--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 22:11:50 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/825-Oak-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -889.70 -897.64
2 -889.77 -897.94
--------------------------------------
TOTAL -889.74 -897.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.522852 0.020542 0.280878 0.803748 0.497287 787.91 1144.45 1.000
r(A<->C){all} 0.117885 0.005050 0.001770 0.257085 0.106542 560.09 568.91 1.001
r(A<->G){all} 0.212347 0.007059 0.059244 0.372296 0.205007 496.56 558.65 1.002
r(A<->T){all} 0.237229 0.007176 0.082699 0.399957 0.227723 783.27 809.42 1.002
r(C<->G){all} 0.128731 0.002684 0.044040 0.235406 0.121330 807.66 845.39 1.001
r(C<->T){all} 0.176114 0.003498 0.060535 0.285755 0.171138 747.84 807.13 1.000
r(G<->T){all} 0.127694 0.003661 0.019685 0.240768 0.119516 654.97 697.32 1.000
pi(A){all} 0.120025 0.000213 0.090364 0.147662 0.119679 1375.25 1395.52 1.000
pi(C){all} 0.365767 0.000461 0.325288 0.409917 0.365668 1293.21 1397.11 1.000
pi(G){all} 0.239168 0.000388 0.201284 0.278077 0.238387 1314.49 1321.00 1.000
pi(T){all} 0.275040 0.000406 0.236830 0.315056 0.274351 1274.11 1346.44 1.000
alpha{1,2} 0.203478 0.033950 0.000260 0.524118 0.160956 1094.65 1217.07 1.001
alpha{3} 0.906771 0.349609 0.137599 2.074984 0.748727 1246.15 1273.14 1.000
pinvar{all} 0.278017 0.027465 0.000033 0.566670 0.264733 756.55 978.69 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -776.102101
Model 2: PositiveSelection -771.423592
Model 0: one-ratio -786.152998
Model 3: discrete -771.423592
Model 7: beta -776.207867
Model 8: beta&w>1 -771.425925
Model 0 vs 1 20.101794000000154
Model 2 vs 1 9.357017999999925
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.506 3.073
66 A 0.961* 5.722
68 P 0.990* 5.891
69 L 0.993** 5.907
73 V 0.999** 5.943
76 K 0.989* 5.883
77 Y 0.978* 5.821
78 A 0.985* 5.860
80 T 0.670 4.029
89 K 0.991** 5.895
90 A 0.970* 5.773
92 T 0.670 4.029
97 R 0.501 3.046
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.791 5.415 +- 3.049
68 P 0.873 5.892 +- 2.795
69 L 0.915 6.176 +- 2.651
73 V 0.941 6.345 +- 2.530
76 K 0.882 5.967 +- 2.772
77 Y 0.822 5.569 +- 2.947
78 A 0.880 5.979 +- 2.796
80 T 0.542 3.742 +- 3.303
89 K 0.896 6.053 +- 2.722
90 A 0.784 5.315 +- 3.023
92 T 0.542 3.742 +- 3.303
Model 8 vs 7 9.563883999999916
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.505 3.074
66 A 0.959* 5.713
68 P 0.989* 5.889
69 L 0.992** 5.906
73 V 0.999** 5.944
76 K 0.988* 5.881
77 Y 0.977* 5.816
78 A 0.984* 5.857
80 T 0.669 4.029
89 K 0.990** 5.894
90 A 0.968* 5.765
92 T 0.669 4.029
97 R 0.501 3.048
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.864 5.566 +- 2.800
68 P 0.933 5.974 +- 2.516
69 L 0.956* 6.131 +- 2.415
73 V 0.976* 6.257 +- 2.305
76 K 0.936 6.002 +- 2.509
77 Y 0.895 5.728 +- 2.675
78 A 0.930 5.985 +- 2.544
80 T 0.618 3.981 +- 3.254
89 K 0.945 6.059 +- 2.467
90 A 0.867 5.540 +- 2.764
92 T 0.618 3.981 +- 3.254
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTA
TSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAAT
PLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYTAPAPVVTATSSQVIA
RNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLAAPLAAPLAAPLAY
SSPLAYSAPLSYAAAPAPLLIoooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=149
C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
*** ***.*.:*****************:***** :**
C1 APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
C2 APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
C3 APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
C4 APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
**************************** * **. :* *:**:**:.
C1 AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
C2 AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
C3 AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
C4 AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
* *:*:** *********************:**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [2488]--->[2229]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.208 Mb, Max= 30.411 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
FORMAT of file /tmp/tmp1440418097538211609aln Not Supported[FATAL:T-COFFEE]
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:149 S:89 BS:149
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 95.35 C1 C2 95.35
TOP 1 0 95.35 C2 C1 95.35
BOT 0 2 95.35 C1 C3 95.35
TOP 2 0 95.35 C3 C1 95.35
BOT 0 3 81.89 C1 C4 81.89
TOP 3 0 81.89 C4 C1 81.89
BOT 1 2 97.04 C2 C3 97.04
TOP 2 1 97.04 C3 C2 97.04
BOT 1 3 81.82 C2 C4 81.82
TOP 3 1 81.82 C4 C2 81.82
BOT 2 3 82.64 C3 C4 82.64
TOP 3 2 82.64 C4 C3 82.64
AVG 0 C1 * 90.86
AVG 1 C2 * 91.40
AVG 2 C3 * 91.68
AVG 3 C4 * 82.12
TOT TOT * 89.01
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC
C2 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
C3 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
C4 ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC
**********.*** ** ** * ** * .*******************
C1 CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
C2 CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
C3 CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
C4 CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT
********************* ** * ** ***:******* *******
C1 AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C2 ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C3 ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C4 AC---------------------------------------ACTGCTCCT
** .*******
C1 GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA
C2 GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
C3 GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
C4 GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA
*****************.************** *********** *****
C1 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
C2 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG
C3 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
C4 TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG
***.************** ************** * ** ..: : ** *
C1 CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG
C2 CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
C3 CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
C4 CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT
** *: **** .. . ****.********.*******: *.*
C1 GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC
C2 GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC
C3 GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC
C4 GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC
** .. *** .***** *******:* ****************
C1 TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC
C2 ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
C3 ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
C4 GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC
***** *********************** *************** ***
C1 TCATC------------------------------------------
C2 TCATC------------------------------------------
C3 TCATC------------------------------------------
C4 TCATC------------------------------------------
*****
>C1
ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG
GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC
TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C2
ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG
CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC
ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C3
ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC
ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C4
ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT
AC---------------------------------------ACTGCTCCT
GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA
TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG
CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT
GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC
GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC
TCATC------------------------------------------
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYooooooSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYoooooooooooooTAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
APoLAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 447 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480111724
Setting output file names to "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 959365650
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9304270436
Seed = 1177419686
Swapseed = 1480111724
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 25 unique site patterns
Division 2 has 19 unique site patterns
Division 3 has 33 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1043.858344 -- -26.620141
Chain 2 -- -1043.106005 -- -26.620141
Chain 3 -- -1043.858344 -- -26.620141
Chain 4 -- -1043.106005 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1043.858344 -- -26.620141
Chain 2 -- -1043.106005 -- -26.620141
Chain 3 -- -1019.873051 -- -26.620141
Chain 4 -- -1043.106005 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1043.858] (-1043.106) (-1043.858) (-1043.106) * [-1043.858] (-1043.106) (-1019.873) (-1043.106)
500 -- (-911.357) [-908.058] (-905.959) (-907.199) * (-910.720) [-910.150] (-897.476) (-902.731) -- 0:00:00
1000 -- (-896.578) (-900.751) [-897.406] (-898.907) * (-901.378) (-908.613) (-892.982) [-892.962] -- 0:00:00
1500 -- [-890.704] (-894.488) (-898.893) (-890.291) * (-902.080) (-898.299) (-890.089) [-890.443] -- 0:00:00
2000 -- (-890.971) (-888.918) [-897.468] (-892.637) * (-896.904) [-889.807] (-889.236) (-892.706) -- 0:00:00
2500 -- (-892.157) [-895.701] (-894.155) (-892.364) * (-900.795) (-892.550) (-891.458) [-889.345] -- 0:00:00
3000 -- [-892.786] (-894.602) (-892.891) (-891.720) * (-901.307) (-894.178) (-892.664) [-893.636] -- 0:00:00
3500 -- (-892.934) (-890.036) (-890.542) [-889.764] * [-892.139] (-892.830) (-895.223) (-894.182) -- 0:04:44
4000 -- (-898.397) (-889.582) (-890.974) [-892.548] * (-891.026) (-890.961) [-892.130] (-891.889) -- 0:04:09
4500 -- [-895.615] (-892.791) (-895.937) (-896.387) * [-896.389] (-897.418) (-891.345) (-891.894) -- 0:03:41
5000 -- [-894.348] (-889.416) (-892.866) (-888.086) * (-892.021) (-891.916) (-891.237) [-895.462] -- 0:03:19
Average standard deviation of split frequencies: 0.078567
5500 -- [-891.318] (-895.283) (-890.305) (-890.195) * (-889.502) (-893.491) (-890.971) [-891.820] -- 0:03:00
6000 -- [-889.577] (-892.156) (-889.913) (-892.791) * (-888.274) (-896.298) [-896.062] (-892.399) -- 0:02:45
6500 -- (-887.814) (-891.665) [-894.818] (-897.383) * (-891.952) [-896.695] (-894.613) (-890.999) -- 0:02:32
7000 -- (-890.824) (-892.247) (-898.357) [-899.606] * [-890.587] (-899.053) (-891.022) (-891.708) -- 0:02:21
7500 -- (-894.104) (-891.395) [-889.663] (-904.184) * (-892.418) (-893.019) (-888.502) [-895.467] -- 0:02:12
