Pinvar{all})
4.9 % ( 4 %) ExtSPR(Tau{all},V{all})
2.1 % ( 2 %) ExtTBR(Tau{all},V{all})
8.4 % ( 7 %) NNI(Tau{all},V{all})
11.7 % ( 9 %) ParsSPR(Tau{all},V{all})
26.1 % ( 26 %) Multiplier(V{all})
33.3 % ( 27 %) Nodeslider(V{all})
25.3 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 167264 0.81 0.65
3 | 166560 166903 0.83
4 | 166607 166090 166576
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166961 0.81 0.65
3 | 167146 166657 0.83
4 | 166042 166785 166409
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2204.63
|1 1 1 |
| 1 1 2 2 |
| 1 * 2 |
| 2 2 1 21 2 2 21 2 |
| 1 * 1 1 * 1 * 2 1 |
|2 2 2 2 1 2 2 2 2 2 |
| 2 2 1 1 1 1 1 2*2* 1 2|
| 21 2 11 2 2 2 1|
| 2 1 1 1 *1 11 2 2 |
| 1 2 1 22 22 2 1 22 1 1 1 1 |
| 2 2 1 2 1 2 |
| 11 1 2 11 2 2 2 |
| 2 2 1 |
| 2 1 *1 |
| 1 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2207.56
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2201.90 -2213.60
2 -2201.35 -2213.73
--------------------------------------
TOTAL -2201.59 -2213.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.040635 0.011452 0.840110 1.246018 1.033238 1372.71 1436.86 1.000
r(A<->C){all} 0.101926 0.000595 0.055820 0.149099 0.100420 877.08 911.30 1.000
r(A<->G){all} 0.194201 0.001132 0.134537 0.264303 0.192478 967.17 1008.60 1.000
r(A<->T){all} 0.057923 0.000319 0.025407 0.093423 0.055980 1070.98 1126.08 1.000
r(C<->G){all} 0.118431 0.000568 0.074782 0.165582 0.117221 1016.93 1045.20 1.000
r(C<->T){all} 0.482484 0.002146 0.393977 0.574789 0.482622 572.70 760.02 1.000
r(G<->T){all} 0.045036 0.000219 0.018194 0.074494 0.043798 1111.89 1188.38 1.000
pi(A){all} 0.270153 0.000268 0.241047 0.304931 0.270064 1182.04 1213.37 1.001
pi(C){all} 0.205427 0.000196 0.180047 0.233705 0.205243 1215.79 1228.38 1.000
pi(G){all} 0.266255 0.000260 0.235363 0.297851 0.266014 874.08 879.19 1.000
pi(T){all} 0.258166 0.000238 0.228124 0.288573 0.257535 761.97 957.31 1.000
alpha{1,2} 0.144688 0.000617 0.099034 0.195907 0.142201 1254.30 1288.64 1.000
alpha{3} 2.647721 0.749523 1.149993 4.329523 2.529012 1370.19 1410.54 1.000
pinvar{all} 0.206694 0.004824 0.066039 0.338086 0.209481 1267.55 1284.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .....***
10 -- ...**...
11 -- ...*****
12 -- .....**.
13 -- .**.....
14 -- ..******
15 -- .*.*****
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 2930 0.976016 0.000942 0.975350 0.976682 2
11 2916 0.971352 0.004711 0.968021 0.974684 2
12 2869 0.955696 0.009893 0.948701 0.962692 2
13 2354 0.784144 0.006595 0.779480 0.788807 2
14 311 0.103598 0.000471 0.103264 0.103931 2
15 298 0.099267 0.006595 0.094604 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.038244 0.000122 0.018229 0.059673 0.037010 1.000 2
length{all}[2] 0.019277 0.000050 0.006660 0.033148 0.018376 1.000 2
length{all}[3] 0.011889 0.000030 0.002817 0.022835 0.011077 1.000 2
length{all}[4] 0.085161 0.000396 0.048531 0.126255 0.083642 1.000 2
length{all}[5] 0.110923 0.000525 0.065846 0.154466 0.109296 1.000 2
length{all}[6] 0.110762 0.000903 0.056984 0.169074 0.108344 1.001 2
length{all}[7] 0.186609 0.001526 0.111555 0.262103 0.183092 1.000 2
length{all}[8] 0.190197 0.001605 0.121222 0.274780 0.186758 1.001 2
length{all}[9] 0.167935 0.001470 0.099255 0.242789 0.165096 1.000 2
length{all}[10] 0.031198 0.000227 0.004414 0.059417 0.029599 1.000 2
length{all}[11] 0.026194 0.000167 0.002055 0.050535 0.024687 1.002 2
length{all}[12] 0.058380 0.000675 0.013215 0.112000 0.055853 1.000 2
length{all}[13] 0.007434 0.000029 0.000017 0.018302 0.006316 1.003 2
length{all}[14] 0.002651 0.000007 0.000009 0.007773 0.001903 1.008 2
length{all}[15] 0.002830 0.000008 0.000013 0.008927 0.001920 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004173
Maximum standard deviation of split frequencies = 0.009893
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------ C4 (4)
| /-----------------98----------------+
| | \------------------ C5 (5)
| |
|--------97-------+ /------------------ C6 (6)
+ | /--------96-------+
| | | \------------------ C7 (7)
| \-------100-------+
| \------------------------------------ C8 (8)
|
| /------------------ C2 (2)
\--------------------------78-------------------------+
\------------------ C3 (3)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
| /-------------- C4 (4)
| /----+
| | \------------------ C5 (5)
| |
|---+ /------------------ C6 (6)
+ | /--------+
| | | \------------------------------- C7 (7)
| \---------------------------+
| \------------------------------- C8 (8)
|
|/--- C2 (2)
\+
\-- C3 (3)
|---------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (27 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 6 trees
99 % credible set contains 16 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 8 ls = 630
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sequences read..
Counting site patterns.. 0:00
172 patterns at 210 / 210 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
167872 bytes for conP
23392 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
503616 bytes for conP, adjusted
0.043012 0.000000 0.111011 0.109719 0.157375 0.275504 0.045568 0.102453 0.236234 0.186698 0.041754 0.028109 0.032841 0.300000 1.300000
ntime & nrate & np: 13 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 15
lnL0 = -2510.876023
Iterating by ming2
Initial: fx= 2510.876023
x= 0.04301 0.00000 0.11101 0.10972 0.15738 0.27550 0.04557 0.10245 0.23623 0.18670 0.04175 0.02811 0.03284 0.30000 1.30000
1 h-m-p 0.0000 0.0004 2481.2009 +YCYCCC 2500.002920 5 0.0000 29 | 0/15
2 h-m-p 0.0001 0.0004 468.7310 +YCYYYYC 2452.255481 6 0.0003 55 | 0/15
3 h-m-p 0.0000 0.0000 2950.0622 +CYYC 2438.809837 3 0.0000 78 | 0/15
4 h-m-p 0.0000 0.0000 18597.9908 +CYCCC 2381.940643 4 0.0000 104 | 0/15
5 h-m-p 0.0002 0.0008 676.4439 +CYYCCC 2333.170677 5 0.0007 131 | 0/15
6 h-m-p 0.0001 0.0005 1107.8173 +YYCYCCCC 2294.931598 7 0.0004 161 | 0/15
7 h-m-p 0.0001 0.0004 1305.0858 ++ 2203.898167 m 0.0004 179 | 0/15
8 h-m-p 0.0000 0.0001 3362.3250 +YCYCCC 2182.103989 5 0.0000 207 | 0/15
9 h-m-p 0.0001 0.0007 359.5718 CCCC 2181.379328 3 0.0000 231 | 0/15
10 h-m-p 0.0002 0.0090 49.6781 +CYC 2180.091952 2 0.0011 253 | 0/15
11 h-m-p 0.0017 0.0087 15.7582 YCCC 2179.912604 3 0.0012 276 | 0/15
12 h-m-p 0.0065 0.1824 2.7890 +CCC 2178.717873 2 0.0221 299 | 0/15
13 h-m-p 0.0057 0.0388 10.8907 +CYYCCC 2150.655296 5 0.0286 326 | 0/15
14 h-m-p 0.0001 0.0007 216.6412 +YYCYCC 2139.825281 5 0.0005 352 | 0/15
15 h-m-p 0.0019 0.0144 52.8829 CYCCC 2137.729035 4 0.0016 377 | 0/15
16 h-m-p 0.0326 0.1632 1.7906 CCCCC 2135.177747 4 0.0441 403 | 0/15
17 h-m-p 0.0048 0.0662 16.5674 +CCCC 2107.263643 3 0.0242 428 | 0/15
18 h-m-p 0.1211 0.6053 0.3311 +YYYCCC 2091.127684 5 0.4488 454 | 0/15
19 h-m-p 0.3922 1.9609 0.0998 CCCCC 2088.182663 4 0.4249 495 | 0/15
20 h-m-p 0.3087 1.9915 0.1374 +YCCC 2082.900482 3 0.9567 534 | 0/15
21 h-m-p 1.6000 8.0000 0.0234 YCCC 2080.357988 3 3.1744 572 | 0/15
22 h-m-p 1.2376 6.1881 0.0221 YCCCC 2078.570640 4 2.5057 612 | 0/15
23 h-m-p 1.6000 8.0000 0.0249 CCCC 2077.943787 3 1.8484 651 | 0/15
24 h-m-p 1.1746 8.0000 0.0391 CYC 2077.594306 2 1.4200 687 | 0/15
25 h-m-p 1.1453 5.7266 0.0431 CCCC 2077.243328 3 1.3196 726 | 0/15
26 h-m-p 1.3459 8.0000 0.0422 YCCC 2076.822433 3 2.1481 764 | 0/15
27 h-m-p 1.6000 8.0000 0.0251 CCC 2076.470642 2 2.3965 801 | 0/15
28 h-m-p 1.6000 8.0000 0.0088 YC 2076.324452 1 2.8215 835 | 0/15
29 h-m-p 1.6000 8.0000 0.0063 +CC 2075.898518 1 5.8349 871 | 0/15
30 h-m-p 1.6000 8.0000 0.0225 CCC 2075.668081 2 2.1110 908 | 0/15
31 h-m-p 1.6000 8.0000 0.0152 YC 2075.497962 1 2.9708 942 | 0/15
32 h-m-p 1.6000 8.0000 0.0094 YC 2075.347835 1 3.0946 976 | 0/15
33 h-m-p 1.6000 8.0000 0.0101 CC 2075.294952 1 2.3715 1011 | 0/15
34 h-m-p 1.6000 8.0000 0.0041 YC 2075.264484 1 2.7750 1045 | 0/15
35 h-m-p 1.6000 8.0000 0.0027 C 2075.260764 0 1.6749 1078 | 0/15
36 h-m-p 1.6000 8.0000 0.0017 C 2075.260352 0 1.5027 1111 | 0/15
37 h-m-p 1.6000 8.0000 0.0001 +Y 2075.260120 0 7.0825 1145 | 0/15
38 h-m-p 1.6000 8.0000 0.0005 YC 2075.259844 1 3.3189 1179 | 0/15
39 h-m-p 1.6000 8.0000 0.0004 C 2075.259742 0 1.8721 1212 | 0/15
40 h-m-p 1.6000 8.0000 0.0001 Y 2075.259732 0 2.7630 1245 | 0/15
41 h-m-p 1.6000 8.0000 0.0001 +C 2075.259712 0 5.8896 1279 | 0/15
42 h-m-p 1.6000 8.0000 0.0001 +Y 2075.259672 0 4.2330 1313 | 0/15
43 h-m-p 1.6000 8.0000 0.0001 C 2075.259669 0 1.2804 1346 | 0/15
44 h-m-p 1.6000 8.0000 0.0000 Y 2075.259669 0 1.0414 1379 | 0/15
45 h-m-p 1.6000 8.0000 0.0000 Y 2075.259669 0 1.6000 1412 | 0/15
46 h-m-p 1.6000 8.0000 0.0000 C 2075.259669 0 0.4000 1445 | 0/15
47 h-m-p 0.6542 8.0000 0.0000 ---------------C 2075.259669 0 0.0000 1493
Out..