8000 -- (-895.381) (-897.562) [-892.908] (-894.485) * (-899.617) [-892.987] (-889.980) (-901.577) -- 0:02:04
8500 -- [-897.337] (-892.526) (-894.785) (-898.871) * (-891.703) [-893.728] (-894.007) (-894.384) -- 0:01:56
9000 -- (-891.434) (-893.522) [-891.482] (-891.126) * [-891.519] (-890.032) (-891.251) (-896.333) -- 0:01:50
9500 -- (-891.051) (-893.722) [-893.971] (-893.527) * [-891.926] (-894.590) (-894.093) (-892.695) -- 0:01:44
10000 -- [-892.692] (-890.891) (-894.602) (-893.562) * [-891.633] (-896.424) (-898.231) (-893.029) -- 0:01:39
Average standard deviation of split frequencies: 0.044194
10500 -- [-894.048] (-895.332) (-892.699) (-893.792) * (-893.717) (-893.584) [-890.432] (-891.463) -- 0:01:34
11000 -- (-889.215) [-890.292] (-900.933) (-891.019) * (-888.386) (-889.702) (-897.953) [-888.114] -- 0:02:59
11500 -- (-888.921) (-896.219) [-894.354] (-894.815) * (-892.675) [-891.788] (-894.736) (-890.141) -- 0:02:51
12000 -- [-889.862] (-887.547) (-895.801) (-893.636) * [-892.173] (-892.107) (-891.978) (-897.445) -- 0:02:44
12500 -- (-892.692) (-895.395) [-890.765] (-894.551) * (-890.289) [-890.039] (-892.499) (-891.628) -- 0:02:38
13000 -- [-893.417] (-896.011) (-891.345) (-889.126) * (-889.192) (-890.758) [-891.690] (-893.349) -- 0:02:31
13500 -- (-895.722) (-891.209) [-889.764] (-893.722) * (-887.430) (-892.053) [-888.004] (-891.277) -- 0:02:26
14000 -- [-891.161] (-889.666) (-894.307) (-901.781) * (-897.946) [-902.908] (-888.032) (-888.878) -- 0:02:20
14500 -- (-895.416) [-889.290] (-892.154) (-891.784) * (-892.799) (-890.684) [-888.877] (-897.015) -- 0:02:15
15000 -- (-890.522) [-890.177] (-896.567) (-892.785) * (-890.159) (-894.592) [-892.394] (-896.592) -- 0:02:11
Average standard deviation of split frequencies: 0.058926
15500 -- [-892.297] (-892.048) (-895.976) (-897.439) * (-891.362) (-892.485) [-888.981] (-894.792) -- 0:02:07
16000 -- (-887.316) (-899.658) [-894.445] (-898.821) * (-889.245) (-897.817) [-888.548] (-892.301) -- 0:02:03
16500 -- [-888.980] (-896.040) (-894.961) (-892.465) * [-893.725] (-894.395) (-889.612) (-891.508) -- 0:01:59
17000 -- [-890.981] (-893.134) (-891.751) (-891.346) * (-893.780) [-891.471] (-895.008) (-890.625) -- 0:01:55
17500 -- (-892.453) (-895.765) (-895.004) [-891.371] * [-891.306] (-890.533) (-891.872) (-891.168) -- 0:01:52
18000 -- (-889.243) [-892.396] (-896.469) (-889.174) * [-892.944] (-891.752) (-893.424) (-891.861) -- 0:02:43
18500 -- (-891.376) (-893.329) (-893.598) [-891.190] * [-890.936] (-888.470) (-892.966) (-899.232) -- 0:02:39
19000 -- (-890.975) (-892.056) (-898.671) [-888.841] * (-892.759) [-888.386] (-890.186) (-891.322) -- 0:02:34
19500 -- (-891.928) (-894.977) (-898.003) [-893.687] * (-889.089) [-894.689] (-897.748) (-890.903) -- 0:02:30
20000 -- (-890.813) (-896.343) (-893.456) [-891.331] * (-892.647) (-896.062) (-889.503) [-886.453] -- 0:02:27
Average standard deviation of split frequencies: 0.114049
20500 -- (-893.656) [-894.954] (-894.342) (-890.417) * (-891.846) (-894.727) (-888.307) [-888.824] -- 0:02:23
21000 -- (-893.146) (-895.718) (-895.865) [-892.532] * (-898.376) [-888.072] (-892.467) (-893.624) -- 0:02:19
21500 -- (-892.623) (-894.155) (-897.066) [-889.214] * (-888.728) (-889.126) [-893.766] (-898.790) -- 0:02:16
22000 -- (-890.360) (-895.375) [-893.898] (-890.984) * (-889.536) [-890.630] (-897.159) (-888.983) -- 0:02:13
22500 -- (-891.371) [-893.751] (-895.109) (-891.042) * (-890.606) [-888.762] (-892.288) (-890.379) -- 0:02:10
23000 -- (-890.348) (-895.563) (-897.906) [-892.268] * (-897.069) (-892.777) [-891.683] (-890.562) -- 0:02:07
23500 -- (-892.663) [-891.403] (-891.773) (-888.861) * (-890.521) (-893.427) (-892.609) [-890.327] -- 0:02:04
24000 -- (-891.406) (-894.127) [-890.552] (-893.931) * [-891.931] (-895.721) (-889.205) (-892.190) -- 0:02:02
24500 -- (-890.603) [-894.365] (-893.472) (-895.080) * (-892.898) (-895.345) [-893.407] (-891.549) -- 0:01:59
25000 -- (-888.559) (-893.996) [-893.901] (-890.189) * (-889.393) (-891.238) (-889.704) [-890.397] -- 0:02:36
Average standard deviation of split frequencies: 0.090655
25500 -- (-892.723) [-892.688] (-893.079) (-891.547) * (-892.204) [-892.086] (-889.001) (-891.946) -- 0:02:32
26000 -- (-889.229) (-894.090) (-893.805) [-890.593] * (-890.609) [-891.903] (-890.416) (-891.897) -- 0:02:29
26500 -- (-890.748) [-891.728] (-890.316) (-892.960) * [-893.485] (-893.089) (-891.197) (-889.329) -- 0:02:26
27000 -- (-889.730) [-893.787] (-893.910) (-897.351) * [-888.339] (-894.416) (-892.726) (-888.605) -- 0:02:24
27500 -- [-890.714] (-898.581) (-889.573) (-899.894) * (-892.643) (-897.188) (-896.108) [-892.054] -- 0:02:21
28000 -- (-890.660) (-897.916) [-891.335] (-901.140) * [-892.422] (-889.967) (-890.301) (-893.756) -- 0:02:18
28500 -- [-894.105] (-897.833) (-888.213) (-895.052) * (-896.001) [-888.806] (-889.698) (-892.847) -- 0:02:16
29000 -- (-896.828) [-894.850] (-893.789) (-893.342) * (-891.480) (-892.295) [-894.356] (-895.678) -- 0:02:13
29500 -- (-893.988) (-900.026) (-889.389) [-896.265] * (-893.696) [-889.442] (-891.613) (-895.968) -- 0:02:11
30000 -- (-889.790) (-893.271) (-893.631) [-893.185] * (-889.769) [-890.198] (-893.552) (-898.525) -- 0:02:09
Average standard deviation of split frequencies: 0.107603
30500 -- (-894.677) (-894.921) (-898.419) [-898.365] * (-889.773) [-891.514] (-897.380) (-896.787) -- 0:02:07
31000 -- (-893.492) [-895.379] (-893.212) (-894.244) * (-889.001) (-891.604) (-898.783) [-892.262] -- 0:02:05
31500 -- (-891.710) (-894.610) (-892.177) [-893.351] * (-892.132) [-890.915] (-891.513) (-903.102) -- 0:02:02
32000 -- (-893.520) (-892.864) [-891.333] (-894.527) * (-891.584) (-890.089) [-888.610] (-903.028) -- 0:02:31
32500 -- (-889.824) (-895.406) (-890.928) [-892.255] * [-889.971] (-889.656) (-890.511) (-904.225) -- 0:02:28
33000 -- (-889.239) (-894.773) [-890.825] (-892.070) * (-890.188) [-891.421] (-891.807) (-893.642) -- 0:02:26
33500 -- (-892.250) (-896.904) [-892.005] (-897.165) * (-892.334) [-890.730] (-893.494) (-892.683) -- 0:02:24
34000 -- (-892.443) (-893.623) (-897.284) [-889.786] * [-892.836] (-896.875) (-892.530) (-894.056) -- 0:02:22
34500 -- (-891.979) (-894.164) [-889.580] (-906.433) * (-889.131) (-895.106) (-893.854) [-886.976] -- 0:02:19
35000 -- (-892.910) [-896.731] (-891.412) (-896.640) * (-892.294) [-893.346] (-890.785) (-895.456) -- 0:02:17
Average standard deviation of split frequencies: 0.091662
35500 -- (-888.871) [-888.761] (-892.901) (-891.145) * (-894.553) (-894.836) [-893.137] (-890.945) -- 0:02:15
36000 -- [-887.153] (-889.197) (-895.897) (-892.943) * (-893.308) [-890.998] (-890.878) (-890.656) -- 0:02:13
36500 -- (-889.532) (-892.262) (-892.055) [-890.529] * [-890.467] (-891.522) (-893.470) (-893.158) -- 0:02:11
37000 -- [-891.630] (-888.920) (-891.233) (-892.683) * (-898.111) [-893.972] (-893.217) (-895.191) -- 0:02:10
37500 -- [-897.847] (-891.913) (-894.581) (-889.615) * (-892.352) (-894.390) [-894.856] (-894.594) -- 0:02:08
38000 -- (-896.380) (-888.792) [-895.651] (-889.114) * (-890.607) (-892.815) (-895.007) [-898.484] -- 0:02:06
38500 -- (-891.598) [-891.179] (-891.244) (-895.321) * (-891.277) (-897.779) [-893.729] (-896.513) -- 0:02:04
39000 -- (-893.903) (-889.032) [-891.655] (-893.212) * [-892.244] (-896.469) (-893.827) (-893.120) -- 0:02:27
39500 -- (-893.507) (-891.545) (-894.252) [-889.248] * (-891.555) (-890.498) (-893.828) [-892.105] -- 0:02:25
40000 -- (-895.898) (-890.420) (-893.102) [-891.410] * (-891.824) [-888.040] (-894.417) (-891.470) -- 0:02:24
Average standard deviation of split frequencies: 0.092735
40500 -- (-902.870) (-890.525) (-903.786) [-889.832] * [-891.579] (-891.828) (-890.546) (-895.868) -- 0:02:22
41000 -- (-895.202) (-891.416) [-888.086] (-891.948) * (-889.158) [-893.929] (-893.154) (-893.185) -- 0:02:20
41500 -- (-890.917) (-890.882) [-890.745] (-890.091) * [-891.907] (-891.010) (-895.040) (-893.780) -- 0:02:18
42000 -- (-895.481) [-891.198] (-894.361) (-889.241) * (-890.668) (-895.427) [-890.563] (-893.577) -- 0:02:16
42500 -- (-896.189) (-889.514) [-891.338] (-892.420) * [-892.326] (-895.554) (-892.875) (-892.753) -- 0:02:15
43000 -- (-900.388) [-890.391] (-893.772) (-890.925) * (-894.153) (-888.988) [-889.318] (-894.312) -- 0:02:13
43500 -- (-890.108) (-889.414) [-895.592] (-891.273) * (-889.970) (-888.810) [-889.464] (-896.287) -- 0:02:11
44000 -- [-890.066] (-887.899) (-891.976) (-889.657) * (-890.128) [-890.725] (-888.295) (-894.352) -- 0:02:10
44500 -- [-895.064] (-889.888) (-893.643) (-890.441) * [-888.728] (-892.542) (-896.476) (-893.429) -- 0:02:08
45000 -- (-894.704) (-893.118) (-904.665) [-893.839] * (-894.010) (-890.398) [-891.380] (-891.741) -- 0:02:07
Average standard deviation of split frequencies: 0.087107
45500 -- (-890.819) (-893.346) (-889.872) [-890.307] * (-894.558) [-892.516] (-890.673) (-897.306) -- 0:02:05
46000 -- (-900.924) (-890.820) (-898.494) [-889.628] * (-898.754) (-897.477) (-895.620) [-892.789] -- 0:02:04
46500 -- (-892.630) [-893.183] (-892.963) (-895.422) * (-897.977) (-891.825) [-889.251] (-893.986) -- 0:02:23
47000 -- (-891.099) (-892.789) [-890.251] (-892.149) * (-895.360) (-893.389) [-893.767] (-889.645) -- 0:02:21
47500 -- [-893.440] (-888.187) (-890.264) (-891.343) * (-895.195) (-894.278) (-892.846) [-891.785] -- 0:02:20
48000 -- (-891.618) (-896.895) [-893.636] (-892.330) * (-891.266) (-895.548) [-891.265] (-892.354) -- 0:02:18
48500 -- (-893.897) (-894.950) (-891.452) [-889.027] * (-889.872) [-890.660] (-890.259) (-891.355) -- 0:02:17
49000 -- (-894.189) (-889.907) (-890.652) [-890.563] * [-892.028] (-888.435) (-898.070) (-897.805) -- 0:02:15
49500 -- [-890.108] (-895.024) (-892.452) (-890.369) * (-888.736) (-894.515) (-896.458) [-898.968] -- 0:02:14
50000 -- (-895.587) (-888.977) [-888.493] (-892.371) * (-887.258) [-890.122] (-903.441) (-898.152) -- 0:02:13
Average standard deviation of split frequencies: 0.079084
50500 -- (-887.633) [-890.769] (-893.158) (-893.081) * (-893.055) [-890.947] (-895.713) (-896.519) -- 0:02:11
51000 -- (-888.028) (-890.407) (-896.784) [-890.760] * [-888.542] (-891.725) (-891.851) (-892.484) -- 0:02:10
51500 -- [-890.281] (-894.132) (-892.573) (-893.166) * (-888.838) [-891.705] (-903.610) (-892.481) -- 0:02:08
52000 -- (-899.320) (-892.518) (-893.771) [-893.772] * (-890.171) [-891.279] (-903.669) (-892.853) -- 0:02:07
52500 -- [-892.566] (-889.405) (-889.169) (-895.236) * [-890.989] (-888.127) (-896.887) (-894.863) -- 0:02:06
53000 -- (-890.546) (-889.239) [-893.570] (-892.862) * (-886.759) [-891.434] (-898.289) (-891.792) -- 0:02:05
53500 -- [-894.636] (-896.568) (-891.755) (-893.422) * (-887.599) (-887.981) [-890.541] (-893.132) -- 0:02:21
54000 -- [-887.763] (-897.317) (-893.080) (-893.410) * (-897.511) (-894.530) (-892.057) [-897.733] -- 0:02:20
54500 -- (-894.564) (-897.859) (-890.565) [-890.784] * (-886.993) [-889.334] (-892.390) (-895.409) -- 0:02:18
55000 -- [-888.566] (-891.443) (-895.063) (-890.400) * (-895.453) [-891.004] (-890.124) (-895.696) -- 0:02:17
Average standard deviation of split frequencies: 0.075761
55500 -- (-890.166) [-887.455] (-896.159) (-893.336) * (-888.879) [-890.014] (-896.408) (-901.164) -- 0:02:16
56000 -- [-895.580] (-893.386) (-894.441) (-902.384) * [-894.715] (-894.048) (-891.904) (-901.040) -- 0:02:14
56500 -- (-895.357) (-894.003) [-891.217] (-891.687) * (-890.913) (-896.103) (-892.820) [-888.702] -- 0:02:13
57000 -- [-889.691] (-894.968) (-899.185) (-888.855) * (-887.850) (-897.075) [-891.451] (-892.642) -- 0:02:12
57500 -- (-895.286) (-894.591) [-895.877] (-895.374) * (-893.521) (-895.173) (-892.513) [-891.231] -- 0:02:11
58000 -- (-893.787) [-890.164] (-894.436) (-891.943) * (-895.662) (-897.968) [-890.126] (-891.178) -- 0:02:09
58500 -- (-888.355) (-890.782) (-892.901) [-894.335] * [-887.911] (-890.965) (-889.177) (-892.575) -- 0:02:08
59000 -- (-888.758) [-895.080] (-895.184) (-895.539) * (-888.566) (-890.029) [-887.379] (-893.628) -- 0:02:07
59500 -- [-888.346] (-891.717) (-897.390) (-889.083) * [-888.117] (-895.593) (-889.114) (-895.379) -- 0:02:06
60000 -- (-893.197) [-891.236] (-892.142) (-890.540) * (-891.987) [-889.662] (-893.754) (-895.751) -- 0:02:05
Average standard deviation of split frequencies: 0.062163
60500 -- (-889.248) (-893.893) [-897.747] (-898.203) * [-889.875] (-894.846) (-892.271) (-892.486) -- 0:02:19
61000 -- (-897.947) (-890.959) [-895.452] (-895.679) * (-892.425) (-898.070) (-896.447) [-892.201] -- 0:02:18
61500 -- [-890.215] (-889.341) (-890.034) (-891.573) * (-892.808) [-890.851] (-893.748) (-893.200) -- 0:02:17
62000 -- (-892.300) (-888.688) [-895.129] (-889.713) * (-895.965) [-890.834] (-895.948) (-893.489) -- 0:02:16
62500 -- (-893.735) (-893.914) [-890.293] (-890.595) * (-893.964) [-891.105] (-892.332) (-889.025) -- 0:02:15
63000 -- [-892.483] (-890.998) (-890.963) (-893.011) * (-896.495) (-894.929) [-892.250] (-892.224) -- 0:02:13
63500 -- (-893.427) [-894.968] (-891.993) (-891.908) * [-897.313] (-898.002) (-893.618) (-891.192) -- 0:02:12
64000 -- (-893.129) [-891.467] (-890.112) (-894.877) * (-903.093) [-896.007] (-895.496) (-889.180) -- 0:02:11
64500 -- (-891.314) [-890.042] (-892.959) (-889.127) * (-902.464) (-897.007) (-893.878) [-888.586] -- 0:02:10
65000 -- (-891.363) (-894.495) (-892.953) [-891.275] * (-901.384) (-898.817) (-897.227) [-898.350] -- 0:02:09
Average standard deviation of split frequencies: 0.049997
65500 -- [-890.246] (-891.414) (-895.926) (-891.269) * (-892.864) (-893.879) (-891.136) [-889.427] -- 0:02:08
66000 -- (-891.531) [-897.377] (-892.630) (-896.931) * (-888.912) [-891.421] (-895.616) (-888.010) -- 0:02:07
66500 -- [-891.040] (-889.370) (-901.030) (-890.861) * (-891.756) (-892.434) (-894.956) [-889.689] -- 0:02:06
67000 -- [-887.762] (-891.197) (-891.775) (-894.224) * (-890.992) (-890.078) (-889.645) [-891.793] -- 0:02:05
67500 -- (-891.374) [-892.416] (-892.204) (-892.493) * (-891.498) (-897.160) [-893.730] (-897.356) -- 0:02:18
68000 -- (-891.149) (-892.572) [-889.672] (-898.473) * (-892.580) [-889.333] (-892.101) (-892.548) -- 0:02:17
68500 -- [-890.270] (-893.915) (-892.583) (-891.470) * (-890.020) (-889.609) (-891.619) [-894.567] -- 0:02:15
69000 -- (-891.098) (-895.007) [-898.345] (-892.929) * [-892.025] (-889.766) (-891.195) (-895.737) -- 0:02:14
69500 -- (-890.583) (-896.610) (-891.511) [-891.686] * (-892.242) (-894.315) [-890.090] (-898.604) -- 0:02:13
70000 -- (-892.842) [-891.256] (-893.192) (-905.774) * (-904.731) (-891.991) (-887.651) [-895.633] -- 0:02:12
Average standard deviation of split frequencies: 0.033354
70500 -- (-891.174) (-891.600) [-891.006] (-894.931) * (-897.505) (-892.247) (-887.871) [-893.438] -- 0:02:11
71000 -- (-892.206) (-893.844) (-890.833) [-887.488] * (-898.324) [-896.128] (-893.358) (-896.641) -- 0:02:10
71500 -- (-892.165) (-894.422) [-888.752] (-895.142) * (-899.044) [-892.906] (-891.497) (-891.470) -- 0:02:09
72000 -- [-890.628] (-892.988) (-892.703) (-893.308) * (-896.128) (-891.579) [-893.949] (-890.345) -- 0:02:08
72500 -- (-897.186) [-888.505] (-893.260) (-896.088) * (-890.307) (-893.806) (-889.261) [-891.606] -- 0:02:07
73000 -- [-892.548] (-891.029) (-898.456) (-895.873) * [-898.361] (-889.679) (-890.527) (-888.067) -- 0:02:06
73500 -- [-893.192] (-894.096) (-892.051) (-893.832) * (-891.937) [-889.909] (-889.471) (-893.534) -- 0:02:06
74000 -- (-891.398) [-893.293] (-891.409) (-895.784) * (-892.734) (-887.840) [-892.967] (-891.692) -- 0:02:05
74500 -- (-891.759) (-889.433) [-890.385] (-897.900) * (-890.931) (-887.179) [-888.498] (-895.255) -- 0:02:16
75000 -- (-894.374) (-888.294) [-894.937] (-894.107) * (-889.623) (-890.138) [-887.928] (-891.399) -- 0:02:15
Average standard deviation of split frequencies: 0.037216
75500 -- (-896.254) [-893.766] (-895.395) (-895.450) * (-891.511) (-890.323) [-891.048] (-892.235) -- 0:02:14
76000 -- (-899.443) [-890.969] (-895.105) (-894.352) * (-893.534) [-889.577] (-889.478) (-895.558) -- 0:02:13
76500 -- [-894.386] (-888.456) (-894.850) (-889.695) * [-889.330] (-893.298) (-890.734) (-891.504) -- 0:02:12
77000 -- [-891.827] (-889.123) (-893.834) (-890.195) * [-893.135] (-895.482) (-890.183) (-889.685) -- 0:02:11
77500 -- [-890.732] (-892.461) (-891.726) (-891.789) * (-892.258) (-897.189) (-891.641) [-892.818] -- 0:02:10
78000 -- (-890.415) [-892.140] (-895.755) (-891.469) * [-891.139] (-893.921) (-895.132) (-893.230) -- 0:02:10
78500 -- (-897.024) (-890.415) (-892.944) [-888.706] * [-891.815] (-892.524) (-896.310) (-898.406) -- 0:02:09
79000 -- (-890.908) (-889.358) (-896.170) [-889.427] * (-887.348) (-896.555) [-890.069] (-893.471) -- 0:02:08
79500 -- (-891.592) [-891.414] (-895.343) (-891.689) * (-890.478) (-892.515) [-893.718] (-890.856) -- 0:02:07
80000 -- (-891.129) (-892.449) (-892.857) [-890.421] * [-890.125] (-895.790) (-896.466) (-896.765) -- 0:02:06
Average standard deviation of split frequencies: 0.040907
80500 -- (-893.268) (-894.308) (-893.974) [-887.581] * (-889.189) [-894.180] (-889.771) (-891.436) -- 0:02:05
81000 -- (-894.550) (-896.778) [-891.691] (-890.253) * (-892.867) (-897.144) (-892.615) [-889.069] -- 0:02:04
81500 -- (-893.158) (-891.457) (-890.983) [-897.114] * [-889.201] (-890.059) (-887.661) (-890.245) -- 0:02:15
82000 -- (-891.483) [-894.023] (-889.619) (-892.303) * [-891.364] (-893.542) (-890.891) (-893.279) -- 0:02:14
82500 -- [-889.234] (-889.782) (-892.160) (-888.648) * [-892.451] (-891.213) (-894.603) (-894.879) -- 0:02:13
83000 -- (-891.619) (-893.507) (-893.007) [-887.735] * (-891.521) [-892.575] (-895.867) (-892.833) -- 0:02:12
83500 -- [-891.884] (-891.520) (-892.133) (-891.466) * [-890.782] (-889.980) (-892.733) (-894.292) -- 0:02:11
84000 -- (-893.100) (-887.569) (-894.957) [-890.310] * (-890.080) (-892.837) [-894.958] (-891.148) -- 0:02:10
84500 -- (-891.797) (-890.343) (-888.782) [-890.626] * (-897.777) [-888.766] (-893.362) (-893.062) -- 0:02:10
85000 -- [-890.348] (-891.810) (-888.030) (-892.742) * [-890.137] (-889.163) (-887.903) (-891.013) -- 0:02:09
Average standard deviation of split frequencies: 0.032889
85500 -- (-892.383) [-887.755] (-894.918) (-893.487) * (-891.329) [-888.703] (-893.088) (-892.094) -- 0:02:08
86000 -- (-891.896) [-892.568] (-893.195) (-894.746) * (-891.282) (-889.819) [-890.684] (-902.139) -- 0:02:07
86500 -- (-889.720) (-892.570) [-898.422] (-893.635) * (-889.141) [-888.505] (-896.196) (-891.388) -- 0:02:06
87000 -- [-889.718] (-891.913) (-894.901) (-896.544) * [-888.661] (-891.355) (-892.437) (-896.338) -- 0:02:05
87500 -- [-891.049] (-892.586) (-894.456) (-890.229) * [-892.334] (-890.112) (-892.174) (-888.306) -- 0:02:05
88000 -- (-887.359) (-894.653) (-896.290) [-893.466] * (-892.544) [-892.096] (-891.878) (-892.832) -- 0:02:04
88500 -- [-891.360] (-892.590) (-893.966) (-892.488) * (-890.778) (-894.052) [-891.734] (-897.853) -- 0:02:03
89000 -- (-891.757) (-890.145) (-898.007) [-889.343] * (-893.051) (-893.736) (-889.287) [-895.958] -- 0:02:13
89500 -- (-893.557) (-887.215) (-892.637) [-893.491] * (-888.639) [-887.844] (-894.652) (-900.424) -- 0:02:12
90000 -- [-896.849] (-894.070) (-897.579) (-891.870) * [-889.413] (-892.249) (-892.800) (-890.902) -- 0:02:11
Average standard deviation of split frequencies: 0.025997
90500 -- (-893.267) [-888.738] (-903.168) (-892.191) * (-894.251) (-889.131) (-895.744) [-893.804] -- 0:02:10
91000 -- (-892.054) [-889.405] (-894.201) (-892.512) * (-891.797) (-890.435) (-898.161) [-892.883] -- 0:02:09
91500 -- [-898.049] (-893.172) (-900.124) (-896.155) * (-888.999) (-896.389) (-893.622) [-896.293] -- 0:02:09
92000 -- [-894.447] (-889.985) (-895.917) (-892.288) * (-895.506) [-887.712] (-891.337) (-895.913) -- 0:02:08
92500 -- (-896.487) (-892.505) [-891.011] (-892.411) * (-888.492) (-892.470) [-895.898] (-896.173) -- 0:02:07
93000 -- (-890.064) (-892.429) (-892.869) [-895.745] * (-892.411) (-894.392) (-891.866) [-892.472] -- 0:02:06
93500 -- (-891.860) [-887.802] (-891.842) (-895.842) * (-893.379) (-898.814) (-890.611) [-888.923] -- 0:02:06
94000 -- [-893.775] (-888.654) (-890.571) (-893.122) * [-889.469] (-890.373) (-894.548) (-889.383) -- 0:02:05
94500 -- (-891.163) (-891.905) (-890.898) [-895.585] * (-891.842) [-888.633] (-895.473) (-890.994) -- 0:02:04
95000 -- (-887.050) (-891.490) [-895.775] (-892.443) * (-895.252) (-888.509) [-888.473] (-890.537) -- 0:02:03
Average standard deviation of split frequencies: 0.034373
95500 -- (-891.338) [-890.629] (-889.905) (-889.561) * (-889.733) [-890.251] (-889.786) (-896.888) -- 0:02:03
96000 -- (-893.870) (-892.425) [-891.318] (-891.491) * (-889.486) (-895.136) [-892.474] (-891.422) -- 0:02:11
96500 -- [-893.500] (-891.308) (-892.193) (-896.189) * [-891.860] (-891.363) (-890.988) (-891.513) -- 0:02:11
97000 -- (-894.501) [-889.247] (-889.608) (-892.786) * (-893.633) [-894.928] (-894.945) (-901.075) -- 0:02:10
97500 -- (-889.846) (-891.362) [-891.198] (-891.824) * (-892.467) (-889.424) [-892.906] (-894.326) -- 0:02:09
98000 -- (-896.247) [-892.953] (-895.330) (-891.915) * (-893.422) (-889.923) (-892.189) [-888.318] -- 0:02:08
98500 -- (-891.259) (-891.194) (-894.099) [-893.289] * (-890.156) (-890.935) [-888.533] (-890.788) -- 0:02:08
99000 -- (-888.280) [-887.974] (-897.850) (-896.326) * (-888.946) (-894.183) (-891.204) [-888.272] -- 0:02:07
99500 -- (-896.806) (-892.401) [-896.384] (-900.865) * (-895.001) (-890.191) (-895.001) [-893.050] -- 0:02:06
100000 -- (-892.754) [-888.108] (-895.677) (-891.952) * (-890.470) [-889.590] (-888.886) (-889.022) -- 0:02:05
Average standard deviation of split frequencies: 0.032780
100500 -- (-890.657) [-891.479] (-894.556) (-898.863) * (-889.342) [-890.301] (-893.083) (-890.732) -- 0:02:05