lnL = -2075.259669
1494 lfun, 1494 eigenQcodon, 19422 P(t)
Time used: 0:08
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
0.051141 0.000000 0.114482 0.136339 0.143461 0.286420 0.045457 0.122698 0.236984 0.201157 0.023405 0.019481 0.054212 1.497640 0.700642 0.304419
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.534091
np = 16
lnL0 = -2200.916189
Iterating by ming2
Initial: fx= 2200.916189
x= 0.05114 0.00000 0.11448 0.13634 0.14346 0.28642 0.04546 0.12270 0.23698 0.20116 0.02341 0.01948 0.05421 1.49764 0.70064 0.30442
1 h-m-p 0.0000 0.0005 838.9255 +++ 2172.894086 m 0.0005 22 | 0/16
2 h-m-p 0.0000 0.0000 13919.2538 +YYYCCCC 2141.008877 6 0.0000 51 | 0/16
3 h-m-p 0.0000 0.0002 344.1889 CYCCCC 2137.369366 5 0.0001 79 | 0/16
4 h-m-p 0.0000 0.0002 136.1691 ++ 2134.689591 m 0.0002 98 | 1/16
5 h-m-p 0.0001 0.0012 177.8747 +CYYCCC 2127.424615 5 0.0008 126 | 1/16
6 h-m-p 0.0007 0.0035 24.5233 +YCYC 2126.760326 3 0.0020 150 | 1/16
7 h-m-p 0.0024 0.0146 20.4591 CCC 2126.432814 2 0.0021 173 | 1/16
8 h-m-p 0.0031 0.0157 9.4825 CCC 2126.207470 2 0.0041 196 | 1/16
9 h-m-p 0.0018 0.0687 21.3223 YCCC 2125.683644 3 0.0044 220 | 1/16
10 h-m-p 0.0044 0.0221 17.9197 +YCCC 2124.201124 3 0.0120 245 | 1/16
11 h-m-p 0.0033 0.0163 52.1053 YCCCC 2121.964412 4 0.0064 271 | 1/16
12 h-m-p 0.0034 0.0172 30.6611 YCCC 2121.623531 3 0.0018 295 | 1/16
13 h-m-p 0.0085 0.0425 5.4993 YC 2121.488945 1 0.0041 315 | 1/16
14 h-m-p 0.0047 0.0733 4.7887 +CYCCC 2119.799176 4 0.0372 343 | 1/16
15 h-m-p 0.0027 0.0135 18.0520 CCCC 2119.367095 3 0.0032 368 | 1/16
16 h-m-p 0.0216 0.1740 2.7165 CCCC 2117.953502 3 0.0364 393 | 1/16
17 h-m-p 0.0068 0.0584 14.6117 +YCYCCCC 2101.242783 6 0.0341 423 | 0/16
18 h-m-p 0.0001 0.0003 1102.3312 CYC 2099.471952 2 0.0001 445 | 0/16
19 h-m-p 0.1220 0.7505 0.7156 +YYCCC 2088.340896 4 0.4361 471 | 0/16
20 h-m-p 0.0621 0.3106 1.2637 +YYYCCC 2081.864693 5 0.2276 514 | 0/16
21 h-m-p 0.4420 2.2099 0.4048 YCCCCC 2069.260503 5 0.8773 542 | 0/16
22 h-m-p 0.1602 0.8012 0.4645 +YYCCC 2065.355347 4 0.5287 584 | 0/16
23 h-m-p 0.5712 2.8559 0.1808 YCYC 2064.050276 3 0.3875 623 | 0/16
24 h-m-p 0.6387 3.1936 0.0533 YYCC 2063.704441 3 0.5613 662 | 0/16
25 h-m-p 1.6000 8.0000 0.0154 YC 2063.637444 1 0.7511 698 | 0/16
26 h-m-p 0.5574 8.0000 0.0208 CC 2063.623123 1 0.6824 735 | 0/16
27 h-m-p 1.6000 8.0000 0.0058 YC 2063.618971 1 0.9613 771 | 0/16
28 h-m-p 1.6000 8.0000 0.0019 CC 2063.616789 1 1.3811 808 | 0/16
29 h-m-p 1.6000 8.0000 0.0012 YC 2063.616217 1 0.9085 844 | 0/16
30 h-m-p 0.8325 8.0000 0.0013 C 2063.616057 0 0.9682 879 | 0/16
31 h-m-p 1.6000 8.0000 0.0007 Y 2063.616045 0 0.8597 914 | 0/16
32 h-m-p 1.6000 8.0000 0.0001 Y 2063.616043 0 0.9691 949 | 0/16
33 h-m-p 1.6000 8.0000 0.0000 Y 2063.616043 0 1.1183 984 | 0/16
34 h-m-p 1.6000 8.0000 0.0000 Y 2063.616043 0 0.8885 1019 | 0/16
35 h-m-p 1.6000 8.0000 0.0000 Y 2063.616043 0 0.8897 1054 | 0/16
36 h-m-p 1.6000 8.0000 0.0000 C 2063.616043 0 0.3731 1089 | 0/16
37 h-m-p 0.6906 8.0000 0.0000 Y 2063.616043 0 0.6906 1124 | 0/16
38 h-m-p 1.6000 8.0000 0.0000 -Y 2063.616043 0 0.1000 1160
Out..
lnL = -2063.616043
1161 lfun, 3483 eigenQcodon, 30186 P(t)
Time used: 0:21
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
initial w for M2:NSpselection reset.
0.083053 0.000000 0.087229 0.106043 0.151264 0.237166 0.052176 0.095287 0.211953 0.207434 0.049482 0.057556 0.022830 1.566817 0.878998 0.263736 0.186073 2.329016
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.783556
np = 18
lnL0 = -2248.637599
Iterating by ming2
Initial: fx= 2248.637599
x= 0.08305 0.00000 0.08723 0.10604 0.15126 0.23717 0.05218 0.09529 0.21195 0.20743 0.04948 0.05756 0.02283 1.56682 0.87900 0.26374 0.18607 2.32902
1 h-m-p 0.0000 0.0009 1174.1700 ++++ 2222.402835 m 0.0009 25 | 0/18
2 h-m-p 0.0000 0.0002 339.4576 +YYCCC 2212.802797 4 0.0002 53 | 0/18
3 h-m-p 0.0002 0.0121 257.0815 +CCCC 2197.535062 3 0.0008 81 | 0/18
4 h-m-p 0.0002 0.0010 306.4758 ++ 2167.363082 m 0.0010 102 | 0/18
5 h-m-p 0.0004 0.0021 99.6883 +YCYCCC 2162.555286 5 0.0012 132 | 0/18
6 h-m-p 0.0009 0.0046 81.3254 ++ 2151.659962 m 0.0046 153 | 0/18
7 h-m-p 0.0015 0.0074 127.1168 CCCC 2148.542631 3 0.0015 180 | 0/18
8 h-m-p 0.0005 0.0025 61.8415 YCYCCC 2147.302931 5 0.0012 209 | 0/18
9 h-m-p 0.0018 0.0089 37.2646 YCCC 2146.139269 3 0.0032 235 | 0/18
10 h-m-p 0.0084 0.1026 14.0168 CCCC 2145.183734 3 0.0113 262 | 0/18
11 h-m-p 0.0093 0.0620 17.0836 +YCCC 2140.378286 3 0.0490 289 | 0/18
12 h-m-p 0.0069 0.0802 121.2754 +YCCC 2127.362065 3 0.0201 316 | 0/18
13 h-m-p 0.0004 0.0021 31.0727 ++ 2126.811568 m 0.0021 337 | 0/18
14 h-m-p 0.0035 0.1077 18.9347 +CC 2125.057172 1 0.0209 361 | 0/18
15 h-m-p 0.0092 0.0461 16.8293 ++ 2120.249547 m 0.0461 382 | 0/18
16 h-m-p 0.0000 0.0000 56.8820
h-m-p: 5.43209572e-19 2.71604786e-18 5.68820112e+01 2120.249547
.. | 0/18
17 h-m-p 0.0000 0.0002 290.5120 +CYCCCC 2117.305475 5 0.0001 431 | 0/18
18 h-m-p 0.0003 0.0022 70.0537 +CYYCCC 2113.106888 5 0.0015 462 | 0/18
19 h-m-p 0.0002 0.0012 203.2338 ++ 2104.136622 m 0.0012 483 | 0/18
20 h-m-p 0.0003 0.0016 456.9677 +YYYCCC 2088.382684 5 0.0012 512 | 0/18
21 h-m-p 0.0004 0.0021 93.7743 YCCCCC 2086.447325 5 0.0009 542 | 0/18
22 h-m-p 0.0023 0.0116 20.5850 CCC 2086.142416 2 0.0018 567 | 0/18
23 h-m-p 0.0042 0.0766 8.8714 +YCCC 2085.593211 3 0.0125 594 | 0/18
24 h-m-p 0.0068 0.0694 16.4070 YCCC 2084.565926 3 0.0137 620 | 0/18
25 h-m-p 0.0080 0.0450 27.9428 CCC 2083.489047 2 0.0086 645 | 0/18
26 h-m-p 0.0107 0.0536 13.8571 CYC 2082.820927 2 0.0099 669 | 0/18
27 h-m-p 0.0077 0.1420 17.7536 +CYCC 2080.520640 3 0.0281 696 | 0/18
28 h-m-p 0.0067 0.0336 31.3869 CYCCC 2078.685712 4 0.0108 724 | 0/18
29 h-m-p 0.0025 0.0124 38.9028 CCCCC 2078.106953 4 0.0030 753 | 0/18
30 h-m-p 0.0068 0.0938 17.3625 YCCC 2077.051555 3 0.0154 779 | 0/18
31 h-m-p 0.0215 0.1424 12.4061 CYCCC 2075.644252 4 0.0325 807 | 0/18
32 h-m-p 0.0225 0.1127 14.7618 YCCCC 2074.632853 4 0.0238 835 | 0/18
33 h-m-p 0.0244 0.1948 14.3746 YCCCC 2072.947774 4 0.0452 863 | 0/18
34 h-m-p 0.0145 0.0727 40.5164 YYCC 2071.823268 3 0.0115 888 | 0/18
35 h-m-p 0.0907 0.7869 5.1153 +YCCC 2068.601720 3 0.2371 915 | 0/18
36 h-m-p 0.6596 6.8900 1.8388 YCCCC 2067.110385 4 0.4454 943 | 0/18
37 h-m-p 0.2982 1.4912 1.2972 YCCCC 2066.088831 4 0.6393 971 | 0/18
38 h-m-p 0.5039 2.5197 1.4384 YYYC 2065.632745 3 0.4705 995 | 0/18
39 h-m-p 0.3884 2.7949 1.7426 CCC 2065.238598 2 0.4948 1020 | 0/18
40 h-m-p 0.7518 6.5902 1.1470 CCCC 2064.800595 3 1.1750 1047 | 0/18
41 h-m-p 1.2118 7.0944 1.1122 YCC 2064.560632 2 0.7968 1071 | 0/18
42 h-m-p 0.5791 8.0000 1.5304 YCCC 2064.189499 3 1.2346 1097 | 0/18
43 h-m-p 0.9103 6.0586 2.0758 YYC 2063.957463 2 0.7631 1120 | 0/18
44 h-m-p 1.6000 8.0000 0.9865 YC 2063.882441 1 0.6824 1142 | 0/18
45 h-m-p 0.4232 7.8190 1.5908 CCC 2063.833139 2 0.5398 1185 | 0/18
46 h-m-p 0.6581 8.0000 1.3049 CCC 2063.781722 2 0.9207 1210 | 0/18