101000 -- (-894.976) [-894.136] (-891.182) (-898.751) * (-894.194) [-891.240] (-893.675) (-891.184) -- 0:02:04
101500 -- (-890.807) [-896.007] (-888.526) (-895.625) * (-898.213) (-889.094) (-891.030) [-891.565] -- 0:02:03
102000 -- (-894.257) [-892.799] (-891.023) (-890.393) * (-898.658) [-891.703] (-889.372) (-891.915) -- 0:02:03
102500 -- [-889.784] (-890.028) (-888.258) (-888.808) * (-887.861) (-895.615) [-889.382] (-892.600) -- 0:02:02
103000 -- (-890.165) [-890.260] (-895.164) (-888.486) * (-901.761) (-894.676) [-891.175] (-893.475) -- 0:02:10
103500 -- [-888.559] (-888.832) (-890.608) (-888.526) * [-893.834] (-891.718) (-893.668) (-893.637) -- 0:02:09
104000 -- (-891.709) (-891.793) (-890.310) [-890.628] * (-888.756) (-890.798) (-898.263) [-888.220] -- 0:02:09
104500 -- (-890.623) [-887.903] (-894.139) (-892.866) * (-893.487) (-892.401) (-891.913) [-892.843] -- 0:02:08
105000 -- (-890.666) [-891.528] (-895.168) (-892.866) * [-889.878] (-894.599) (-890.609) (-893.883) -- 0:02:07
Average standard deviation of split frequencies: 0.031130
105500 -- (-888.768) [-890.080] (-901.461) (-888.324) * (-889.879) (-892.548) [-894.650] (-895.394) -- 0:02:07
106000 -- (-895.968) [-888.359] (-903.750) (-895.034) * (-892.118) (-890.503) (-896.453) [-890.638] -- 0:02:06
106500 -- (-893.046) (-890.654) (-891.174) [-894.567] * [-890.623] (-892.215) (-898.213) (-894.242) -- 0:02:05
107000 -- [-889.247] (-890.100) (-894.124) (-890.900) * [-888.432] (-893.105) (-890.452) (-895.041) -- 0:02:05
107500 -- (-890.583) (-888.651) [-891.389] (-894.065) * (-906.601) (-889.441) (-890.768) [-894.431] -- 0:02:04
108000 -- (-891.773) [-893.355] (-893.184) (-890.204) * (-894.682) (-895.523) (-894.437) [-889.955] -- 0:02:03
108500 -- (-890.720) [-892.300] (-896.955) (-893.720) * (-896.829) (-893.664) [-892.226] (-893.916) -- 0:02:03
109000 -- (-892.702) (-894.635) [-890.256] (-892.169) * [-893.362] (-887.624) (-891.102) (-892.273) -- 0:02:02
109500 -- (-891.460) [-891.831] (-895.879) (-893.127) * [-892.521] (-888.700) (-894.019) (-896.420) -- 0:02:01
110000 -- (-891.799) (-891.047) [-895.163] (-903.159) * [-896.051] (-891.122) (-891.587) (-896.948) -- 0:02:09
Average standard deviation of split frequencies: 0.029818
110500 -- (-894.347) [-892.920] (-894.215) (-899.341) * (-896.890) (-893.083) (-889.768) [-891.192] -- 0:02:08
111000 -- (-891.287) (-891.524) (-897.492) [-890.944] * (-895.425) [-889.357] (-899.449) (-886.726) -- 0:02:08
111500 -- [-889.846] (-890.419) (-892.249) (-891.435) * (-891.772) [-889.387] (-896.745) (-891.596) -- 0:02:07
112000 -- [-896.472] (-889.389) (-890.365) (-894.166) * (-890.312) [-889.807] (-898.890) (-890.773) -- 0:02:06
112500 -- (-903.425) [-891.940] (-894.332) (-892.699) * [-889.131] (-890.705) (-892.783) (-894.515) -- 0:02:06
113000 -- [-893.462] (-892.560) (-896.313) (-891.936) * (-897.092) (-889.027) (-894.123) [-889.114] -- 0:02:05
113500 -- [-888.204] (-891.929) (-894.636) (-890.886) * (-890.809) (-895.722) (-889.976) [-889.358] -- 0:02:04
114000 -- (-889.247) [-890.024] (-891.893) (-889.813) * [-893.762] (-894.663) (-888.246) (-888.825) -- 0:02:04
114500 -- (-893.865) (-891.347) (-896.892) [-894.724] * (-897.965) (-894.640) [-887.220] (-892.250) -- 0:02:03
115000 -- (-891.752) [-889.167] (-893.045) (-892.988) * [-893.992] (-893.572) (-889.177) (-892.611) -- 0:02:03
Average standard deviation of split frequencies: 0.024383
115500 -- (-897.851) [-890.090] (-895.993) (-888.799) * (-888.966) (-896.051) (-892.208) [-889.927] -- 0:02:02
116000 -- (-890.859) (-892.060) [-893.724] (-891.844) * [-891.996] (-888.413) (-890.144) (-888.660) -- 0:02:01
116500 -- (-889.330) (-893.374) [-893.742] (-893.874) * [-889.619] (-891.607) (-890.408) (-891.949) -- 0:02:01
117000 -- (-892.822) (-892.341) (-894.991) [-895.042] * [-891.694] (-898.095) (-895.126) (-892.947) -- 0:02:08
117500 -- (-892.755) (-890.010) [-892.896] (-901.899) * (-893.797) [-892.510] (-895.647) (-893.239) -- 0:02:07
118000 -- (-894.146) [-891.486] (-892.150) (-891.769) * [-892.117] (-893.587) (-893.449) (-895.492) -- 0:02:07
118500 -- (-896.683) [-889.542] (-890.831) (-892.837) * [-892.207] (-892.010) (-891.362) (-895.246) -- 0:02:06
119000 -- (-894.114) [-893.635] (-890.217) (-895.110) * (-894.367) (-890.000) (-888.740) [-894.493] -- 0:02:05
119500 -- (-890.742) (-889.568) [-895.025] (-894.175) * (-891.042) [-895.010] (-889.435) (-895.456) -- 0:02:05
120000 -- (-893.459) [-888.812] (-896.942) (-898.559) * (-891.233) (-894.110) (-889.105) [-893.761] -- 0:02:04
Average standard deviation of split frequencies: 0.023440
120500 -- [-894.676] (-890.779) (-894.053) (-890.591) * (-891.545) (-890.176) [-887.992] (-893.327) -- 0:02:04
121000 -- (-892.518) (-890.909) [-890.445] (-886.533) * (-893.705) [-887.317] (-895.859) (-894.096) -- 0:02:03
121500 -- (-891.033) (-895.226) (-893.138) [-888.556] * (-895.186) (-891.280) [-888.982] (-887.595) -- 0:02:02
122000 -- (-892.083) [-890.160] (-890.216) (-892.528) * (-889.345) [-892.893] (-893.788) (-891.267) -- 0:02:02
122500 -- (-897.591) [-888.954] (-890.805) (-892.533) * [-889.622] (-896.640) (-892.403) (-891.874) -- 0:02:01
123000 -- (-895.934) (-887.626) (-888.432) [-890.152] * [-889.769] (-898.768) (-894.472) (-895.347) -- 0:02:01
123500 -- [-890.894] (-889.119) (-890.328) (-897.225) * [-890.291] (-896.279) (-892.659) (-890.320) -- 0:02:00
124000 -- (-892.330) (-890.394) [-890.689] (-890.438) * [-892.337] (-889.810) (-898.904) (-892.794) -- 0:02:07
124500 -- (-894.228) (-892.906) [-890.026] (-890.765) * (-892.372) (-896.840) (-893.628) [-895.014] -- 0:02:06
125000 -- [-892.599] (-892.957) (-895.968) (-890.345) * [-897.744] (-893.051) (-893.936) (-891.075) -- 0:02:06
Average standard deviation of split frequencies: 0.026189
125500 -- [-892.566] (-887.000) (-897.664) (-891.565) * (-889.952) (-896.407) [-890.940] (-891.966) -- 0:02:05
126000 -- (-894.786) (-891.907) [-894.605] (-895.285) * (-889.143) [-893.337] (-897.246) (-893.155) -- 0:02:04
126500 -- (-893.084) [-891.886] (-896.021) (-892.669) * [-890.338] (-892.860) (-900.812) (-890.928) -- 0:02:04
127000 -- (-891.565) (-897.207) [-890.177] (-889.857) * (-892.259) [-889.345] (-895.642) (-890.632) -- 0:02:03
127500 -- (-892.784) (-896.101) [-889.990] (-894.999) * (-890.293) (-893.679) (-894.689) [-892.292] -- 0:02:03
128000 -- [-892.109] (-896.367) (-896.740) (-893.340) * [-890.359] (-892.118) (-897.202) (-894.651) -- 0:02:02
128500 -- (-890.622) [-892.322] (-888.679) (-889.594) * (-894.626) [-893.141] (-895.031) (-888.797) -- 0:02:02
129000 -- (-892.546) [-888.395] (-892.851) (-893.669) * (-891.283) [-888.167] (-889.690) (-890.355) -- 0:02:01
129500 -- [-890.219] (-890.777) (-892.728) (-889.851) * (-892.281) (-892.481) [-892.578] (-893.305) -- 0:02:00
130000 -- (-890.401) (-891.199) [-892.122] (-896.759) * [-890.698] (-890.245) (-888.348) (-890.010) -- 0:02:00
Average standard deviation of split frequencies: 0.025254
130500 -- [-890.994] (-889.710) (-894.257) (-893.964) * (-892.789) (-892.172) [-889.962] (-892.821) -- 0:01:59
131000 -- (-888.064) [-891.311] (-892.377) (-899.629) * (-896.133) (-891.641) [-895.196] (-891.763) -- 0:02:06
131500 -- (-891.330) (-890.358) [-893.221] (-894.782) * (-894.439) (-891.879) (-890.630) [-890.531] -- 0:02:05
132000 -- [-892.438] (-886.705) (-893.560) (-892.542) * (-895.171) (-897.835) [-892.998] (-887.653) -- 0:02:04
132500 -- (-895.873) (-890.468) [-888.775] (-894.817) * [-895.875] (-888.776) (-899.165) (-890.824) -- 0:02:04
133000 -- (-891.070) [-888.181] (-895.296) (-897.308) * (-894.116) (-892.748) [-892.331] (-892.792) -- 0:02:03
133500 -- [-890.929] (-887.609) (-893.371) (-890.773) * (-895.578) [-901.038] (-898.408) (-892.289) -- 0:02:03
134000 -- [-890.114] (-891.515) (-893.193) (-887.804) * (-896.963) [-890.150] (-898.964) (-892.691) -- 0:02:02
134500 -- (-888.096) (-888.990) (-892.976) [-888.714] * (-890.726) (-894.136) (-897.249) [-891.675] -- 0:02:02
135000 -- (-890.001) (-890.425) (-890.502) [-891.055] * (-891.595) [-890.494] (-894.691) (-890.059) -- 0:02:01
Average standard deviation of split frequencies: 0.020797
135500 -- (-893.999) [-887.983] (-892.340) (-888.335) * (-893.964) [-893.724] (-899.756) (-890.169) -- 0:02:01
136000 -- (-889.583) (-892.626) [-889.979] (-898.428) * (-893.102) [-889.461] (-897.356) (-888.249) -- 0:02:00
136500 -- [-891.724] (-887.594) (-895.675) (-893.083) * (-889.232) (-892.041) (-895.003) [-892.752] -- 0:02:00
137000 -- (-888.210) [-889.381] (-893.894) (-896.552) * (-888.922) (-892.139) (-902.416) [-892.830] -- 0:01:59
137500 -- (-893.690) (-891.522) [-894.473] (-890.566) * (-893.364) (-893.862) (-898.711) [-890.607] -- 0:01:59
138000 -- (-901.031) (-891.519) [-889.642] (-888.873) * (-891.241) (-895.615) (-896.041) [-894.884] -- 0:02:04
138500 -- (-894.478) [-893.349] (-889.529) (-892.568) * [-897.187] (-893.269) (-894.094) (-892.718) -- 0:02:04
139000 -- (-893.235) (-893.207) [-891.536] (-892.337) * [-892.896] (-888.070) (-897.147) (-893.249) -- 0:02:03
139500 -- (-892.282) [-894.538] (-890.542) (-890.543) * (-890.366) [-889.259] (-900.162) (-892.725) -- 0:02:03
140000 -- (-889.562) (-891.236) [-889.643] (-891.964) * [-890.918] (-890.004) (-900.228) (-892.318) -- 0:02:02
Average standard deviation of split frequencies: 0.020107
140500 -- [-888.514] (-898.224) (-891.429) (-893.147) * (-894.993) [-895.037] (-903.772) (-897.571) -- 0:02:02
141000 -- [-891.942] (-894.379) (-892.197) (-888.645) * [-892.779] (-892.017) (-893.175) (-889.885) -- 0:02:01
141500 -- (-890.821) (-892.041) (-897.095) [-895.847] * [-894.756] (-891.404) (-894.693) (-891.452) -- 0:02:01
142000 -- (-890.536) (-894.516) [-892.828] (-889.920) * [-888.516] (-892.532) (-903.245) (-892.622) -- 0:02:00
142500 -- (-895.451) [-894.427] (-895.466) (-889.476) * (-892.857) (-893.119) (-900.891) [-889.203] -- 0:02:00
143000 -- (-896.710) [-892.495] (-893.696) (-894.856) * (-890.913) (-890.570) (-893.441) [-889.686] -- 0:01:59
143500 -- (-897.289) [-893.050] (-890.550) (-887.528) * [-894.147] (-891.933) (-893.965) (-890.665) -- 0:01:59
144000 -- (-908.747) (-896.174) (-886.713) [-890.376] * [-890.815] (-892.790) (-896.018) (-893.523) -- 0:01:58
144500 -- (-897.848) (-892.833) [-891.295] (-894.903) * (-893.110) (-891.755) [-893.567] (-893.124) -- 0:01:58
145000 -- (-892.408) (-895.331) (-892.180) [-888.739] * (-889.338) (-899.513) (-891.900) [-895.334] -- 0:02:03
Average standard deviation of split frequencies: 0.025830
145500 -- (-890.269) (-888.473) (-889.629) [-888.532] * (-890.402) (-891.804) (-896.998) [-892.255] -- 0:02:03
146000 -- (-894.293) (-891.430) (-889.746) [-892.522] * (-893.032) (-895.977) (-894.745) [-892.534] -- 0:02:02
146500 -- (-896.124) [-891.875] (-894.207) (-891.469) * [-889.392] (-892.942) (-892.165) (-892.706) -- 0:02:02
147000 -- (-898.275) (-889.496) (-889.034) [-890.435] * (-890.405) (-890.404) [-890.337] (-891.265) -- 0:02:01
147500 -- (-889.043) [-891.892] (-891.285) (-895.165) * (-889.093) (-894.764) [-886.817] (-891.536) -- 0:02:01
148000 -- (-892.760) (-891.623) [-887.566] (-891.092) * (-892.651) (-895.005) [-892.890] (-895.782) -- 0:02:00
148500 -- [-899.330] (-893.677) (-894.714) (-895.457) * [-892.483] (-897.303) (-893.186) (-889.800) -- 0:02:00
149000 -- (-890.903) [-889.821] (-895.776) (-892.705) * (-891.992) (-895.804) [-891.120] (-892.370) -- 0:01:59
149500 -- (-895.328) (-891.961) [-892.380] (-894.183) * (-892.642) [-897.604] (-889.450) (-890.484) -- 0:01:59
150000 -- (-893.854) (-896.855) [-890.098] (-892.376) * (-890.535) [-896.974] (-893.068) (-894.113) -- 0:01:58
Average standard deviation of split frequencies: 0.028159
150500 -- (-895.284) (-892.986) (-891.215) [-894.510] * (-891.817) (-900.524) (-895.738) [-891.179] -- 0:01:58
151000 -- (-894.872) (-895.048) [-890.205] (-889.232) * (-888.618) (-893.202) (-893.702) [-893.330] -- 0:01:58
151500 -- (-892.261) (-892.468) (-891.184) [-895.969] * (-891.206) (-893.873) (-894.234) [-889.754] -- 0:01:57
152000 -- (-889.449) (-892.221) (-888.916) [-895.363] * (-895.398) [-891.840] (-896.308) (-892.948) -- 0:01:57
152500 -- [-891.355] (-889.702) (-889.542) (-890.365) * (-893.470) (-894.642) (-895.810) [-892.215] -- 0:02:02
153000 -- (-892.758) (-893.778) [-889.582] (-891.410) * (-892.187) (-892.571) (-892.152) [-888.676] -- 0:02:01
153500 -- (-896.276) (-890.164) (-887.636) [-889.055] * (-890.910) (-896.103) [-891.281] (-892.948) -- 0:02:01
154000 -- (-891.991) (-902.641) (-889.567) [-891.009] * (-894.642) (-891.951) (-895.017) [-893.594] -- 0:02:00
154500 -- [-892.837] (-896.002) (-891.579) (-896.016) * (-896.914) [-892.706] (-895.876) (-895.226) -- 0:02:00
155000 -- (-893.400) (-895.781) (-893.600) [-896.237] * (-892.627) (-891.037) [-892.314] (-890.446) -- 0:01:59
Average standard deviation of split frequencies: 0.024175
155500 -- (-889.101) [-893.545] (-892.154) (-898.088) * [-892.450] (-887.915) (-893.570) (-891.984) -- 0:01:59
156000 -- (-890.691) (-888.664) (-894.189) [-888.880] * (-888.937) (-893.972) [-893.109] (-889.339) -- 0:01:59
156500 -- [-893.550] (-893.395) (-890.917) (-894.949) * (-888.585) [-890.454] (-891.897) (-892.557) -- 0:01:58
157000 -- (-891.345) (-895.154) (-889.738) [-891.697] * (-891.063) [-889.678] (-893.220) (-893.375) -- 0:01:58
157500 -- (-892.200) (-893.167) (-888.698) [-888.587] * (-896.022) (-889.627) (-890.123) [-891.228] -- 0:01:57
158000 -- [-891.362] (-891.815) (-889.399) (-895.116) * (-897.570) (-888.420) (-895.456) [-891.708] -- 0:01:57
158500 -- [-891.778] (-890.305) (-892.291) (-893.342) * (-906.554) [-891.537] (-892.240) (-893.313) -- 0:01:56
159000 -- (-893.179) (-889.593) [-891.471] (-890.976) * (-898.278) (-892.427) [-890.820] (-893.353) -- 0:01:56
159500 -- [-890.032] (-892.224) (-891.832) (-892.379) * [-889.492] (-891.474) (-891.425) (-890.307) -- 0:02:01
160000 -- [-896.571] (-893.716) (-892.812) (-891.457) * (-894.284) (-890.998) [-891.209] (-897.722) -- 0:02:00
Average standard deviation of split frequencies: 0.020538
160500 -- (-891.798) (-894.235) (-889.524) [-889.439] * (-891.661) (-893.189) (-889.718) [-894.026] -- 0:02:00
161000 -- (-888.562) [-892.212] (-888.531) (-890.215) * (-890.696) (-892.029) (-890.089) [-897.411] -- 0:01:59
161500 -- (-896.069) (-890.429) [-892.377] (-889.913) * (-888.398) (-892.716) (-889.551) [-890.417] -- 0:01:59
162000 -- (-902.683) (-891.558) [-889.188] (-892.378) * (-891.023) [-893.941] (-899.119) (-891.593) -- 0:01:58
162500 -- (-899.011) (-900.862) [-890.562] (-896.116) * (-890.682) [-897.017] (-890.548) (-890.065) -- 0:01:58
163000 -- [-896.506] (-892.740) (-889.475) (-891.156) * (-897.440) [-893.876] (-886.639) (-894.219) -- 0:01:58
163500 -- (-894.337) (-888.453) [-896.551] (-888.872) * (-893.430) (-891.331) (-890.901) [-890.595] -- 0:01:57
164000 -- (-891.546) (-889.412) (-894.482) [-889.192] * (-892.624) (-899.629) (-889.872) [-891.114] -- 0:01:57
164500 -- (-890.937) (-892.126) [-889.920] (-891.877) * (-892.714) (-894.753) [-888.900] (-891.859) -- 0:01:56
165000 -- (-895.306) [-890.168] (-890.459) (-890.048) * (-893.359) [-890.466] (-898.318) (-889.354) -- 0:01:56
Average standard deviation of split frequencies: 0.019879
165500 -- (-898.349) (-891.607) (-889.957) [-889.088] * (-891.220) (-892.595) (-894.088) [-889.790] -- 0:01:55
166000 -- (-894.938) [-891.564] (-892.095) (-890.999) * (-891.594) [-888.742] (-895.568) (-893.708) -- 0:01:55
166500 -- (-894.576) [-888.795] (-888.140) (-894.911) * (-892.994) [-891.144] (-890.174) (-893.553) -- 0:02:00
167000 -- (-896.924) (-889.118) [-892.440] (-894.493) * (-894.079) (-896.084) (-890.338) [-888.121] -- 0:01:59
167500 -- (-895.763) [-892.820] (-889.351) (-892.473) * (-893.729) [-892.199] (-892.366) (-896.445) -- 0:01:59
168000 -- (-896.411) (-895.654) [-894.176] (-888.910) * (-888.593) (-889.127) [-887.690] (-893.202) -- 0:01:58
168500 -- (-892.965) (-892.108) [-894.630] (-894.006) * (-893.264) [-893.510] (-891.727) (-894.855) -- 0:01:58
169000 -- [-893.399] (-890.004) (-890.179) (-896.149) * (-893.584) (-888.682) (-888.908) [-894.157] -- 0:01:58
169500 -- (-891.543) (-894.735) [-892.430] (-889.578) * (-892.336) [-893.935] (-891.400) (-892.072) -- 0:01:57
170000 -- (-890.805) [-894.396] (-891.772) (-890.614) * [-890.915] (-896.370) (-890.777) (-889.817) -- 0:01:57
Average standard deviation of split frequencies: 0.016573
170500 -- (-894.795) (-894.258) [-895.970] (-894.343) * (-891.955) (-897.694) [-895.239] (-891.967) -- 0:01:56
171000 -- [-892.115] (-889.638) (-890.116) (-889.096) * (-889.324) (-891.880) (-891.760) [-890.758] -- 0:01:56
171500 -- [-892.243] (-895.579) (-890.399) (-889.317) * (-889.331) (-892.654) [-888.377] (-893.931) -- 0:01:55
172000 -- (-892.412) [-893.412] (-891.735) (-890.541) * (-890.183) [-891.445] (-890.101) (-890.017) -- 0:01:55
172500 -- (-895.421) (-896.658) (-895.476) [-889.148] * (-892.034) (-891.839) [-890.727] (-894.285) -- 0:01:55
173000 -- (-898.533) (-891.665) (-891.729) [-891.275] * [-893.504] (-892.254) (-888.265) (-892.113) -- 0:01:54
173500 -- [-891.434] (-894.906) (-896.509) (-892.172) * (-891.656) (-891.890) (-889.975) [-892.000] -- 0:01:59
174000 -- (-893.400) (-899.010) (-891.898) [-893.102] * [-888.109] (-889.678) (-889.721) (-889.237) -- 0:01:58
174500 -- [-894.324] (-895.273) (-894.886) (-898.367) * (-891.992) [-891.498] (-887.944) (-887.370) -- 0:01:58
175000 -- (-891.894) [-896.241] (-896.178) (-898.818) * (-896.061) (-895.687) (-894.700) [-890.447] -- 0:01:57
Average standard deviation of split frequencies: 0.018749
175500 -- (-890.592) [-893.956] (-890.257) (-892.210) * (-890.723) (-898.017) (-889.054) [-890.644] -- 0:01:57
176000 -- [-891.907] (-892.589) (-890.653) (-891.607) * [-888.840] (-894.491) (-888.929) (-890.127) -- 0:01:57
176500 -- (-889.143) [-897.266] (-898.043) (-893.104) * (-894.772) (-897.244) [-889.593] (-889.622) -- 0:01:56
177000 -- (-890.287) (-894.444) (-894.773) [-897.431] * (-889.897) (-899.314) [-890.713] (-892.826) -- 0:01:56
177500 -- (-892.027) (-894.414) (-892.890) [-892.509] * (-889.863) (-895.180) [-893.256] (-894.471) -- 0:01:55
178000 -- [-889.827] (-892.549) (-894.470) (-891.636) * (-889.037) (-890.405) (-891.946) [-890.683] -- 0:01:55
178500 -- (-890.140) (-892.636) (-891.810) [-890.279] * (-895.490) (-889.079) (-890.740) [-891.055] -- 0:01:55
179000 -- (-892.795) (-891.949) (-890.148) [-892.006] * (-893.231) (-893.886) (-896.357) [-897.587] -- 0:01:54
179500 -- (-897.294) (-893.512) (-896.898) [-889.858] * (-895.044) (-892.530) (-897.196) [-901.085] -- 0:01:54
180000 -- (-891.836) (-892.652) [-894.027] (-892.206) * (-892.892) [-896.152] (-897.941) (-887.918) -- 0:01:53
Average standard deviation of split frequencies: 0.015656
180500 -- [-888.389] (-898.390) (-894.925) (-893.494) * (-893.121) (-891.418) (-894.268) [-890.200] -- 0:01:58
181000 -- (-887.757) (-893.631) (-895.246) [-893.592] * (-894.164) [-891.571] (-889.450) (-888.715) -- 0:01:57
181500 -- [-888.280] (-894.369) (-895.528) (-891.090) * (-893.567) [-891.405] (-898.887) (-889.991) -- 0:01:57
182000 -- (-893.381) (-891.179) (-899.642) [-891.910] * [-894.855] (-891.800) (-892.369) (-897.833) -- 0:01:56
182500 -- [-891.129] (-892.824) (-896.110) (-889.803) * (-892.403) (-893.741) (-890.967) [-891.436] -- 0:01:56
183000 -- (-891.451) [-893.604] (-902.476) (-891.338) * (-901.528) (-893.908) [-893.804] (-889.361) -- 0:01:56
183500 -- (-889.742) (-892.625) [-892.904] (-890.793) * (-902.696) [-892.279] (-893.517) (-892.820) -- 0:01:55
184000 -- (-888.994) (-896.914) [-892.087] (-892.932) * (-895.704) (-888.830) (-892.968) [-890.652] -- 0:01:55
184500 -- (-894.679) (-896.059) (-893.184) [-892.016] * (-895.500) (-893.346) [-891.355] (-892.308) -- 0:01:54
185000 -- (-891.256) (-897.962) [-895.162] (-892.382) * [-894.464] (-890.317) (-889.844) (-891.890) -- 0:01:54
Average standard deviation of split frequencies: 0.015207
185500 -- (-887.759) [-891.010] (-889.262) (-891.422) * (-890.489) (-893.400) [-889.344] (-891.264) -- 0:01:54
186000 -- (-887.638) [-895.016] (-900.235) (-893.286) * (-892.352) (-891.174) (-891.729) [-890.595] -- 0:01:53
186500 -- [-890.427] (-891.856) (-895.262) (-896.211) * (-895.395) [-893.506] (-892.431) (-896.235) -- 0:01:53
187000 -- (-889.042) (-893.530) (-901.189) [-890.710] * (-890.188) (-898.802) (-891.466) [-893.835] -- 0:01:53
187500 -- (-894.476) [-890.219] (-893.052) (-894.421) * [-897.502] (-888.531) (-887.738) (-890.275) -- 0:01:57
188000 -- [-894.315] (-898.173) (-896.385) (-895.898) * (-898.216) (-893.213) [-889.122] (-889.561) -- 0:01:56
188500 -- [-890.583] (-896.965) (-890.332) (-894.151) * [-894.888] (-890.158) (-890.499) (-892.148) -- 0:01:56
189000 -- (-889.457) [-890.150] (-890.499) (-897.838) * (-895.561) [-888.971] (-889.382) (-893.403) -- 0:01:55
189500 -- (-890.324) (-888.288) (-892.013) [-898.894] * [-892.859] (-899.440) (-901.051) (-888.037) -- 0:01:55
190000 -- (-889.754) (-893.711) [-889.296] (-891.866) * (-887.937) (-893.929) (-897.111) [-890.509] -- 0:01:55
Average standard deviation of split frequencies: 0.012362
190500 -- (-887.999) (-891.375) [-894.195] (-892.370) * (-890.592) (-895.413) (-893.351) [-886.814] -- 0:01:54
191000 -- (-891.886) (-889.973) [-893.202] (-891.331) * (-900.320) (-892.675) (-894.197) [-890.834] -- 0:01:54
191500 -- (-892.525) (-893.895) (-894.422) [-890.365] * (-894.998) (-890.901) [-891.950] (-889.437) -- 0:01:53
192000 -- (-892.118) [-888.297] (-889.142) (-894.711) * (-892.426) [-888.479] (-890.666) (-893.023) -- 0:01:53
192500 -- [-896.513] (-890.999) (-889.725) (-894.632) * (-891.255) [-886.542] (-891.820) (-900.006) -- 0:01:53
193000 -- (-891.410) (-895.371) [-892.199] (-895.128) * (-894.731) [-889.459] (-891.872) (-897.747) -- 0:01:52
193500 -- (-890.705) (-895.778) [-888.253] (-900.143) * (-893.769) [-888.066] (-894.157) (-895.476) -- 0:01:52