47 h-m-p 0.6377 8.0000 1.8841 CCC 2063.733763 2 0.8164 1235 | 0/18
48 h-m-p 0.7440 8.0000 2.0674 CC 2063.691803 1 0.7700 1258 | 0/18
49 h-m-p 1.0544 8.0000 1.5098 YCC 2063.669749 2 0.7282 1282 | 0/18
50 h-m-p 0.4840 8.0000 2.2715 CCC 2063.654026 2 0.7135 1307 | 0/18
51 h-m-p 0.6618 8.0000 2.4490 C 2063.640629 0 0.6618 1328 | 0/18
52 h-m-p 0.9405 8.0000 1.7232 CY 2063.632195 1 1.0014 1351 | 0/18
53 h-m-p 0.8552 8.0000 2.0178 CC 2063.625192 1 1.1115 1374 | 0/18
54 h-m-p 1.4931 8.0000 1.5021 C 2063.621140 0 1.4931 1395 | 0/18
55 h-m-p 1.1364 8.0000 1.9736 C 2063.618975 0 1.1364 1416 | 0/18
56 h-m-p 1.3559 8.0000 1.6541 CY 2063.617526 1 1.5972 1439 | 0/18
57 h-m-p 1.6000 8.0000 1.4417 C 2063.616852 0 1.6000 1460 | 0/18
58 h-m-p 1.0547 8.0000 2.1872 C 2063.616523 0 0.9777 1481 | 0/18
59 h-m-p 1.3195 8.0000 1.6206 C 2063.616322 0 1.3195 1502 | 0/18
60 h-m-p 1.6000 8.0000 1.3351 C 2063.616209 0 1.4263 1523 | 0/18
61 h-m-p 1.6000 8.0000 0.9538 C 2063.616146 0 1.8498 1544 | 0/18
62 h-m-p 0.7856 8.0000 2.2460 +C 2063.616085 0 3.1423 1584 | 0/18
63 h-m-p 1.6000 8.0000 2.7231 Y 2063.616072 0 0.6766 1605 | 0/18
64 h-m-p 0.4506 8.0000 4.0886 --------C 2063.616072 0 0.0000 1634 | 0/18
65 h-m-p 0.0160 8.0000 3.5794 -------Y 2063.616072 0 0.0000 1662 | 0/18
66 h-m-p 0.0160 8.0000 0.0043 +++C 2063.616068 0 0.9887 1686 | 0/18
67 h-m-p 0.2667 8.0000 0.0161 +C 2063.616068 0 0.9742 1726 | 0/18
68 h-m-p 1.6000 8.0000 0.0019 Y 2063.616068 0 1.0928 1765 | 0/18
69 h-m-p 1.6000 8.0000 0.0001 Y 2063.616068 0 2.6092 1804 | 0/18
70 h-m-p 1.4305 8.0000 0.0002 ++ 2063.616068 m 8.0000 1843 | 0/18
71 h-m-p 0.0239 8.0000 0.0554 +++C 2063.616068 0 2.0398 1885 | 0/18
72 h-m-p 1.6000 8.0000 0.0576 ++ 2063.616065 m 8.0000 1924 | 0/18
73 h-m-p 0.5036 8.0000 0.9157 Y 2063.616063 0 1.0568 1963 | 0/18
74 h-m-p 1.6000 8.0000 0.0018 Y 2063.616063 0 0.4000 2002 | 0/18
75 h-m-p 0.6854 8.0000 0.0010 -Y 2063.616063 0 0.0428 2042 | 0/18
76 h-m-p 0.0426 8.0000 0.0010 +++C 2063.616063 0 2.6660 2084 | 0/18
77 h-m-p 1.6000 8.0000 0.0007 ++ 2063.616063 m 8.0000 2123 | 0/18
78 h-m-p 0.0160 8.0000 0.8489 +++Y 2063.616059 0 1.7467 2165 | 0/18
79 h-m-p 1.6000 8.0000 0.4504 ++ 2063.616048 m 8.0000 2204 | 0/18
80 h-m-p 1.6000 8.0000 1.4685 Y 2063.616045 0 2.8668 2243 | 0/18
81 h-m-p 1.0465 8.0000 4.0229 -------------C 2063.616045 0 0.0000 2277 | 0/18
82 h-m-p 0.0160 8.0000 0.6785 -------------.. | 0/18
83 h-m-p 0.0160 8.0000 0.0848 ---C 2063.616045 0 0.0001 2351 | 0/18
84 h-m-p 0.0160 8.0000 0.0155 --C 2063.616045 0 0.0003 2392 | 0/18
85 h-m-p 0.0058 2.8895 0.0122 -Y 2063.616045 0 0.0003 2432 | 0/18
86 h-m-p 0.0160 8.0000 0.0086 --Y 2063.616045 0 0.0004 2473 | 0/18
87 h-m-p 0.0160 8.0000 0.0089 -Y 2063.616045 0 0.0008 2513 | 0/18
88 h-m-p 0.0160 8.0000 0.0124 --C 2063.616045 0 0.0004 2554 | 0/18
89 h-m-p 0.0160 8.0000 0.0212 -C 2063.616045 0 0.0010 2594 | 0/18
90 h-m-p 0.0160 8.0000 0.0218 -C 2063.616045 0 0.0010 2634 | 0/18
91 h-m-p 0.0160 8.0000 0.0203 C 2063.616045 0 0.0033 2673 | 0/18
92 h-m-p 0.0160 8.0000 0.0086 Y 2063.616045 0 0.0023 2712 | 0/18
93 h-m-p 0.0160 8.0000 0.0020 -Y 2063.616045 0 0.0020 2752 | 0/18
94 h-m-p 0.0160 8.0000 0.0003 Y 2063.616045 0 0.0021 2791
Out..
lnL = -2063.616045
2792 lfun, 11168 eigenQcodon, 108888 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2076.302889 S = -1989.392774 -77.807735
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 172 patterns 1:06
did 20 / 172 patterns 1:06
did 30 / 172 patterns 1:06
did 40 / 172 patterns 1:06
did 50 / 172 patterns 1:06
did 60 / 172 patterns 1:06
did 70 / 172 patterns 1:06
did 80 / 172 patterns 1:06
did 90 / 172 patterns 1:06
did 100 / 172 patterns 1:06
did 110 / 172 patterns 1:06
did 120 / 172 patterns 1:06
did 130 / 172 patterns 1:06
did 140 / 172 patterns 1:06
did 150 / 172 patterns 1:06
did 160 / 172 patterns 1:06
did 170 / 172 patterns 1:06
did 172 / 172 patterns 1:06
Time used: 1:06
Model 3: discrete
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
0.069836 0.000000 0.114934 0.148700 0.164325 0.334757 0.054460 0.124635 0.282778 0.241678 0.022702 0.027848 0.027888 1.566815 0.062503 0.014820 0.032081 0.074905 0.128526
ntime & nrate & np: 13 4 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.476610
np = 19
lnL0 = -2080.917576
Iterating by ming2
Initial: fx= 2080.917576
x= 0.06984 0.00000 0.11493 0.14870 0.16432 0.33476 0.05446 0.12464 0.28278 0.24168 0.02270 0.02785 0.02789 1.56682 0.06250 0.01482 0.03208 0.07490 0.12853
1 h-m-p 0.0000 0.0002 1067.0773 +YYYCC 2076.059517 4 0.0000 30 | 0/19
2 h-m-p 0.0000 0.0002 220.9974 ++ 2069.383818 m 0.0002 52 | 1/19
3 h-m-p 0.0001 0.0005 335.5308 ++ 2061.307612 m 0.0005 74 | 1/19
4 h-m-p 0.0004 0.0020 83.3522 CCC 2060.403426 2 0.0004 100 | 1/19
5 h-m-p 0.0003 0.0017 52.9066 CCCC 2059.865372 3 0.0006 128 | 1/19
6 h-m-p 0.0004 0.0020 19.1134 YYC 2059.821248 2 0.0003 152 | 0/19
7 h-m-p 0.0002 0.0092 26.2383 YCC 2059.780169 2 0.0001 177 | 0/19
8 h-m-p 0.0002 0.0086 15.2962 +YCC 2059.731169 2 0.0007 203 | 0/19
9 h-m-p 0.0003 0.0017 30.9091 CC 2059.687947 1 0.0004 227 | 0/19
10 h-m-p 0.0013 0.0339 8.9443 CC 2059.649264 1 0.0017 251 | 0/19
11 h-m-p 0.0011 0.0378 13.3097 CCC 2059.600362 2 0.0017 277 | 0/19
12 h-m-p 0.0014 0.0248 17.0477 YC 2059.504646 1 0.0028 300 | 0/19
13 h-m-p 0.0014 0.0800 35.3138 +YCCC 2058.825931 3 0.0102 328 | 0/19
14 h-m-p 0.0118 0.0589 21.1558 CCC 2058.682796 2 0.0039 354 | 0/19
15 h-m-p 0.0063 0.0750 13.2248 YC 2058.623445 1 0.0030 377 | 0/19
16 h-m-p 0.0039 0.1709 10.2953 +CCC 2058.391829 2 0.0172 404 | 0/19
17 h-m-p 0.0059 0.0456 30.1871 YCC 2058.222669 2 0.0044 429 | 0/19
18 h-m-p 0.0280 0.1504 4.7281 -YC 2058.207695 1 0.0031 453 | 0/19
19 h-m-p 0.0613 8.0000 0.2426 ++CCC 2057.980130 2 0.8301 481 | 0/19
20 h-m-p 0.6468 8.0000 0.3113 CYC 2057.884184 2 0.5107 525 | 0/19
21 h-m-p 0.8281 8.0000 0.1920 YCCC 2057.583521 3 1.9636 571 | 0/19
22 h-m-p 1.6000 8.0000 0.0820 CCC 2057.393463 2 1.3949 616 | 0/19
23 h-m-p 1.2043 8.0000 0.0949 CYC 2057.367172 2 1.0739 660 | 0/19
24 h-m-p 1.6000 8.0000 0.0373 CCC 2057.352220 2 2.5226 705 | 0/19
25 h-m-p 1.5108 8.0000 0.0623 CCC 2057.340260 2 2.0497 750 | 0/19
26 h-m-p 1.6000 8.0000 0.0346 CC 2057.335679 1 1.3404 793 | 0/19
27 h-m-p 1.4347 8.0000 0.0323 C 2057.334128 0 1.4516 834 | 0/19
28 h-m-p 1.6000 8.0000 0.0035 YC 2057.333648 1 3.5548 876 | 0/19
29 h-m-p 0.7608 8.0000 0.0162 +C 2057.332836 0 2.6070 918 | 0/19
30 h-m-p 1.6000 8.0000 0.0015 YC 2057.332584 1 0.9737 960 | 0/19
31 h-m-p 0.9582 8.0000 0.0015 C 2057.332570 0 1.0439 1001 | 0/19
32 h-m-p 1.6000 8.0000 0.0001 Y 2057.332570 0 1.0006 1042 | 0/19
33 h-m-p 1.6000 8.0000 0.0000 Y 2057.332570 0 0.7993 1083 | 0/19
34 h-m-p 1.6000 8.0000 0.0000 C 2057.332570 0 2.1761 1124 | 0/19
35 h-m-p 1.6000 8.0000 0.0000 -Y 2057.332570 0 0.1000 1166 | 0/19
36 h-m-p 0.0700 8.0000 0.0000 --------------.. | 0/19
37 h-m-p 0.0160 8.0000 0.0004 -------C 2057.332570 0 0.0000 1267
Out..