194000 -- (-889.754) (-897.522) [-890.634] (-893.280) * (-894.627) (-889.888) [-891.630] (-893.525) -- 0:01:52
194500 -- [-891.890] (-891.660) (-894.249) (-900.190) * (-891.324) (-888.859) [-891.316] (-896.342) -- 0:01:51
195000 -- (-886.724) (-893.890) (-889.275) [-890.679] * [-894.908] (-890.938) (-891.564) (-894.546) -- 0:01:55
Average standard deviation of split frequencies: 0.014431
195500 -- (-892.781) [-891.209] (-891.910) (-889.793) * [-891.767] (-895.099) (-894.987) (-893.609) -- 0:01:55
196000 -- [-890.863] (-892.225) (-895.581) (-890.443) * (-890.826) (-889.844) [-890.840] (-890.998) -- 0:01:54
196500 -- (-896.974) (-890.490) (-891.252) [-887.620] * (-890.436) (-893.181) [-892.104] (-890.849) -- 0:01:54
197000 -- [-890.576] (-896.717) (-891.532) (-888.868) * (-893.173) [-890.512] (-890.022) (-887.074) -- 0:01:54
197500 -- (-890.393) [-893.850] (-891.394) (-891.995) * (-888.072) [-890.365] (-890.485) (-893.486) -- 0:01:53
198000 -- (-894.049) (-892.146) (-892.990) [-899.719] * [-892.160] (-889.474) (-890.868) (-895.131) -- 0:01:53
198500 -- (-892.318) (-896.121) (-894.672) [-892.282] * (-895.420) (-896.565) (-892.174) [-888.935] -- 0:01:53
199000 -- (-892.279) [-889.195] (-893.783) (-897.264) * (-890.534) (-891.916) [-888.349] (-896.614) -- 0:01:52
199500 -- (-896.625) [-887.587] (-896.817) (-889.993) * [-890.089] (-894.399) (-891.168) (-901.147) -- 0:01:52
200000 -- (-892.627) [-893.540] (-889.453) (-886.867) * (-896.179) (-893.588) (-889.661) [-894.943] -- 0:01:51
Average standard deviation of split frequencies: 0.014095
200500 -- (-894.229) [-891.989] (-895.418) (-892.755) * [-887.451] (-890.003) (-889.842) (-894.237) -- 0:01:51
201000 -- (-901.576) (-891.508) [-894.074] (-896.228) * (-888.507) [-888.433] (-891.950) (-892.790) -- 0:01:51
201500 -- [-890.284] (-894.651) (-895.485) (-894.751) * (-893.657) (-890.348) [-893.776] (-889.681) -- 0:01:50
202000 -- (-888.123) (-895.309) [-890.488] (-890.164) * [-896.099] (-889.003) (-888.585) (-895.577) -- 0:01:54
202500 -- (-889.230) [-891.280] (-896.388) (-891.501) * (-891.819) [-889.848] (-891.677) (-887.008) -- 0:01:54
203000 -- [-889.186] (-896.965) (-894.356) (-890.034) * (-894.254) (-890.466) (-895.190) [-890.500] -- 0:01:53
203500 -- (-893.429) [-892.526] (-891.332) (-892.080) * (-892.876) (-897.344) [-891.623] (-893.898) -- 0:01:53
204000 -- (-893.001) (-894.827) [-890.674] (-891.571) * (-893.571) [-890.495] (-891.946) (-895.398) -- 0:01:53
204500 -- (-895.946) (-894.674) (-889.366) [-890.819] * [-895.224] (-890.035) (-893.104) (-894.674) -- 0:01:52
205000 -- (-894.624) (-897.132) [-890.317] (-894.031) * (-894.626) (-891.976) [-890.231] (-892.751) -- 0:01:52
Average standard deviation of split frequencies: 0.011442
205500 -- [-890.102] (-894.978) (-888.278) (-894.188) * [-890.172] (-893.245) (-889.870) (-895.314) -- 0:01:52
206000 -- [-892.944] (-889.357) (-892.111) (-890.431) * (-887.722) (-897.779) (-891.266) [-894.542] -- 0:01:51
206500 -- (-891.142) [-890.224] (-897.947) (-890.635) * (-891.247) (-894.979) [-898.391] (-894.464) -- 0:01:51
207000 -- (-890.838) [-892.331] (-897.735) (-889.575) * (-897.971) (-899.623) [-892.353] (-898.787) -- 0:01:51
207500 -- (-894.313) [-888.814] (-893.104) (-889.824) * [-893.574] (-897.085) (-893.582) (-891.150) -- 0:01:50
208000 -- [-893.757] (-892.406) (-892.070) (-890.028) * [-890.072] (-894.547) (-892.799) (-893.443) -- 0:01:50
208500 -- (-895.419) (-893.674) [-892.213] (-891.210) * [-889.443] (-894.303) (-890.525) (-889.504) -- 0:01:50
209000 -- [-900.274] (-892.092) (-895.869) (-893.877) * (-895.082) (-889.911) [-891.959] (-899.183) -- 0:01:53
209500 -- [-896.578] (-889.227) (-894.162) (-895.617) * [-891.964] (-890.029) (-894.101) (-893.095) -- 0:01:53
210000 -- (-893.546) (-886.992) [-891.824] (-894.517) * (-893.650) (-892.096) (-890.366) [-894.234] -- 0:01:52
Average standard deviation of split frequencies: 0.008951
210500 -- (-897.419) (-894.934) (-894.687) [-890.135] * [-888.859] (-895.509) (-897.305) (-889.909) -- 0:01:52
211000 -- [-893.162] (-890.963) (-891.287) (-891.788) * [-891.145] (-891.328) (-897.268) (-894.328) -- 0:01:52
211500 -- (-889.714) [-891.411] (-891.010) (-894.444) * (-888.726) [-888.746] (-901.629) (-896.363) -- 0:01:51
212000 -- [-894.008] (-899.496) (-898.915) (-888.885) * (-890.870) (-891.299) [-893.937] (-891.750) -- 0:01:51
212500 -- [-890.978] (-894.047) (-892.639) (-888.711) * (-892.691) [-891.262] (-896.588) (-893.931) -- 0:01:51
213000 -- (-893.670) (-895.187) [-889.075] (-888.453) * [-889.226] (-890.352) (-893.066) (-894.652) -- 0:01:50
213500 -- [-891.665] (-891.395) (-887.524) (-890.889) * [-891.807] (-888.089) (-898.210) (-893.377) -- 0:01:50
214000 -- (-890.271) (-893.935) [-887.165] (-889.883) * (-894.974) (-892.058) (-897.135) [-892.406] -- 0:01:50
214500 -- [-891.443] (-896.826) (-894.139) (-897.217) * [-890.225] (-890.448) (-894.531) (-889.068) -- 0:01:49
215000 -- (-896.120) (-893.159) [-894.145] (-897.760) * (-889.999) (-891.730) (-898.487) [-889.706] -- 0:01:49
Average standard deviation of split frequencies: 0.008730
215500 -- (-894.953) (-897.774) (-888.762) [-893.954] * [-889.644] (-893.833) (-900.752) (-894.529) -- 0:01:49
216000 -- [-890.895] (-893.782) (-893.342) (-890.574) * [-889.622] (-889.074) (-895.208) (-895.162) -- 0:01:52
216500 -- (-895.798) (-890.538) [-890.005] (-891.427) * (-893.330) (-895.406) (-899.613) [-891.054] -- 0:01:52
217000 -- (-892.248) [-890.950] (-890.207) (-890.737) * (-888.453) [-889.317] (-897.744) (-894.597) -- 0:01:51
217500 -- (-894.588) (-890.356) (-894.739) [-890.097] * (-890.286) (-890.846) (-890.618) [-889.939] -- 0:01:51
218000 -- (-898.622) (-894.865) [-890.425] (-889.160) * (-889.252) [-894.976] (-891.671) (-891.808) -- 0:01:51
218500 -- (-891.272) (-889.755) [-890.679] (-890.214) * (-894.654) [-890.773] (-898.866) (-891.292) -- 0:01:50
219000 -- (-892.939) [-891.167] (-890.751) (-889.906) * (-890.321) (-892.739) [-896.370] (-896.176) -- 0:01:50
219500 -- (-895.057) (-890.702) (-889.891) [-891.810] * (-889.873) (-890.372) (-893.086) [-891.593] -- 0:01:50
220000 -- (-891.070) (-896.231) [-890.281] (-889.388) * (-899.419) (-891.209) (-893.631) [-889.547] -- 0:01:49
Average standard deviation of split frequencies: 0.008545
220500 -- (-894.245) (-891.897) (-890.422) [-890.174] * (-892.571) [-889.074] (-891.557) (-890.695) -- 0:01:49
221000 -- [-892.600] (-896.376) (-891.617) (-893.618) * (-893.359) [-888.446] (-893.976) (-892.296) -- 0:01:49
221500 -- (-891.404) [-891.041] (-887.757) (-896.982) * (-891.896) (-894.069) (-895.311) [-891.017] -- 0:01:48
222000 -- (-896.765) (-888.880) [-891.750] (-899.990) * (-888.113) [-889.602] (-898.704) (-896.132) -- 0:01:48
222500 -- (-895.985) (-893.427) [-889.989] (-894.170) * (-888.094) (-893.223) [-890.391] (-890.912) -- 0:01:48
223000 -- (-896.566) (-890.433) (-892.259) [-893.631] * (-893.026) (-891.825) (-891.851) [-893.173] -- 0:01:51
223500 -- (-889.852) (-893.452) [-890.067] (-892.135) * (-891.257) (-899.475) [-901.911] (-893.277) -- 0:01:51
224000 -- (-888.625) [-893.059] (-897.132) (-889.086) * (-891.384) (-893.322) [-889.687] (-892.519) -- 0:01:50
224500 -- (-898.443) (-889.545) [-895.910] (-890.715) * (-891.463) (-890.780) [-888.907] (-889.747) -- 0:01:50
225000 -- (-892.132) (-891.707) (-891.024) [-889.935] * (-887.591) [-891.236] (-887.822) (-891.757) -- 0:01:50
Average standard deviation of split frequencies: 0.006258
225500 -- (-898.232) (-893.268) (-891.357) [-890.122] * (-893.421) [-889.360] (-887.744) (-897.423) -- 0:01:49
226000 -- (-893.044) (-888.266) [-895.857] (-889.992) * (-894.161) [-894.958] (-891.290) (-905.052) -- 0:01:49
226500 -- [-888.634] (-892.081) (-893.963) (-891.235) * [-894.221] (-894.915) (-895.793) (-894.910) -- 0:01:49
227000 -- (-890.249) (-891.379) (-893.945) [-892.681] * (-892.688) [-895.644] (-890.353) (-900.345) -- 0:01:48
227500 -- (-896.123) [-895.396] (-889.239) (-892.659) * (-894.033) (-891.633) [-890.952] (-898.508) -- 0:01:48
228000 -- (-890.350) (-891.869) [-892.095] (-895.871) * [-888.876] (-889.598) (-903.470) (-909.310) -- 0:01:48
228500 -- (-891.495) (-896.777) [-888.476] (-898.325) * [-889.623] (-892.138) (-896.022) (-897.857) -- 0:01:48
229000 -- (-891.210) [-896.157] (-891.957) (-894.585) * [-888.774] (-891.994) (-895.056) (-894.108) -- 0:01:47
229500 -- (-890.420) [-894.908] (-896.336) (-891.907) * (-886.871) (-889.058) (-897.673) [-895.938] -- 0:01:47
230000 -- (-898.409) [-894.779] (-892.111) (-891.198) * [-890.221] (-890.793) (-893.793) (-893.439) -- 0:01:50
Average standard deviation of split frequencies: 0.008175
230500 -- [-896.212] (-895.310) (-897.321) (-892.789) * (-889.962) (-891.213) [-895.702] (-893.748) -- 0:01:50
231000 -- [-893.582] (-895.799) (-895.107) (-893.000) * [-888.441] (-891.144) (-890.535) (-893.044) -- 0:01:49
231500 -- (-892.942) (-891.136) (-895.924) [-892.063] * [-895.487] (-891.088) (-888.252) (-895.641) -- 0:01:49
232000 -- (-894.326) [-887.160] (-900.423) (-891.560) * [-888.560] (-899.105) (-888.387) (-894.281) -- 0:01:49
232500 -- (-897.359) (-891.212) (-895.203) [-894.794] * (-894.598) (-900.831) (-892.768) [-896.433] -- 0:01:48
233000 -- [-888.948] (-893.922) (-900.419) (-894.141) * (-892.185) (-892.686) (-889.074) [-891.950] -- 0:01:48
233500 -- [-896.128] (-892.574) (-895.701) (-890.404) * (-887.756) (-895.799) [-889.070] (-893.535) -- 0:01:48
234000 -- (-886.628) [-890.415] (-895.645) (-891.335) * (-893.057) (-896.415) [-892.361] (-890.388) -- 0:01:48
234500 -- [-889.356] (-895.476) (-896.540) (-895.529) * [-892.183] (-894.623) (-889.736) (-891.119) -- 0:01:47
235000 -- [-892.318] (-890.026) (-893.079) (-892.299) * (-891.931) (-888.257) (-892.114) [-892.958] -- 0:01:47
Average standard deviation of split frequencies: 0.005992
235500 -- (-898.629) [-895.632] (-894.969) (-891.788) * (-893.462) (-891.610) [-892.814] (-889.120) -- 0:01:47
236000 -- [-889.634] (-890.238) (-889.101) (-890.161) * (-895.088) [-889.381] (-891.139) (-890.164) -- 0:01:46
236500 -- (-893.578) [-889.386] (-889.195) (-887.352) * [-892.341] (-891.539) (-891.739) (-892.355) -- 0:01:46
237000 -- (-889.157) (-890.089) [-890.570] (-894.893) * (-891.165) (-889.336) (-892.026) [-887.717] -- 0:01:46
237500 -- [-893.112] (-889.217) (-892.636) (-890.153) * (-887.783) [-894.579] (-891.892) (-891.769) -- 0:01:49
238000 -- (-892.992) (-889.342) [-888.714] (-901.889) * [-890.208] (-892.608) (-889.736) (-890.184) -- 0:01:48
238500 -- (-889.206) (-888.237) [-892.122] (-893.631) * [-888.500] (-892.947) (-888.962) (-896.997) -- 0:01:48
239000 -- (-891.631) (-889.378) [-886.700] (-889.287) * (-891.455) [-894.394] (-888.691) (-890.420) -- 0:01:48
239500 -- (-893.488) (-888.907) [-889.444] (-893.005) * [-891.404] (-890.401) (-890.760) (-892.956) -- 0:01:47
240000 -- (-893.696) (-894.793) (-891.645) [-893.327] * (-888.823) [-890.115] (-889.615) (-897.883) -- 0:01:47