lnL = -2057.332570
1268 lfun, 5072 eigenQcodon, 49452 P(t)
Time used: 1:27
Model 7: beta
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
0.069594 0.000000 0.105485 0.137784 0.163590 0.330681 0.055821 0.125651 0.274617 0.241946 0.035269 0.026769 0.037401 1.467251 0.942968 1.067294
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.121187
np = 16
lnL0 = -2179.930662
Iterating by ming2
Initial: fx= 2179.930662
x= 0.06959 0.00000 0.10548 0.13778 0.16359 0.33068 0.05582 0.12565 0.27462 0.24195 0.03527 0.02677 0.03740 1.46725 0.94297 1.06729
1 h-m-p 0.0000 0.0006 647.5084 ++CYCCC 2172.253176 4 0.0001 30 | 0/16
2 h-m-p 0.0001 0.0006 189.2434 +YCCCC 2162.615797 4 0.0005 57 | 0/16
3 h-m-p 0.0001 0.0006 772.2288 ++ 2134.980388 m 0.0006 76 | 0/16
4 h-m-p 0.0002 0.0011 825.0320 YCYCCC 2105.359154 5 0.0006 103 | 0/16
5 h-m-p 0.0003 0.0014 231.6266 YCYCCC 2096.425255 5 0.0006 130 | 0/16
6 h-m-p 0.0017 0.0087 38.5191 YCYCCC 2093.274530 5 0.0040 157 | 0/16
7 h-m-p 0.0005 0.0026 226.7995 +YYCCC 2085.566958 4 0.0017 183 | 0/16
8 h-m-p 0.0004 0.0020 155.6746 +YCCCC 2082.727611 4 0.0011 210 | 0/16
9 h-m-p 0.0004 0.0019 217.6031 ++ 2075.494521 m 0.0019 229 | 0/16
10 h-m-p 0.0000 0.0000 89.9838
h-m-p: 1.24065481e-19 6.20327404e-19 8.99838158e+01 2075.494521
.. | 0/16
11 h-m-p 0.0000 0.0005 338.7592 ++YYC 2069.728529 2 0.0002 268 | 0/16
12 h-m-p 0.0001 0.0006 97.4314 +YYCCC 2067.431515 4 0.0004 294 | 0/16
13 h-m-p 0.0001 0.0004 283.7637 +YYCCC 2064.781597 4 0.0002 320 | 0/16
14 h-m-p 0.0002 0.0009 126.2831 YCYCCC 2062.615763 5 0.0005 347 | 0/16
15 h-m-p 0.0002 0.0011 345.9286 CCCC 2060.210146 3 0.0003 372 | 0/16
16 h-m-p 0.0013 0.0067 36.1167 YCC 2059.785397 2 0.0009 394 | 0/16
17 h-m-p 0.0005 0.0024 38.2761 YYC 2059.652859 2 0.0004 415 | 0/16
18 h-m-p 0.0012 0.1073 10.8891 YCC 2059.560015 2 0.0020 437 | 0/16
19 h-m-p 0.0007 0.0239 30.7095 +YYC 2059.265070 2 0.0025 459 | 0/16
20 h-m-p 0.0024 0.0570 32.2537 +YYCC 2058.341717 3 0.0080 483 | 0/16
21 h-m-p 0.0053 0.0266 47.7479 CCC 2058.013510 2 0.0022 506 | 0/16
22 h-m-p 0.0083 0.0694 12.4764 CC 2057.956493 1 0.0019 527 | 0/16
23 h-m-p 0.0132 0.2487 1.7687 C 2057.951450 0 0.0033 546 | 0/16
24 h-m-p 0.0213 1.5991 0.2720 C 2057.947873 0 0.0213 565 | 0/16
25 h-m-p 0.0042 0.2548 1.3725 YC 2057.937305 1 0.0095 601 | 0/16
26 h-m-p 0.0020 0.2042 6.4728 +YC 2057.848526 1 0.0160 622 | 0/16
27 h-m-p 1.6000 8.0000 0.0425 CC 2057.840764 1 1.4074 643 | 0/16
28 h-m-p 1.6000 8.0000 0.0054 CC 2057.836324 1 2.3212 680 | 0/16
29 h-m-p 1.1511 8.0000 0.0108 C 2057.836072 0 1.0025 715 | 0/16
30 h-m-p 1.6000 8.0000 0.0008 Y 2057.836062 0 0.9361 750 | 0/16
31 h-m-p 1.6000 8.0000 0.0001 Y 2057.836061 0 1.1749 785 | 0/16
32 h-m-p 1.6000 8.0000 0.0000 Y 2057.836061 0 1.0365 820 | 0/16
33 h-m-p 1.6000 8.0000 0.0000 Y 2057.836061 0 1.2009 855 | 0/16
34 h-m-p 1.1182 8.0000 0.0000 C 2057.836061 0 1.1182 890 | 0/16
35 h-m-p 1.6000 8.0000 0.0000 C 2057.836061 0 0.4000 925 | 0/16
36 h-m-p 1.6000 8.0000 0.0000 ---Y 2057.836061 0 0.0063 963
Out..
lnL = -2057.836061
964 lfun, 10604 eigenQcodon, 125320 P(t)
Time used: 2:18
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
initial w for M8:NSbetaw>1 reset.
0.082887 0.000000 0.066878 0.102620 0.115773 0.236008 0.073579 0.116528 0.184437 0.147218 0.021373 0.065538 0.040594 1.472715 0.900000 1.091300 1.180709 2.396835
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.156971
np = 18
lnL0 = -2235.608712
Iterating by ming2
Initial: fx= 2235.608712
x= 0.08289 0.00000 0.06688 0.10262 0.11577 0.23601 0.07358 0.11653 0.18444 0.14722 0.02137 0.06554 0.04059 1.47271 0.90000 1.09130 1.18071 2.39683
1 h-m-p 0.0000 0.0003 1624.8244 ++CYCCC 2215.654450 4 0.0001 32 | 0/18
2 h-m-p 0.0000 0.0002 376.6679 ++ 2189.561357 m 0.0002 53 | 1/18
3 h-m-p 0.0003 0.0019 191.8748 ++ 2171.045302 m 0.0019 74 | 1/18
4 h-m-p 0.0001 0.0007 821.2592 ++ 2130.065158 m 0.0007 95 | 1/18
5 h-m-p 0.0001 0.0006 776.3923 YCYCCC 2115.628295 5 0.0003 124 | 1/18
6 h-m-p 0.0001 0.0005 150.1565 ++ 2112.116254 m 0.0005 145 | 0/18
7 h-m-p 0.0002 0.0033 309.7526 YCYCC 2107.738451 4 0.0001 172 | 0/18
8 h-m-p 0.0006 0.0029 46.7248 ++ 2103.632960 m 0.0029 193 | 0/18
9 h-m-p -0.0000 -0.0000 386.0176
h-m-p: -5.81831278e-23 -2.90915639e-22 3.86017571e+02 2103.632960
.. | 0/18
10 h-m-p 0.0000 0.0009 258.7709 ++++ 2083.082701 m 0.0009 234 | 0/18
11 h-m-p 0.0001 0.0006 343.1201 +YYCCC 2072.843711 4 0.0004 262 | 0/18
12 h-m-p 0.0001 0.0004 133.2112 +YCYCCC 2070.877537 5 0.0002 292 | 0/18
13 h-m-p 0.0003 0.0014 64.0831 +YCYCCC 2069.402650 5 0.0008 322 | 0/18
14 h-m-p 0.0002 0.0010 71.4195 CCC 2069.124316 2 0.0002 347 | 0/18
15 h-m-p 0.0003 0.0056 49.0350 +YYCC 2068.410918 3 0.0012 373 | 0/18
16 h-m-p 0.0009 0.0044 30.7780 YCCC 2067.862092 3 0.0020 399 | 0/18
17 h-m-p 0.0001 0.0007 147.9237 +CCC 2067.173178 2 0.0006 425 | 0/18
18 h-m-p 0.0008 0.0042 9.8048 +CC 2067.042280 1 0.0030 449 | 0/18
19 h-m-p 0.0009 0.0047 6.7439 ++ 2066.887653 m 0.0047 470 | 1/18
20 h-m-p 0.0018 0.0604 18.2090 +YC 2066.562701 1 0.0047 493 | 1/18
21 h-m-p 0.0017 0.0320 50.2548 CCC 2066.237335 2 0.0022 518 | 1/18
22 h-m-p 0.0038 0.0549 29.1701 CCC 2065.894036 2 0.0035 543 | 1/18
23 h-m-p 0.0044 0.0222 8.9601 YCC 2065.808790 2 0.0030 567 | 1/18
24 h-m-p 0.0078 0.4085 3.4853 ++YCCC 2064.129132 3 0.0848 595 | 1/18
25 h-m-p 0.0064 0.0322 42.7455 CYCCC 2061.322247 4 0.0110 623 | 1/18
26 h-m-p 0.0100 0.0498 9.0712 CYC 2061.256434 2 0.0024 647 | 1/18
27 h-m-p 0.0058 0.4892 3.6967 ++YCCC 2059.009321 3 0.2034 675 | 1/18
28 h-m-p 0.5897 2.9485 0.1107 CYC 2058.056801 2 0.5361 699 | 1/18
29 h-m-p 0.1584 8.0000 0.3746 +CCC 2057.862760 2 0.8940 742 | 1/18
30 h-m-p 1.6000 8.0000 0.1929 CC 2057.844477 1 0.5980 782 | 1/18
31 h-m-p 1.0970 8.0000 0.1051 YC 2057.838683 1 0.7073 821 | 1/18
32 h-m-p 1.6000 8.0000 0.0036 YC 2057.838131 1 0.8041 860 | 1/18
33 h-m-p 0.6949 8.0000 0.0042 C 2057.838072 0 0.6086 898 | 1/18
34 h-m-p 1.1182 8.0000 0.0023 Y 2057.838062 0 0.4902 936 | 1/18
35 h-m-p 1.6000 8.0000 0.0005 Y 2057.838062 0 0.8798 974 | 1/18
36 h-m-p 1.6000 8.0000 0.0002 Y 2057.838062 0 0.9695 1012 | 1/18
37 h-m-p 1.6000 8.0000 0.0001 C 2057.838062 0 1.9550 1050 | 1/18
38 h-m-p 1.1303 8.0000 0.0002 ++ 2057.838061 m 8.0000 1088 | 1/18
39 h-m-p 0.6314 8.0000 0.0021 ++ 2057.838060 m 8.0000 1126 | 1/18
40 h-m-p 0.3896 8.0000 0.0426 ++C 2057.838051 0 5.3610 1166 | 1/18
41 h-m-p 1.2765 8.0000 0.1788 ++ 2057.837539 m 8.0000 1204 | 1/18
42 h-m-p 0.8470 8.0000 1.6890 ------------C 2057.837539 0 0.0000 1254 | 1/18
43 h-m-p 0.0002 0.1174 6.9726 +++++ 2057.836697 m 0.1174 1278 | 2/18
44 h-m-p 0.6418 8.0000 0.0070 YC 2057.836476 1 1.1295 1300 | 2/18
45 h-m-p 1.6000 8.0000 0.0020 Y 2057.836430 0 2.7978 1337 | 2/18
46 h-m-p 1.6000 8.0000 0.0009 Y 2057.836428 0 1.0193 1374 | 2/18
47 h-m-p 1.6000 8.0000 0.0000 Y 2057.836428 0 0.9608 1411 | 2/18
48 h-m-p 1.6000 8.0000 0.0000 Y 2057.836428 0 1.0535 1448 | 2/18
49 h-m-p 1.6000 8.0000 0.0000 -------------C 2057.836428 0 0.0000 1498
Out..
lnL = -2057.836428
1499 lfun, 17988 eigenQcodon, 214357 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2078.251872 S = -1992.674355 -77.227709
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 172 patterns 3:45
did 20 / 172 patterns 3:46
did 30 / 172 patterns 3:46
did 40 / 172 patterns 3:46
did 50 / 172 patterns 3:46
did 60 / 172 patterns 3:46
did 70 / 172 patterns 3:47
did 80 / 172 patterns 3:47
did 90 / 172 patterns 3:47
did 100 / 172 patterns 3:47
did 110 / 172 patterns 3:47
did 120 / 172 patterns 3:48
did 130 / 172 patterns 3:48
did 140 / 172 patterns 3:48
did 150 / 172 patterns 3:48
did 160 / 172 patterns 3:48
did 170 / 172 patterns 3:48
did 172 / 172 patterns 3:49
Time used: 3:49
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=210
D_melanogaster_a5-PA MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
D_sechellia_a5-PA MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI
D_simulans_a5-PA MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI
D_yakuba_a5-PA MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI
D_erecta_a5-PA MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV
D_takahashii_a5-PA MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI
D_suzukii_a5-PA MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI
D_rhopaloa_a5-PA MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI
** :** : * ***:.::******** * *:**:***.:***:
D_melanogaster_a5-PA KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
D_sechellia_a5-PA KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
D_simulans_a5-PA KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
D_yakuba_a5-PA KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
D_erecta_a5-PA KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP
D_takahashii_a5-PA KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP
D_suzukii_a5-PA KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP
D_rhopaloa_a5-PA KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP
**:**:******:***.***************:****:*********:**
D_melanogaster_a5-PA MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
D_sechellia_a5-PA MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
D_simulans_a5-PA MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD
D_yakuba_a5-PA MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD
D_erecta_a5-PA MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD
D_takahashii_a5-PA MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD
D_suzukii_a5-PA MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD
D_rhopaloa_a5-PA MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD
************:****:*****:*:******.**** ****:***:***
D_melanogaster_a5-PA KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
D_sechellia_a5-PA KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
D_simulans_a5-PA KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE
D_yakuba_a5-PA KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE
D_erecta_a5-PA KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE
D_takahashii_a5-PA KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE
D_suzukii_a5-PA KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE
D_rhopaloa_a5-PA KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE
********:************* **:******.*****:*********.*
D_melanogaster_a5-PA LMKTLYGVSE
D_sechellia_a5-PA LMKTLYGVSE
D_simulans_a5-PA LMKTLYGVSE
D_yakuba_a5-PA LMKTLYGVSE
D_erecta_a5-PA LMKTLYGVSE
D_takahashii_a5-PA LMKTLYGVSE
D_suzukii_a5-PA LMKTLYGVNE
D_rhopaloa_a5-PA LMKTLYGVDE
********.*
>D_melanogaster_a5-PA ATGAAATTGCCTGCATTGCATTTGTTATTCCTGGGCTTTATTTGCCTGGC TCGCAGCCAGGATAACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG AGGTGATCCCAGAAATTTTGGATGAGCCTCCGAGGGAGTTACTTAGGATC AAGTACGACAACACCATTGACATAGAGGAGGGCAAGACCTATACTCCGAC GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAACCGAGAGAATCCC ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA TATTATGAAGGGGCAACCGATATCGGAGTACTTCGGTCCTCTGCCTCCAA AGGATAGTGGTATTCAGCGGTATCTTATTCTTGTGTATCAGCAATCTGAT AAGCTGGACTTTGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA TAGTAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCAC CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG TTGATGAAGACACTGTATGGTGTCAGTGAG >D_sechellia_a5-PA ATGAAATGGCTTGCATTGCATTTGTTATTCCTGGGCTTTATTTGCCTAGC TCGCAGCCAGGATGACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG AGGTGATCCCCGAAATTTTGGACGAGCCTCCGAGGGAGTTACTCAGGATC AAGTACGACAACACCATTGACATCGAGGAGGGCAAGACCTATACTCCGAC GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAATCGAGAGAATCCC ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA TATAATGAAGGGGCAGCCCATATCGGAGTACTTCGGTCCCCTGCCTCCAA AGGATAGTGGCATTCAGCGGTATCTAATTCTGGTGTATCAGCAATCCGAT AAGCTGGACTTCGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA TAGCAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCTC CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG TTAATGAAGACACTCTATGGCGTCAGTGAG >D_simulans_a5-PA ATGAAATTGCTTGCATTGCATTTGTTATTCCTCGGGTTTATTTGCCTGGC TCGCAGCCAGGATAACGACGAGAATGTCAGAAGGATAATGAAGGAAATGG AGGTGATCCCCGAAATTTTGGACGAGCCTCCGAGGGAGTTACTCAGGATC AAGTACGACAACACCATTGACATCGAGGAGGGCAAGACCTATACTCCGAC GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAACGCGGATCCTGAGTCCT TCTACACCGTGCTCATGATCTGTCCCGATGCTCCGAACCGAGAGAATCCC ATGTACCGTTCCTGGCTCCATTGGCTGGTGGTCAATGTTCCCGGATTGGA TATAATGAAGGGGCAGCCGATATCGGACTACTTCGGTCCCCTGCCTCCAA AGGATAGTGGCATTCAGCGGTATCTTATTCTGGTGTATCAGCAATCCGAT AAGCTGGACTTCGACGAGAAGAAAATGGAGCTTAGCAATGCCGATGGTCA CAGCAATTTTGACGTGATGAAGTTCACCCAGAAATACGAGATGGGCTCTC CAGTGGCGGGTAATATATTCCAGTCCAGGTGGGATGAATATGTGCCCGAG TTGATGAAGACACTCTATGGCGTCAGTGAG >D_yakuba_a5-PA ATGAAATTGCTCGCTTTGCATTTGTTATTCCTGTGCTTTGTGGGCCTGGC TTGCAGTCAGGATAATGACGAGAATGTCAGAAGGATAATGAAAGAAATGG CGGTGATACCCGAAATTTTGGACGAGCCTCCGAGGGAGTTGCTTAGGATC AAGTACGACAACACCTTCGATATAGAGGAGGGCAAGACCTATACTCCCAC GGAGCTCAAGTTCCAGCCGAGACTCGACTGGAATGCGGATCCCGAGTCCT TCTACACCGTGCTCATGATTTGTCCCGATGCTCCGAACCGAGAGAATCCC ATGTACCGCTCCTGGCTGCATTGGCTGGTGGTCAATGTTCCCGGACTGGA CATAATGAAGGGCCAACCGATATCGGAGTACTTCGGTCCCCTACCGACCA AGGATAGTGGCATTCAGCGATATCTTATTCTGGTGTATCAGCAGTCCGAC AAACTGGACTTCGACGAGAAGAAAATGGAGCTGAGCAATGCCGACGGTCA TAGCAACTTTGACGTGATGAAGTTCACCCAGAAGTATGAGATGGGCCCTC CAGTGGCCGGTAATATTTTTCAGTCCAGGTGGGATGAGTATGTGCCCGAG TTGATGAAGACACTCTATGGTGTCAGTGAG >D_erecta_a5-PA ATGAAATTGCTTGCATTGCATTTGTTATTCCTGGCTTCCATTTGCCTCGT TCGCAGTCAGGACAACGACGAGGATGTCCGGAGGATCATGAAGGAAATGG CGGTGATCCCCGACATTCTGGACGAGCCCCCGAGGCAGTTGCTTAGGGTC AAGTACGACAACACCTTTGATATCGAGGAGGGCAAGACCTATACTCCCAC GGAGCTGAAGTTCCAGCCGCGACTCGACTGGAATGCGGATCCCGAGTCCT TCTACACCGTGCTCATGATTTGTCCCGATGCGCCGAACCGGGAGAATCCC ATGTACCGCTCCTGGCTCCACTGGCTGGTGGTCAATGTACCCGGATTGGA CGTAATGAAGGGCCAGCCGATATCGGAGTACTTCGGCCCACTGCCTCCAA AGGATAGTGGCATTCAGCGCTATCTTATTCTGGTGTATCAGCAGTCCGAC AAACTGGACTTCGACGAGAAGAAAATGGAGCTGAGCAACGCCGATGGTCA CAGCAATTTCGACGTGATGAAGTTCGCCCAGAAATACGAGATGGGCCCTC CAGTGGCGGGAAATGTGTTCCAGTCCAGGTGGGATGAGTACGTGTCCGAG CTGATGAAGACACTCTATGGTGTCAGTGAG >D_takahashii_a5-PA ATGAAATTGCTGGTCTGTCATTTGCTATTCCTGGGCTTTATTTGCCTAGG TCGCAGTCAGGACGATAGCGAGAATGTCAGAAGGATAATGAAGGAAATGG AGGTGATCCCGGAAATTTTAGACGAGCCTCCCAGGGAATTACTTAGGATA AAATATGACAACACCTTTGACATTGAGGAGGGCAAGTCCTATACTCCGAG TGAGCTCAAGTTCCAACCCAGGCTCGATTGGAATGCGGATCCCGAGTCCT TTTACACCGTGGTAATGATTTGTCCCGATGCTCCGAATCGCGATAATCCC ATGTATCGCTCCTGGCTCCACTGGTTGGTGGTCAATATTCCCGGATTGGA TATAATGAAGGGTCAACCGATTTCGGAATACTTTGGTCCTCTTCCGCCAA AGGACAGTGGAGTCCAGCGGTATCTCCTTCTCGTGTATCAGCAGTCGGAT AAACTGGACTTCGATGAGAAGAAAATCGAGCTAAGCAATGCCGATGGTCA TAGCAATTTTGATGTCAAGAAATTCGCGCAGAAATATGAAATGGGATCGC CCGTGGCGGGAAATATATTCCAATCCCGGTGGGATGAATATGTGCCGGAA CTGATGAAGACACTCTATGGTGTCAGCGAG >D_suzukii_a5-PA ATGAAATTGATAGTATGTCATTGGATATTCCTGGGCTTTATTTGCCTAAG