Average standard deviation of split frequencies: 0.007835
240500 -- (-897.929) (-893.478) (-890.145) [-896.801] * (-890.919) [-891.226] (-890.690) (-892.965) -- 0:01:47
241000 -- (-896.446) (-892.474) [-889.428] (-890.124) * (-888.602) (-892.862) [-891.955] (-888.067) -- 0:01:47
241500 -- (-897.408) (-888.442) [-888.687] (-892.627) * [-891.292] (-893.501) (-892.108) (-888.154) -- 0:01:46
242000 -- [-898.087] (-890.506) (-893.857) (-898.350) * (-892.214) (-896.525) (-891.022) [-890.457] -- 0:01:46
242500 -- [-891.007] (-890.239) (-891.257) (-897.801) * (-890.007) (-888.531) [-887.565] (-888.337) -- 0:01:46
243000 -- [-891.214] (-888.908) (-889.457) (-893.086) * (-889.783) [-890.529] (-890.544) (-889.941) -- 0:01:45
243500 -- (-893.817) [-892.408] (-892.670) (-891.162) * [-894.541] (-888.776) (-891.831) (-894.865) -- 0:01:45
244000 -- (-890.694) [-890.084] (-898.017) (-893.199) * (-891.059) (-891.977) [-888.825] (-893.360) -- 0:01:45
244500 -- (-888.059) (-892.637) (-891.691) [-891.208] * [-890.465] (-896.768) (-888.835) (-892.243) -- 0:01:48
245000 -- (-891.170) (-890.784) (-891.641) [-893.536] * (-888.861) [-892.873] (-891.497) (-896.860) -- 0:01:47
Average standard deviation of split frequencies: 0.007665
245500 -- (-889.937) (-895.256) [-890.180] (-895.012) * (-892.210) (-893.952) [-894.916] (-893.895) -- 0:01:47
246000 -- (-892.759) [-890.254] (-891.283) (-893.142) * (-894.165) (-895.602) (-892.525) [-889.733] -- 0:01:47
246500 -- (-891.276) [-890.052] (-898.595) (-892.252) * [-891.474] (-889.663) (-891.724) (-888.765) -- 0:01:46
247000 -- [-896.877] (-895.760) (-889.166) (-896.222) * (-890.622) [-892.293] (-893.872) (-893.463) -- 0:01:46
247500 -- (-894.247) (-896.072) [-891.582] (-893.578) * (-888.634) [-894.145] (-894.560) (-898.282) -- 0:01:46
248000 -- (-889.920) (-888.195) [-891.872] (-891.071) * (-889.353) (-894.376) [-892.835] (-900.064) -- 0:01:46
248500 -- (-893.400) (-891.769) (-890.684) [-892.029] * (-889.187) [-890.536] (-889.557) (-891.009) -- 0:01:45
249000 -- (-890.942) [-890.612] (-894.690) (-890.200) * [-890.944] (-889.796) (-892.424) (-891.811) -- 0:01:45
249500 -- (-897.514) (-890.870) (-890.621) [-886.462] * (-890.205) (-894.418) (-894.743) [-889.250] -- 0:01:45
250000 -- (-890.840) (-888.427) (-895.868) [-889.188] * (-890.300) (-901.007) (-897.926) [-890.028] -- 0:01:44
Average standard deviation of split frequencies: 0.005642
250500 -- (-893.177) (-886.798) (-891.923) [-892.608] * [-891.063] (-896.138) (-894.332) (-893.774) -- 0:01:44
251000 -- (-886.860) (-896.270) [-888.751] (-891.252) * (-897.374) [-891.100] (-894.618) (-890.902) -- 0:01:44
251500 -- (-892.601) [-890.157] (-892.032) (-896.230) * [-889.224] (-893.853) (-892.669) (-893.418) -- 0:01:47
252000 -- (-889.803) (-889.358) [-887.093] (-893.802) * [-889.633] (-895.029) (-891.787) (-890.104) -- 0:01:46
252500 -- (-889.244) (-892.758) (-891.373) [-892.958] * [-891.113] (-896.790) (-893.504) (-890.111) -- 0:01:46
253000 -- [-897.438] (-898.812) (-896.074) (-890.136) * (-889.765) (-895.866) (-889.855) [-888.612] -- 0:01:46
253500 -- (-896.213) (-898.298) [-896.462] (-892.591) * (-891.077) (-894.127) [-889.518] (-894.238) -- 0:01:46
254000 -- [-889.802] (-891.506) (-892.185) (-895.058) * (-887.647) (-893.661) (-887.001) [-890.641] -- 0:01:45
254500 -- (-891.232) (-890.659) [-888.853] (-892.954) * (-893.776) (-901.864) (-898.238) [-893.786] -- 0:01:45
255000 -- (-897.351) (-892.707) [-888.899] (-892.441) * [-888.801] (-899.622) (-894.193) (-893.809) -- 0:01:45
Average standard deviation of split frequencies: 0.009207
255500 -- (-888.456) (-889.237) [-887.689] (-892.066) * (-892.371) (-892.755) [-891.919] (-899.926) -- 0:01:44
256000 -- (-890.612) (-893.804) (-891.749) [-888.987] * (-894.715) (-891.842) [-891.158] (-892.820) -- 0:01:44
256500 -- (-895.030) (-891.417) (-890.874) [-895.097] * (-894.815) [-893.164] (-893.300) (-889.034) -- 0:01:44
257000 -- (-890.206) (-887.738) [-891.846] (-898.772) * (-887.733) [-903.768] (-890.715) (-896.163) -- 0:01:44
257500 -- [-891.674] (-887.303) (-892.761) (-899.601) * (-891.661) (-895.619) [-896.756] (-896.379) -- 0:01:43
258000 -- (-889.696) (-890.758) [-888.806] (-897.180) * (-892.947) (-895.727) (-890.500) [-888.210] -- 0:01:43
258500 -- [-891.885] (-894.120) (-890.067) (-893.127) * (-890.213) [-894.290] (-888.019) (-895.974) -- 0:01:46
259000 -- (-893.846) (-897.505) [-891.700] (-894.424) * (-893.140) (-896.198) [-888.629] (-897.121) -- 0:01:45
259500 -- (-892.302) [-890.092] (-893.672) (-890.184) * (-893.378) (-893.957) [-891.618] (-892.719) -- 0:01:45
260000 -- (-895.152) (-889.799) (-894.424) [-891.457] * (-886.763) (-888.734) [-891.974] (-890.757) -- 0:01:45
Average standard deviation of split frequencies: 0.007234
260500 -- (-891.709) [-888.235] (-893.315) (-889.955) * [-892.960] (-888.588) (-892.612) (-892.831) -- 0:01:45
261000 -- [-894.436] (-890.894) (-895.372) (-895.564) * (-890.759) (-889.517) [-888.321] (-892.629) -- 0:01:44
261500 -- (-891.793) (-889.981) [-892.683] (-893.229) * (-895.007) (-895.193) (-889.034) [-901.452] -- 0:01:44
262000 -- [-901.004] (-887.205) (-894.536) (-895.241) * (-894.731) (-893.082) [-890.695] (-892.292) -- 0:01:44
262500 -- (-900.705) (-899.372) [-890.774] (-893.869) * (-887.324) [-895.873] (-896.144) (-893.442) -- 0:01:43
263000 -- [-892.975] (-889.585) (-890.910) (-890.785) * [-893.212] (-893.477) (-891.460) (-891.142) -- 0:01:43
263500 -- [-890.273] (-890.584) (-887.979) (-899.051) * (-891.625) (-891.005) [-891.814] (-893.078) -- 0:01:43
264000 -- (-889.444) [-890.561] (-891.100) (-894.343) * (-887.826) (-894.414) (-890.792) [-888.410] -- 0:01:43
264500 -- [-890.594] (-888.528) (-892.550) (-890.278) * [-888.864] (-889.331) (-895.930) (-892.776) -- 0:01:42
265000 -- (-894.087) (-892.491) [-891.718] (-890.993) * (-891.442) [-891.557] (-895.772) (-893.249) -- 0:01:42
Average standard deviation of split frequencies: 0.007089
265500 -- (-894.705) (-890.556) (-889.859) [-891.044] * (-895.392) [-891.005] (-892.407) (-892.315) -- 0:01:45
266000 -- [-894.509] (-886.900) (-889.605) (-892.915) * (-893.448) (-901.866) [-893.075] (-896.235) -- 0:01:44
266500 -- (-889.925) (-892.418) (-890.730) [-889.948] * (-889.425) (-892.078) (-894.193) [-893.553] -- 0:01:44
267000 -- (-899.322) (-891.855) [-889.830] (-889.246) * (-890.311) (-895.216) [-891.593] (-899.080) -- 0:01:44
267500 -- (-894.707) (-895.783) (-887.404) [-888.692] * [-889.106] (-893.712) (-899.812) (-890.891) -- 0:01:44
268000 -- (-892.798) [-899.641] (-889.429) (-889.725) * (-888.540) (-894.109) (-889.597) [-892.171] -- 0:01:43
268500 -- (-894.145) (-894.015) [-891.773] (-891.698) * (-897.685) (-895.095) (-889.439) [-891.803] -- 0:01:43
269000 -- (-887.097) [-889.600] (-890.736) (-888.085) * (-895.495) (-895.139) (-889.507) [-895.872] -- 0:01:43
269500 -- [-893.536] (-895.408) (-894.844) (-890.566) * (-895.437) (-900.628) (-890.132) [-893.875] -- 0:01:43
270000 -- (-893.553) (-888.786) (-892.435) [-896.126] * [-891.494] (-896.344) (-892.601) (-897.223) -- 0:01:42
Average standard deviation of split frequencies: 0.006967
270500 -- (-894.331) (-892.133) (-891.818) [-888.359] * [-891.489] (-895.313) (-892.868) (-895.835) -- 0:01:42
271000 -- (-892.450) [-891.070] (-895.344) (-895.499) * (-890.972) (-897.634) (-893.021) [-894.654] -- 0:01:42
271500 -- (-895.021) (-895.475) (-891.562) [-889.912] * [-889.361] (-895.713) (-893.623) (-896.690) -- 0:01:41
272000 -- [-896.551] (-888.647) (-889.788) (-893.230) * [-886.658] (-890.114) (-891.935) (-896.369) -- 0:01:41
272500 -- (-889.514) (-891.053) (-893.306) [-891.600] * [-892.903] (-892.954) (-893.345) (-892.766) -- 0:01:44
273000 -- (-895.539) [-888.334] (-890.673) (-892.589) * (-893.510) (-890.134) [-890.926] (-894.798) -- 0:01:43
273500 -- (-888.891) (-892.959) (-892.766) [-891.478] * (-894.327) (-891.006) (-893.808) [-887.129] -- 0:01:43
274000 -- (-890.428) [-892.869] (-889.343) (-889.716) * (-890.419) [-893.116] (-893.962) (-897.145) -- 0:01:43
274500 -- [-890.028] (-891.888) (-895.089) (-890.578) * (-903.837) (-893.356) (-890.153) [-894.487] -- 0:01:43
275000 -- (-891.591) [-893.198] (-892.316) (-899.320) * (-899.220) [-892.399] (-892.606) (-889.444) -- 0:01:42
Average standard deviation of split frequencies: 0.008540
275500 -- (-890.928) [-892.139] (-891.733) (-895.180) * (-892.954) (-895.392) (-893.508) [-890.479] -- 0:01:42
276000 -- [-890.559] (-895.218) (-891.773) (-891.394) * (-892.834) (-892.176) (-893.940) [-893.024] -- 0:01:42
276500 -- (-891.434) [-896.388] (-889.828) (-890.711) * (-889.682) (-895.517) (-893.133) [-895.890] -- 0:01:42
277000 -- [-893.769] (-891.947) (-893.983) (-892.306) * [-887.280] (-895.508) (-888.751) (-892.833) -- 0:01:41
277500 -- (-891.806) (-895.878) (-894.853) [-892.661] * (-891.649) (-887.757) [-888.195] (-893.947) -- 0:01:41
278000 -- [-892.558] (-891.757) (-891.581) (-895.610) * (-886.805) (-889.649) [-894.575] (-891.950) -- 0:01:41
278500 -- (-888.949) (-893.965) [-890.038] (-891.639) * (-889.009) (-895.350) (-897.908) [-892.617] -- 0:01:41
279000 -- [-891.077] (-888.679) (-891.550) (-892.030) * (-900.058) [-893.903] (-896.283) (-889.596) -- 0:01:40
279500 -- (-892.183) [-888.973] (-891.168) (-892.738) * (-892.722) (-893.117) [-894.984] (-889.304) -- 0:01:43
280000 -- (-897.363) (-887.577) (-889.021) [-888.053] * (-890.479) (-890.748) [-896.916] (-891.746) -- 0:01:42
Average standard deviation of split frequencies: 0.006718
280500 -- [-893.057] (-890.842) (-892.688) (-887.846) * (-890.778) [-894.567] (-893.514) (-889.578) -- 0:01:42
281000 -- (-895.335) (-892.746) [-891.165] (-891.264) * [-892.156] (-894.114) (-889.344) (-893.072) -- 0:01:42
281500 -- (-892.070) (-895.277) (-889.870) [-891.885] * [-889.135] (-891.089) (-891.221) (-893.555) -- 0:01:42
282000 -- [-889.958] (-894.436) (-890.494) (-887.620) * (-891.812) [-888.277] (-889.887) (-898.327) -- 0:01:41
282500 -- [-896.630] (-892.462) (-890.768) (-892.479) * [-888.445] (-891.285) (-889.127) (-895.908) -- 0:01:41
283000 -- (-896.677) (-891.589) (-895.408) [-896.557] * (-891.726) (-890.318) [-892.527] (-894.057) -- 0:01:41
283500 -- [-890.630] (-894.355) (-894.693) (-890.962) * [-891.883] (-898.289) (-894.420) (-897.653) -- 0:01:41
284000 -- [-891.506] (-890.773) (-894.774) (-888.890) * [-889.994] (-894.251) (-896.598) (-890.827) -- 0:01:40
284500 -- (-891.218) [-892.380] (-892.681) (-889.972) * [-893.220] (-892.694) (-890.772) (-891.193) -- 0:01:40
285000 -- (-890.500) (-889.350) [-892.160] (-896.074) * (-889.642) (-892.510) (-892.317) [-890.992] -- 0:01:40
Average standard deviation of split frequencies: 0.008241
285500 -- (-893.538) [-891.842] (-894.989) (-890.787) * (-893.096) [-892.005] (-889.812) (-889.004) -- 0:01:40
286000 -- (-889.135) (-887.530) [-894.020] (-893.434) * (-892.230) (-890.406) (-894.366) [-891.820] -- 0:01:39