TCGAAGTCAGGACGACAATGATAATGTTAGAAGGATAATGAAGGAAATGG AGGTAACCCCAGATATCTTAGAGGAGCCTCCAAGGGAGTTACTTAGGATA AAATATGAGAACACCTTTGACATTGAGGAGGGCAAGACCTATACTCCTAC AGAGCTGAAATTCCAACCCAGACTGGATTGGAATGCGGATCCTGAGTCCT TTTACACGGTGGTTATGATCTGCCCCGATGCTCCGAATCGTGAGAATCCG ATGTATCGTTCTTGGCTTCATTGGTTGGTTGTCAATATCCCCGGTTTGGA TATAATGAAGGGTCAACCGGTATCGGATTACTTTGGTCCTTTACCACCAA AAGATAGTGGAACTCAGCGTTATCTTATTCTGGTGTATCAGCAATCGGAT AAACTGGATTTCGATGAGAAGAAAATCGAACTGAGCAATGCCGATGGTCA TAGCAATTTCGATGTAAAGAAATTTGCGCAGAAATATGAAATGGGAACTC CGGTGGCAGGAAATATATTCCAATCCAGGTGGGATGAATATGTGCCGGAA CTGATGAAGACACTCTATGGAGTCAATGAG >D_rhopaloa_a5-PA ATGAAATTGCATGGGTTACTTTTGCTATTCCTGGGCTTCATTTGCCTGAG TCGCAGTCAGGACGAAAATGAGAATGTTCGCAGGATAATGAAGGAAATGG AGGTGATCCCTGAAATTTTAGATGAACCGCCCAACGAATTACTCAGGATT AAATATGACAACACCTTTGACATCGAAGAGGGCAAGTCCTATACTCCAAA AGAACTTAAATTCCAACCCAGACTTGATTGGAACGCGGATCCTGAGACAT TTTACACTGTGGTTATGATTTGTCCCGATGCTCCGAATCGTGAGAATCCC ATGTACCGATCCTGGCTTCATTGGCTGGTGGTCAATGTTCCCGGATTGGA TATAATGAAGGGTCAACCCATATCGGATTACTTTGGTCCTCTGCCACCAA AAGACAGTGGAGTTCAGCGCTATCTTATTCTGGTCTATCGGCAATCGGAT AAACTGGATTTTGATGAGAAGAAGATAGAGCTAAGTAATGCCGATGGTCA TAGCAATTTTGATGTGATGAAGTTTGCCCAGAAGTACGAAATGGGAACTC CAGTGGCGGGAAATATATTCCAATCCAGGTGGGATGAATATGTTCCGGAG TTGATGAAGACACTCTATGGTGTTGATGAG
>D_melanogaster_a5-PA MKLPALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE LMKTLYGVSE >D_sechellia_a5-PA MKWLALHLLFLGFICLARSQDDDENVRRIMKEMEVIPEILDEPPRELLRI KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE LMKTLYGVSE >D_simulans_a5-PA MKLLALHLLFLGFICLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRI KYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGIQRYLILVYQQSD KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPE LMKTLYGVSE >D_yakuba_a5-PA MKLLALHLLFLCFVGLACSQDNDENVRRIMKEMAVIPEILDEPPRELLRI KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP MYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPTKDSGIQRYLILVYQQSD KLDFDEKKMELSNADGHSNFDVMKFTQKYEMGPPVAGNIFQSRWDEYVPE LMKTLYGVSE >D_erecta_a5-PA MKLLALHLLFLASICLVRSQDNDEDVRRIMKEMAVIPDILDEPPRQLLRV KYDNTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENP MYRSWLHWLVVNVPGLDVMKGQPISEYFGPLPPKDSGIQRYLILVYQQSD KLDFDEKKMELSNADGHSNFDVMKFAQKYEMGPPVAGNVFQSRWDEYVSE LMKTLYGVSE >D_takahashii_a5-PA MKLLVCHLLFLGFICLGRSQDDSENVRRIMKEMEVIPEILDEPPRELLRI KYDNTFDIEEGKSYTPSELKFQPRLDWNADPESFYTVVMICPDAPNRDNP MYRSWLHWLVVNIPGLDIMKGQPISEYFGPLPPKDSGVQRYLLLVYQQSD KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGSPVAGNIFQSRWDEYVPE LMKTLYGVSE >D_suzukii_a5-PA MKLIVCHWIFLGFICLSRSQDDNDNVRRIMKEMEVTPDILEEPPRELLRI KYENTFDIEEGKTYTPTELKFQPRLDWNADPESFYTVVMICPDAPNRENP MYRSWLHWLVVNIPGLDIMKGQPVSDYFGPLPPKDSGTQRYLILVYQQSD KLDFDEKKIELSNADGHSNFDVKKFAQKYEMGTPVAGNIFQSRWDEYVPE LMKTLYGVNE >D_rhopaloa_a5-PA MKLHGLLLLFLGFICLSRSQDENENVRRIMKEMEVIPEILDEPPNELLRI KYDNTFDIEEGKSYTPKELKFQPRLDWNADPETFYTVVMICPDAPNRENP MYRSWLHWLVVNVPGLDIMKGQPISDYFGPLPPKDSGVQRYLILVYRQSD KLDFDEKKIELSNADGHSNFDVMKFAQKYEMGTPVAGNIFQSRWDEYVPE LMKTLYGVDE
#NEXUS
[ID: 9350185240]
begin taxa;
dimensions ntax=8;
taxlabels
D_melanogaster_a5-PA
D_sechellia_a5-PA
D_simulans_a5-PA
D_yakuba_a5-PA
D_erecta_a5-PA
D_takahashii_a5-PA
D_suzukii_a5-PA
D_rhopaloa_a5-PA
;
end;
begin trees;
translate
1 D_melanogaster_a5-PA,
2 D_sechellia_a5-PA,
3 D_simulans_a5-PA,
4 D_yakuba_a5-PA,
5 D_erecta_a5-PA,
6 D_takahashii_a5-PA,
7 D_suzukii_a5-PA,
8 D_rhopaloa_a5-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03700973,((4:0.08364203,5:0.1092956)0.976:0.02959897,((6:0.1083437,7:0.1830923)0.956:0.05585331,8:0.1867583)1.000:0.1650961)0.971:0.02468711,(2:0.01837576,3:0.01107743)0.784:0.00631624);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03700973,((4:0.08364203,5:0.1092956):0.02959897,((6:0.1083437,7:0.1830923):0.05585331,8:0.1867583):0.1650961):0.02468711,(2:0.01837576,3:0.01107743):0.00631624);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2201.90 -2213.60
2 -2201.35 -2213.73
--------------------------------------
TOTAL -2201.59 -2213.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/a5-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.040635 0.011452 0.840110 1.246018 1.033238 1372.71 1436.86 1.000
r(A<->C){all} 0.101926 0.000595 0.055820 0.149099 0.100420 877.08 911.30 1.000
r(A<->G){all} 0.194201 0.001132 0.134537 0.264303 0.192478 967.17 1008.60 1.000
r(A<->T){all} 0.057923 0.000319 0.025407 0.093423 0.055980 1070.98 1126.08 1.000
r(C<->G){all} 0.118431 0.000568 0.074782 0.165582 0.117221 1016.93 1045.20 1.000
r(C<->T){all} 0.482484 0.002146 0.393977 0.574789 0.482622 572.70 760.02 1.000
r(G<->T){all} 0.045036 0.000219 0.018194 0.074494 0.043798 1111.89 1188.38 1.000
pi(A){all} 0.270153 0.000268 0.241047 0.304931 0.270064 1182.04 1213.37 1.001
pi(C){all} 0.205427 0.000196 0.180047 0.233705 0.205243 1215.79 1228.38 1.000
pi(G){all} 0.266255 0.000260 0.235363 0.297851 0.266014 874.08 879.19 1.000
pi(T){all} 0.258166 0.000238 0.228124 0.288573 0.257535 761.97 957.31 1.000
alpha{1,2} 0.144688 0.000617 0.099034 0.195907 0.142201 1254.30 1288.64 1.000
alpha{3} 2.647721 0.749523 1.149993 4.329523 2.529012 1370.19 1410.54 1.000
pinvar{all} 0.206694 0.004824 0.066039 0.338086 0.209481 1267.55 1284.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/a5-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 210
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 2 3 1 5 | Ser TCT 1 1 1 0 0 0 | Tyr TAT 5 5 5 6 4 8 | Cys TGT 1 1 1 1 1 2
TTC 6 7 7 7 8 5 | TCC 3 4 4 4 6 4 | TAC 5 5 5 4 6 2 | TGC 1 1 1 2 1 1
Leu TTA 2 3 2 1 1 2 | TCA 1 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 4 6 6 5 4 | TCG 1 1 1 1 1 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 5 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 2 3 2 3 3 | Pro CCT 5 3 3 2 2 2 | His CAT 3 3 2 3 1 2 | Arg CGT 1 1 1 0 0 0
CTC 4 6 7 5 5 6 | CCC 4 7 6 8 7 7 | CAC 0 0 1 0 2 1 | CGC 1 1 1 1 3 3
CTA 0 2 0 1 0 3 | CCA 3 2 2 1 3 1 | Gln CAA 2 1 1 1 0 3 | CGA 1 1 1 2 1 0
CTG 6 5 5 8 9 4 | CCG 5 4 5 5 4 6 | CAG 6 7 7 7 9 5 | CGG 1 1 1 0 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 5 5 5 5 6 | Thr ACT 1 1 1 1 1 1 | Asn AAT 6 7 6 7 5 8 | Ser AGT 3 2 2 3 3 3
ATC 3 4 4 1 3 2 | ACC 4 4 4 5 3 2 | AAC 4 2 4 3 4 1 | AGC 2 3 3 2 2 4
ATA 4 4 4 5 1 4 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 4 4 6 | Arg AGA 2 2 2 2 0 1
Met ATG 10 10 10 10 10 8 | ACG 1 1 1 1 1 0 | AAG 10 10 10 9 9 8 | AGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 0 | Ala GCT 2 2 2 3 1 1 | Asp GAT 9 8 8 6 7 11 | Gly GGT 5 3 3 4 2 5
GTC 3 3 3 3 4 6 | GCC 1 1 1 2 2 1 | GAC 7 9 9 10 11 6 | GGC 3 5 4 5 5 2
GTA 0 0 0 0 2 1 | GCA 1 1 1 0 1 0 | Glu GAA 3 3 3 2 1 7 | GGA 1 1 1 1 2 4
GTG 7 7 7 8 8 6 | GCG 2 2 2 2 4 3 | GAG 15 15 14 15 14 10 | GGG 1 1 2 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 5 6 | Ser TCT 1 0 | Tyr TAT 8 6 | Cys TGT 1 1
TTC 5 4 | TCC 2 3 | TAC 2 4 | TGC 2 1
Leu TTA 3 3 | TCA 0 0 | *** TAA 0 0 | *** TGA 0 0
TTG 3 4 | TCG 2 2 | TAG 0 0 | Trp TGG 5 4
----------------------------------------------------------------------
Leu CTT 3 5 | Pro CCT 4 3 | His CAT 3 3 | Arg CGT 3 1
CTC 1 2 | CCC 3 6 | CAC 0 0 | CGC 0 3
CTA 1 2 | CCA 4 4 | Gln CAA 4 4 | CGA 1 1
CTG 7 6 | CCG 5 3 | CAG 4 3 | CGG 0 1
----------------------------------------------------------------------
Ile ATT 3 5 | Thr ACT 3 3 | Asn AAT 10 8 | Ser AGT 3 4
ATC 4 2 | ACC 3 1 | AAC 1 3 | AGC 2 1
ATA 6 5 | ACA 2 2 | Lys AAA 8 6 | Arg AGA 2 1
Met ATG 8 9 | ACG 1 0 | AAG 6 8 | AGG 4 3
----------------------------------------------------------------------
Val GTT 3 6 | Ala GCT 1 1 | Asp GAT 14 13 | Gly GGT 4 4
GTC 2 2 | GCC 1 2 | GAC 3 4 | GGC 2 2
GTA 4 0 | GCA 1 0 | Glu GAA 5 9 | GGA 4 4
GTG 4 5 | GCG 2 2 | GAG 12 9 | GGG 0 1
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_a5-PA
position 1: T:0.18571 C:0.21905 A:0.30476 G:0.29048
position 2: T:0.30952 C:0.17143 A:0.37143 G:0.14762
position 3: T:0.26667 C:0.24286 A:0.11429 G:0.37619
Average T:0.25397 C:0.21111 A:0.26349 G:0.27143
#2: D_sechellia_a5-PA
position 1: T:0.18571 C:0.21905 A:0.30000 G:0.29524
position 2: T:0.30952 C:0.16667 A:0.37143 G:0.15238
position 3: T:0.22381 C:0.29524 A:0.11429 G:0.36667
Average T:0.23968 C:0.22698 A:0.26190 G:0.27143
#3: D_simulans_a5-PA
position 1: T:0.18571 C:0.21905 A:0.30476 G:0.29048
position 2: T:0.31429 C:0.16667 A:0.37143 G:0.14762
position 3: T:0.21905 C:0.30476 A:0.10000 G:0.37619
Average T:0.23968 C:0.23016 A:0.25873 G:0.27143
#4: D_yakuba_a5-PA
position 1: T:0.18571 C:0.21905 A:0.30000 G:0.29524
position 2: T:0.31429 C:0.17143 A:0.36667 G:0.14762
position 3: T:0.22381 C:0.29524 A:0.10000 G:0.38095
Average T:0.24127 C:0.22857 A:0.25556 G:0.27460
#5: D_erecta_a5-PA
position 1: T:0.18095 C:0.24286 A:0.26667 G:0.30952
position 2: T:0.31429 C:0.17619 A:0.36667 G:0.14286
position 3: T:0.17619 C:0.34286 A:0.08095 G:0.40000
Average T:0.22381 C:0.25397 A:0.23810 G:0.28413
#6: D_takahashii_a5-PA
position 1: T:0.19048 C:0.22857 A:0.28095 G:0.30000
position 2: T:0.30952 C:0.15238 A:0.37143 G:0.16667
position 3: T:0.27143 C:0.25238 A:0.15714 G:0.31905
Average T:0.25714 C:0.21111 A:0.26984 G:0.26190
#7: D_suzukii_a5-PA
position 1: T:0.18571 C:0.20476 A:0.31429 G:0.29524
position 2: T:0.29524 C:0.16667 A:0.38095 G:0.15714
position 3: T:0.32857 C:0.15714 A:0.21429 G:0.30000
Average T:0.26984 C:0.17619 A:0.30317 G:0.25079
#8: D_rhopaloa_a5-PA
position 1: T:0.18095 C:0.22381 A:0.29048 G:0.30476
position 2: T:0.31429 C:0.15238 A:0.38095 G:0.15238
position 3: T:0.32857 C:0.19048 A:0.19524 G:0.28571
Average T:0.27460 C:0.18889 A:0.28889 G:0.24762
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 27 | Ser S TCT 4 | Tyr Y TAT 47 | Cys C TGT 9
TTC 49 | TCC 30 | TAC 33 | TGC 10
Leu L TTA 17 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 38 | TCG 12 | TAG 0 | Trp W TGG 34
------------------------------------------------------------------------------
Leu L CTT 25 | Pro P CCT 24 | His H CAT 20 | Arg R CGT 7
CTC 36 | CCC 48 | CAC 4 | CGC 13
CTA 9 | CCA 20 | Gln Q CAA 16 | CGA 8
CTG 50 | CCG 37 | CAG 48 | CGG 8
------------------------------------------------------------------------------
Ile I ATT 40 | Thr T ACT 12 | Asn N AAT 57 | Ser S AGT 23
ATC 23 | ACC 26 | AAC 22 | AGC 19
ATA 33 | ACA 10 | Lys K AAA 37 | Arg R AGA 12
Met M ATG 75 | ACG 6 | AAG 70 | AGG 31
------------------------------------------------------------------------------
Val V GTT 14 | Ala A GCT 13 | Asp D GAT 76 | Gly G GGT 30
GTC 26 | GCC 11 | GAC 59 | GGC 28
GTA 7 | GCA 5 | Glu E GAA 33 | GGA 18
GTG 52 | GCG 19 | GAG 104 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18512 C:0.22202 A:0.29524 G:0.29762
position 2: T:0.31012 C:0.16548 A:0.37262 G:0.15179
position 3: T:0.25476 C:0.26012 A:0.13452 G:0.35060
Average T:0.25000 C:0.21587 A:0.26746 G:0.26667
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_a5-PA
D_sechellia_a5-PA 0.0361 (0.0061 0.1680)
D_simulans_a5-PA 0.0270 (0.0040 0.1495) 0.0963 (0.0061 0.0629)
D_yakuba_a5-PA 0.0427 (0.0194 0.4538) 0.0502 (0.0215 0.4276) 0.0516 (0.0204 0.3956)
D_erecta_a5-PA 0.0602 (0.0320 0.5318) 0.0762 (0.0341 0.4474) 0.0808 (0.0320 0.3959) 0.0830 (0.0352 0.4243)
D_takahashii_a5-PA 0.0480 (0.0403 0.8401) 0.0466 (0.0382 0.8194) 0.0465 (0.0403 0.8669) 0.0538 (0.0522 0.9695) 0.0556 (0.0589 1.0593)
D_suzukii_a5-PA 0.0538 (0.0564 1.0479) 0.0531 (0.0542 1.0209) 0.0466 (0.0520 1.1169) 0.0442 (0.0663 1.4980) 0.0459 (0.0687 1.4974) 0.0830 (0.0457 0.5502)
D_rhopaloa_a5-PA 0.0556 (0.0500 0.8993) 0.0570 (0.0500 0.8770) 0.0501 (0.0478 0.9548) 0.0437 (0.0620 1.4202) 0.0518 (0.0666 1.2864) 0.0691 (0.0490 0.7087) 0.0873 (0.0575 0.6590)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
lnL(ntime: 13 np: 15): -2075.259669 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.070303 0.034511 0.067700 0.157897 0.236429 0.311970 0.076656 0.200591 0.291295 0.299141 0.016622 0.037312 0.021453 1.497640 0.064162
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.82188
(1: 0.070303, ((4: 0.157897, 5: 0.236429): 0.067700, ((6: 0.200591, 7: 0.291295): 0.076656, 8: 0.299141): 0.311970): 0.034511, (2: 0.037312, 3: 0.021453): 0.016622);
(D_melanogaster_a5-PA: 0.070303, ((D_yakuba_a5-PA: 0.157897, D_erecta_a5-PA: 0.236429): 0.067700, ((D_takahashii_a5-PA: 0.200591, D_suzukii_a5-PA: 0.291295): 0.076656, D_rhopaloa_a5-PA: 0.299141): 0.311970): 0.034511, (D_sechellia_a5-PA: 0.037312, D_simulans_a5-PA: 0.021453): 0.016622);
Detailed output identifying parameters
kappa (ts/tv) = 1.49764
omega (dN/dS) = 0.06416
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.070 492.9 137.1 0.0642 0.0056 0.0875 2.8 12.0
9..10 0.035 492.9 137.1 0.0642 0.0028 0.0430 1.4 5.9
10..11 0.068 492.9 137.1 0.0642 0.0054 0.0843 2.7 11.6
11..4 0.158 492.9 137.1 0.0642 0.0126 0.1966 6.2 26.9
11..5 0.236 492.9 137.1 0.0642 0.0189 0.2943 9.3 40.3
10..12 0.312 492.9 137.1 0.0642 0.0249 0.3884 12.3 53.2
12..13 0.077 492.9 137.1 0.0642 0.0061 0.0954 3.0 13.1
13..6 0.201 492.9 137.1 0.0642 0.0160 0.2497 7.9 34.2
13..7 0.291 492.9 137.1 0.0642 0.0233 0.3626 11.5 49.7
12..8 0.299 492.9 137.1 0.0642 0.0239 0.3724 11.8 51.0
9..14 0.017 492.9 137.1 0.0642 0.0013 0.0207 0.7 2.8
14..2 0.037 492.9 137.1 0.0642 0.0030 0.0464 1.5 6.4
14..3 0.021 492.9 137.1 0.0642 0.0017 0.0267 0.8 3.7
tree length for dN: 0.1455
tree length for dS: 2.2680
Time used: 0:08
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
lnL(ntime: 13 np: 16): -2063.616043 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.071403 0.035429 0.067697 0.159973 0.238895 0.323663 0.075084 0.199755 0.302398 0.308351 0.017001 0.037833 0.021624 1.566817 0.936104 0.039797
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.85911
(1: 0.071403, ((4: 0.159973, 5: 0.238895): 0.067697, ((6: 0.199755, 7: 0.302398): 0.075084, 8: 0.308351): 0.323663): 0.035429, (2: 0.037833, 3: 0.021624): 0.017001);
(D_melanogaster_a5-PA: 0.071403, ((D_yakuba_a5-PA: 0.159973, D_erecta_a5-PA: 0.238895): 0.067697, ((D_takahashii_a5-PA: 0.199755, D_suzukii_a5-PA: 0.302398): 0.075084, D_rhopaloa_a5-PA: 0.308351): 0.323663): 0.035429, (D_sechellia_a5-PA: 0.037833, D_simulans_a5-PA: 0.021624): 0.017001);
Detailed output identifying parameters
kappa (ts/tv) = 1.56682
dN/dS (w) for site classes (K=2)
p: 0.93610 0.06390
w: 0.03980 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.071 491.5 138.5 0.1012 0.0081 0.0797 4.0 11.0
9..10 0.035 491.5 138.5 0.1012 0.0040 0.0395 2.0 5.5
10..11 0.068 491.5 138.5 0.1012 0.0076 0.0755 3.8 10.5
11..4 0.160 491.5 138.5 0.1012 0.0181 0.1785 8.9 24.7
11..5 0.239 491.5 138.5 0.1012 0.0270 0.2666 13.3 36.9
10..12 0.324 491.5 138.5 0.1012 0.0365 0.3612 18.0 50.0
12..13 0.075 491.5 138.5 0.1012 0.0085 0.0838 4.2 11.6
13..6 0.200 491.5 138.5 0.1012 0.0225 0.2229 11.1 30.9
13..7 0.302 491.5 138.5 0.1012 0.0341 0.3374 16.8 46.7
12..8 0.308 491.5 138.5 0.1012 0.0348 0.3441 17.1 47.6
9..14 0.017 491.5 138.5 0.1012 0.0019 0.0190 0.9 2.6
14..2 0.038 491.5 138.5 0.1012 0.0043 0.0422 2.1 5.8
14..3 0.022 491.5 138.5 0.1012 0.0024 0.0241 1.2 3.3
Time used: 0:21
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
lnL(ntime: 13 np: 18): -2063.616045 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.071403 0.035429 0.067697 0.159973 0.238895 0.323663 0.075084 0.199756 0.302398 0.308352 0.017001 0.037833 0.021624 1.566815 0.936104 0.063896 0.039797 62.278953
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.85911
(1: 0.071403, ((4: 0.159973, 5: 0.238895): 0.067697, ((6: 0.199756, 7: 0.302398): 0.075084, 8: 0.308352): 0.323663): 0.035429, (2: 0.037833, 3: 0.021624): 0.017001);
(D_melanogaster_a5-PA: 0.071403, ((D_yakuba_a5-PA: 0.159973, D_erecta_a5-PA: 0.238895): 0.067697, ((D_takahashii_a5-PA: 0.199756, D_suzukii_a5-PA: 0.302398): 0.075084, D_rhopaloa_a5-PA: 0.308352): 0.323663): 0.035429, (D_sechellia_a5-PA: 0.037833, D_simulans_a5-PA: 0.021624): 0.017001);
Detailed output identifying parameters
kappa (ts/tv) = 1.56682
dN/dS (w) for site classes (K=3)
p: 0.93610 0.06390 0.00000
w: 0.03980 1.00000 62.27895
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.071 491.5 138.5 0.1012 0.0081 0.0797 4.0 11.0
9..10 0.035 491.5 138.5 0.1012 0.0040 0.0395 2.0 5.5
10..11 0.068 491.5 138.5 0.1012 0.0076 0.0755 3.8 10.5
11..4 0.160 491.5 138.5 0.1012 0.0181 0.1785 8.9 24.7
11..5 0.239 491.5 138.5 0.1012 0.0270 0.2666 13.3 36.9
10..12 0.324 491.5 138.5 0.1012 0.0365 0.3612 18.0 50.0
12..13 0.075 491.5 138.5 0.1012 0.0085 0.0838 4.2 11.6
13..6 0.200 491.5 138.5 0.1012 0.0225 0.2229 11.1 30.9
13..7 0.302 491.5 138.5 0.1012 0.0341 0.3374 16.8 46.7
12..8 0.308 491.5 138.5 0.1012 0.0348 0.3441 17.1 47.6
9..14 0.017 491.5 138.5 0.1012 0.0019 0.0190 0.9 2.6
14..2 0.038 491.5 138.5 0.1012 0.0043 0.0422 2.1 5.8
14..3 0.022 491.5 138.5 0.1012 0.0024 0.0241 1.2 3.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_a5-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.900 0.036 0.012 0.009 0.008 0.007 0.007 0.007 0.007 0.007
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.997
sum of density on p0-p1 = 1.000000
Time used: 1:06
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
lnL(ntime: 13 np: 19): -2057.332570 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.071374 0.034483 0.069276 0.160511 0.240890 0.325024 0.072211 0.202814 0.300023 0.310367 0.016988 0.037878 0.021716 1.467251 0.209844 0.639488 0.021502 0.021502 0.362392
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.86355
(1: 0.071374, ((4: 0.160511, 5: 0.240890): 0.069276, ((6: 0.202814, 7: 0.300023): 0.072211, 8: 0.310367): 0.325024): 0.034483, (2: 0.037878, 3: 0.021716): 0.016988);
(D_melanogaster_a5-PA: 0.071374, ((D_yakuba_a5-PA: 0.160511, D_erecta_a5-PA: 0.240890): 0.069276, ((D_takahashii_a5-PA: 0.202814, D_suzukii_a5-PA: 0.300023): 0.072211, D_rhopaloa_a5-PA: 0.310367): 0.325024): 0.034483, (D_sechellia_a5-PA: 0.037878, D_simulans_a5-PA: 0.021716): 0.016988);
Detailed output identifying parameters
kappa (ts/tv) = 1.46725
dN/dS (w) for site classes (K=3)
p: 0.20984 0.63949 0.15067
w: 0.02150 0.02150 0.36239
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.071 493.6 136.4 0.0729 0.0063 0.0869 3.1 11.9
9..10 0.034 493.6 136.4 0.0729 0.0031 0.0420 1.5 5.7
10..11 0.069 493.6 136.4 0.0729 0.0061 0.0844 3.0 11.5
11..4 0.161 493.6 136.4 0.0729 0.0142 0.1955 7.0 26.7
11..5 0.241 493.6 136.4 0.0729 0.0214 0.2934 10.6 40.0
10..12 0.325 493.6 136.4 0.0729 0.0288 0.3959 14.2 54.0
12..13 0.072 493.6 136.4 0.0729 0.0064 0.0880 3.2 12.0
13..6 0.203 493.6 136.4 0.0729 0.0180 0.2471 8.9 33.7
13..7 0.300 493.6 136.4 0.0729 0.0266 0.3655 13.1 49.9
12..8 0.310 493.6 136.4 0.0729 0.0275 0.3781 13.6 51.6
9..14 0.017 493.6 136.4 0.0729 0.0015 0.0207 0.7 2.8
14..2 0.038 493.6 136.4 0.0729 0.0034 0.0461 1.7 6.3
14..3 0.022 493.6 136.4 0.0729 0.0019 0.0265 1.0 3.6
Naive Empirical Bayes (NEB) analysis
Time used: 1:27
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
lnL(ntime: 13 np: 16): -2057.836061 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.071259 0.034478 0.069017 0.160469 0.240880 0.324457 0.071413 0.203071 0.299570 0.310168 0.016951 0.037814 0.021692 1.472715 0.221051 2.654033
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.86124
(1: 0.071259, ((4: 0.160469, 5: 0.240880): 0.069017, ((6: 0.203071, 7: 0.299570): 0.071413, 8: 0.310168): 0.324457): 0.034478, (2: 0.037814, 3: 0.021692): 0.016951);
(D_melanogaster_a5-PA: 0.071259, ((D_yakuba_a5-PA: 0.160469, D_erecta_a5-PA: 0.240880): 0.069017, ((D_takahashii_a5-PA: 0.203071, D_suzukii_a5-PA: 0.299570): 0.071413, D_rhopaloa_a5-PA: 0.310168): 0.324457): 0.034478, (D_sechellia_a5-PA: 0.037814, D_simulans_a5-PA: 0.021692): 0.016951);
Detailed output identifying parameters
kappa (ts/tv) = 1.47271
Parameters in M7 (beta):
p = 0.22105 q = 2.65403
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00005 0.00055 0.00252 0.00792 0.01994 0.04386 0.08905 0.17636 0.38288
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.071 493.5 136.5 0.0723 0.0063 0.0869 3.1 11.9
9..10 0.034 493.5 136.5 0.0723 0.0030 0.0420 1.5 5.7
10..11 0.069 493.5 136.5 0.0723 0.0061 0.0842 3.0 11.5
11..4 0.160 493.5 136.5 0.0723 0.0141 0.1957 7.0 26.7
11..5 0.241 493.5 136.5 0.0723 0.0212 0.2937 10.5 40.1
10..12 0.324 493.5 136.5 0.0723 0.0286 0.3956 14.1 54.0
12..13 0.071 493.5 136.5 0.0723 0.0063 0.0871 3.1 11.9
13..6 0.203 493.5 136.5 0.0723 0.0179 0.2476 8.8 33.8
13..7 0.300 493.5 136.5 0.0723 0.0264 0.3653 13.0 49.9
12..8 0.310 493.5 136.5 0.0723 0.0273 0.3782 13.5 51.6
9..14 0.017 493.5 136.5 0.0723 0.0015 0.0207 0.7 2.8
14..2 0.038 493.5 136.5 0.0723 0.0033 0.0461 1.6 6.3
14..3 0.022 493.5 136.5 0.0723 0.0019 0.0265 0.9 3.6
Time used: 2:18
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 270
lnL(ntime: 13 np: 18): -2057.836428 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.071260 0.034478 0.069017 0.160470 0.240881 0.324459 0.071414 0.203072 0.299571 0.310169 0.016951 0.037814 0.021692 1.472724 0.999990 0.221065 2.654389 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.86125
(1: 0.071260, ((4: 0.160470, 5: 0.240881): 0.069017, ((6: 0.203072, 7: 0.299571): 0.071414, 8: 0.310169): 0.324459): 0.034478, (2: 0.037814, 3: 0.021692): 0.016951);
(D_melanogaster_a5-PA: 0.071260, ((D_yakuba_a5-PA: 0.160470, D_erecta_a5-PA: 0.240881): 0.069017, ((D_takahashii_a5-PA: 0.203072, D_suzukii_a5-PA: 0.299571): 0.071414, D_rhopaloa_a5-PA: 0.310169): 0.324459): 0.034478, (D_sechellia_a5-PA: 0.037814, D_simulans_a5-PA: 0.021692): 0.016951);
Detailed output identifying parameters
kappa (ts/tv) = 1.47272
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.22107 q = 2.65439
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00005 0.00055 0.00252 0.00792 0.01994 0.04386 0.08905 0.17635 0.38285 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.071 493.5 136.5 0.0723 0.0063 0.0869 3.1 11.9
9..10 0.034 493.5 136.5 0.0723 0.0030 0.0420 1.5 5.7
10..11 0.069 493.5 136.5 0.0723 0.0061 0.0842 3.0 11.5
11..4 0.160 493.5 136.5 0.0723 0.0141 0.1957 7.0 26.7
11..5 0.241 493.5 136.5 0.0723 0.0212 0.2937 10.5 40.1
10..12 0.324 493.5 136.5 0.0723 0.0286 0.3956 14.1 54.0
12..13 0.071 493.5 136.5 0.0723 0.0063 0.0871 3.1 11.9
13..6 0.203 493.5 136.5 0.0723 0.0179 0.2476 8.8 33.8
13..7 0.300 493.5 136.5 0.0723 0.0264 0.3653 13.0 49.9
12..8 0.310 493.5 136.5 0.0723 0.0274 0.3782 13.5 51.6
9..14 0.017 493.5 136.5 0.0723 0.0015 0.0207 0.7 2.8
14..2 0.038 493.5 136.5 0.0723 0.0033 0.0461 1.6 6.3
14..3 0.022 493.5 136.5 0.0723 0.0019 0.0265 0.9 3.6
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_a5-PA)
Pr(w>1) post mean +- SE for w
17 A 0.528 1.083 +- 0.535
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.001 0.012 0.054 0.149 0.299 0.484
ws: 0.837 0.050 0.020 0.015 0.014 0.013 0.013 0.013 0.013 0.013
Time used: 3:49
Model 1: NearlyNeutral -2063.616043 Model 2: PositiveSelection -2063.616045 Model 0: one-ratio -2075.259669 Model 3: discrete -2057.33257 Model 7: beta -2057.836061 Model 8: beta&w>1 -2057.836428 Model 0 vs 1 23.28725200000008 Model 2 vs 1 4.000000444648322E-6 Model 8 vs 7 7.340000001931912E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