286500 -- (-895.754) (-896.188) [-888.164] (-889.342) * (-894.885) (-891.188) [-889.970] (-886.976) -- 0:01:42
287000 -- [-894.506] (-893.289) (-888.357) (-888.569) * (-892.641) (-892.659) (-894.105) [-890.628] -- 0:01:41
287500 -- (-902.592) (-894.522) (-895.848) [-890.467] * (-889.552) [-890.667] (-896.563) (-892.067) -- 0:01:41
288000 -- (-892.356) (-894.564) (-898.756) [-893.312] * [-893.914] (-890.655) (-898.465) (-895.753) -- 0:01:41
288500 -- [-890.255] (-896.838) (-894.950) (-900.408) * (-891.633) (-891.650) [-892.219] (-896.177) -- 0:01:41
289000 -- (-889.461) (-892.870) [-894.963] (-889.114) * (-889.500) (-888.863) [-895.979] (-894.048) -- 0:01:40
289500 -- [-891.300] (-887.179) (-892.519) (-894.652) * (-891.656) (-895.083) [-891.390] (-894.602) -- 0:01:40
290000 -- (-887.621) (-893.550) [-891.446] (-889.974) * (-892.865) (-889.515) [-896.559] (-895.625) -- 0:01:40
Average standard deviation of split frequencies: 0.006487
290500 -- (-893.716) (-892.103) [-890.281] (-888.759) * [-889.096] (-889.126) (-897.262) (-892.651) -- 0:01:40
291000 -- (-890.871) [-890.767] (-891.590) (-896.992) * [-890.471] (-890.533) (-896.952) (-896.090) -- 0:01:39
291500 -- [-886.797] (-897.483) (-898.817) (-899.088) * [-888.895] (-894.934) (-889.797) (-894.046) -- 0:01:39
292000 -- (-891.083) (-889.110) (-892.876) [-888.545] * (-897.591) [-890.967] (-891.894) (-895.153) -- 0:01:39
292500 -- (-891.827) [-892.440] (-892.467) (-890.881) * (-893.113) (-891.350) [-896.474] (-890.869) -- 0:01:39
293000 -- (-893.704) (-892.936) (-894.098) [-893.934] * [-892.718] (-894.244) (-892.707) (-891.835) -- 0:01:38
293500 -- (-893.253) (-892.440) [-892.417] (-899.663) * (-890.286) [-889.571] (-895.461) (-897.924) -- 0:01:41
294000 -- (-891.706) (-892.233) [-889.256] (-894.942) * [-891.916] (-889.719) (-894.798) (-897.062) -- 0:01:40
294500 -- (-888.079) [-892.434] (-890.862) (-895.485) * (-890.740) (-889.631) (-896.843) [-893.085] -- 0:01:40
295000 -- (-890.449) [-890.565] (-893.277) (-891.798) * (-891.727) (-900.820) (-890.852) [-888.811] -- 0:01:40
Average standard deviation of split frequencies: 0.007963
295500 -- (-890.127) (-897.202) [-894.701] (-890.086) * (-891.488) (-894.063) [-892.478] (-892.143) -- 0:01:40
296000 -- (-893.581) (-895.102) (-892.430) [-890.367] * (-890.183) [-893.017] (-892.217) (-893.885) -- 0:01:39
296500 -- (-893.966) (-894.361) [-888.889] (-888.946) * (-893.998) [-897.036] (-891.855) (-889.456) -- 0:01:39
297000 -- [-889.719] (-893.670) (-892.661) (-892.440) * [-889.576] (-890.858) (-891.880) (-894.573) -- 0:01:39
297500 -- (-892.223) (-890.976) [-889.967] (-893.578) * [-892.181] (-890.720) (-891.268) (-892.477) -- 0:01:39
298000 -- (-893.951) (-890.435) [-895.670] (-892.831) * [-889.488] (-894.118) (-894.830) (-893.313) -- 0:01:38
298500 -- (-890.500) (-888.104) [-888.682] (-890.806) * (-893.446) (-893.969) [-892.419] (-896.515) -- 0:01:38
299000 -- (-895.471) (-889.983) [-890.587] (-888.825) * [-892.341] (-897.481) (-892.596) (-896.607) -- 0:01:38
299500 -- (-889.647) (-893.342) (-887.692) [-891.129] * (-897.638) [-892.332] (-891.442) (-898.192) -- 0:01:38
300000 -- [-895.421] (-890.014) (-887.127) (-897.203) * (-891.392) [-890.850] (-896.713) (-890.424) -- 0:01:37
Average standard deviation of split frequencies: 0.004704
300500 -- [-888.793] (-892.679) (-891.787) (-897.263) * (-892.686) (-889.901) [-893.976] (-891.110) -- 0:01:40
301000 -- [-892.102] (-890.150) (-897.731) (-894.917) * (-895.446) [-892.054] (-894.768) (-893.331) -- 0:01:39
301500 -- (-892.822) (-895.191) (-890.367) [-890.176] * (-898.139) [-891.244] (-897.090) (-892.429) -- 0:01:39
302000 -- (-891.111) (-889.838) [-889.348] (-892.434) * (-896.224) (-893.048) (-890.607) [-890.981] -- 0:01:39
302500 -- [-891.243] (-890.572) (-889.943) (-893.238) * (-888.135) (-893.848) [-890.753] (-891.043) -- 0:01:39
303000 -- (-896.551) [-891.622] (-898.338) (-897.171) * (-897.858) [-893.054] (-892.158) (-888.557) -- 0:01:38
303500 -- (-892.389) (-899.617) (-889.072) [-892.426] * (-893.512) (-890.475) (-896.535) [-890.801] -- 0:01:38
304000 -- [-893.110] (-892.332) (-894.881) (-892.823) * (-895.452) [-889.173] (-893.695) (-889.097) -- 0:01:38
304500 -- (-892.072) (-897.550) (-896.366) [-891.445] * [-890.338] (-890.873) (-895.188) (-893.854) -- 0:01:38
305000 -- (-892.362) [-892.257] (-897.430) (-893.728) * (-892.498) (-890.848) [-892.818] (-891.640) -- 0:01:37
Average standard deviation of split frequencies: 0.004622
305500 -- (-890.429) [-888.116] (-895.669) (-892.001) * (-891.526) (-891.220) (-889.249) [-898.289] -- 0:01:37
306000 -- [-890.973] (-892.908) (-893.520) (-898.247) * (-892.504) [-891.852] (-896.589) (-889.782) -- 0:01:37
306500 -- (-891.065) [-890.899] (-896.750) (-894.097) * (-893.704) (-893.667) (-895.912) [-891.517] -- 0:01:37
307000 -- (-893.218) (-892.662) (-892.086) [-892.528] * (-890.712) [-889.707] (-894.398) (-891.234) -- 0:01:37
307500 -- (-891.193) [-890.623] (-891.351) (-891.106) * (-891.193) (-892.002) (-895.229) [-888.315] -- 0:01:39
308000 -- (-893.156) [-890.203] (-897.872) (-893.110) * [-891.685] (-896.982) (-891.268) (-891.180) -- 0:01:38
308500 -- (-892.381) (-889.577) [-891.533] (-897.408) * (-894.857) (-892.231) [-893.094] (-890.224) -- 0:01:38
309000 -- (-893.880) [-891.169] (-892.090) (-891.711) * (-889.225) (-889.463) (-893.637) [-891.946] -- 0:01:38
309500 -- (-894.607) [-892.549] (-892.171) (-899.746) * (-889.774) [-893.113] (-887.618) (-896.828) -- 0:01:38
310000 -- (-892.649) [-890.814] (-893.633) (-906.479) * (-890.854) (-891.677) (-889.505) [-893.767] -- 0:01:37
Average standard deviation of split frequencies: 0.001517
310500 -- (-886.636) (-890.726) [-892.926] (-898.850) * (-889.155) (-890.239) [-890.482] (-894.673) -- 0:01:37
311000 -- (-890.774) [-892.292] (-893.067) (-891.630) * (-891.257) (-895.938) [-890.824] (-888.938) -- 0:01:37
311500 -- (-896.512) (-891.208) [-893.303] (-894.387) * (-894.303) (-899.115) (-894.016) [-894.619] -- 0:01:37
312000 -- [-890.660] (-892.112) (-888.228) (-893.685) * [-887.961] (-892.123) (-891.150) (-892.606) -- 0:01:37
312500 -- (-893.175) [-889.091] (-892.137) (-890.403) * (-890.485) (-890.123) (-889.878) [-890.874] -- 0:01:36
313000 -- (-889.343) (-893.044) (-891.339) [-891.760] * [-892.764] (-890.057) (-889.844) (-893.060) -- 0:01:36
313500 -- (-890.856) (-889.394) (-889.764) [-889.858] * (-895.171) [-890.931] (-894.994) (-890.712) -- 0:01:36
314000 -- [-888.184] (-893.793) (-889.310) (-893.702) * (-900.407) [-892.606] (-887.507) (-892.352) -- 0:01:36
314500 -- (-890.630) (-889.086) [-890.009] (-893.846) * (-901.472) (-888.279) (-893.376) [-890.463] -- 0:01:38
315000 -- (-900.303) [-893.951] (-894.316) (-890.882) * (-895.489) (-891.181) (-893.706) [-891.030] -- 0:01:37
Average standard deviation of split frequencies: 0.001492
315500 -- (-893.337) [-895.174] (-889.379) (-889.779) * (-895.762) [-891.657] (-896.394) (-892.053) -- 0:01:37
316000 -- [-890.815] (-894.544) (-892.455) (-893.451) * (-889.370) (-891.316) (-890.003) [-891.887] -- 0:01:37
316500 -- (-888.680) (-890.318) [-895.644] (-893.693) * (-892.081) [-888.941] (-890.268) (-892.973) -- 0:01:37
317000 -- (-888.734) [-893.005] (-891.151) (-892.746) * (-894.176) [-892.348] (-890.522) (-887.799) -- 0:01:36
317500 -- (-891.187) [-893.444] (-894.944) (-889.607) * (-891.348) (-891.852) [-892.597] (-892.751) -- 0:01:36
318000 -- (-891.670) (-897.007) [-892.624] (-893.264) * (-889.071) (-894.383) [-891.532] (-892.766) -- 0:01:36
318500 -- (-891.271) (-893.325) (-889.229) [-889.910] * (-891.297) [-890.983] (-890.416) (-890.885) -- 0:01:36
319000 -- (-893.670) [-894.576] (-889.831) (-891.619) * [-893.080] (-891.596) (-894.119) (-891.089) -- 0:01:36
319500 -- [-894.577] (-890.486) (-888.194) (-895.100) * (-890.892) [-889.651] (-895.161) (-893.356) -- 0:01:35
320000 -- (-899.090) [-895.217] (-887.342) (-891.949) * (-893.528) [-892.305] (-890.853) (-894.944) -- 0:01:35
Average standard deviation of split frequencies: 0.001470
320500 -- (-891.350) (-890.022) (-889.640) [-897.259] * (-897.924) (-891.956) [-890.060] (-890.328) -- 0:01:35
321000 -- [-892.149] (-888.259) (-891.367) (-891.902) * (-895.023) (-892.256) [-888.161] (-893.231) -- 0:01:35
321500 -- (-896.259) (-893.562) (-889.408) [-889.630] * (-895.230) (-886.994) [-891.663] (-890.576) -- 0:01:37
322000 -- [-889.206] (-894.171) (-888.636) (-890.373) * (-889.877) [-894.169] (-888.929) (-890.969) -- 0:01:36
322500 -- (-890.510) (-895.729) [-891.245] (-889.677) * (-888.324) (-894.725) [-888.239] (-890.561) -- 0:01:36
323000 -- [-893.655] (-897.385) (-889.331) (-892.952) * (-896.538) [-893.482] (-890.422) (-892.729) -- 0:01:36
323500 -- (-891.130) [-891.002] (-888.410) (-887.586) * (-891.397) [-891.644] (-895.794) (-894.144) -- 0:01:36
324000 -- (-894.841) (-893.349) [-891.956] (-892.058) * (-893.081) (-893.668) [-892.258] (-887.633) -- 0:01:35
324500 -- (-892.662) (-889.398) (-890.150) [-888.167] * (-907.349) (-897.447) [-893.923] (-890.369) -- 0:01:35
325000 -- (-894.642) (-891.868) [-891.907] (-894.743) * (-893.610) (-896.829) (-891.490) [-888.932] -- 0:01:35
Average standard deviation of split frequencies: 0.002892
325500 -- (-896.774) [-890.483] (-889.332) (-894.532) * (-893.801) [-893.827] (-894.404) (-895.134) -- 0:01:35
326000 -- (-892.684) [-893.510] (-888.695) (-892.523) * (-898.127) (-894.832) (-888.869) [-888.773] -- 0:01:35
326500 -- (-889.806) (-891.032) (-891.236) [-889.635] * (-891.979) (-895.198) (-887.325) [-895.840] -- 0:01:34
327000 -- (-890.762) [-888.750] (-891.224) (-891.333) * (-893.642) [-889.114] (-892.051) (-893.833) -- 0:01:34
327500 -- (-889.138) (-895.508) [-889.552] (-890.878) * (-894.273) (-892.016) [-888.899] (-893.039) -- 0:01:34
328000 -- (-891.067) [-890.376] (-891.399) (-894.127) * (-889.734) [-889.729] (-892.400) (-892.219) -- 0:01:34
328500 -- (-892.142) (-892.681) [-890.793] (-892.572) * [-888.034] (-892.237) (-890.363) (-891.490) -- 0:01:36
329000 -- [-892.834] (-890.661) (-895.400) (-891.018) * (-892.902) (-889.808) (-894.566) [-887.511] -- 0:01:35
329500 -- (-893.041) (-893.611) [-890.831] (-891.089) * [-892.901] (-888.745) (-892.794) (-891.841) -- 0:01:35
330000 -- (-896.169) (-892.480) [-896.535] (-894.223) * (-893.902) (-895.529) (-894.927) [-894.172] -- 0:01:35
Average standard deviation of split frequencies: 0.004277
330500 -- (-891.955) (-897.685) [-893.866] (-892.616) * (-890.419) (-891.397) (-894.443) [-899.015] -- 0:01:35
331000 -- (-890.478) (-891.218) [-894.296] (-894.636) * (-894.129) (-893.601) (-892.536) [-896.032] -- 0:01:34
331500 -- (-891.173) [-891.403] (-895.430) (-893.593) * (-895.551) (-895.187) [-890.993] (-893.646) -- 0:01:34
332000 -- (-892.016) [-894.652] (-894.727) (-893.783) * (-899.013) (-893.319) [-894.010] (-893.692) -- 0:01:34
332500 -- (-892.266) (-891.913) [-893.273] (-890.669) * (-897.511) (-889.646) (-892.284) [-897.605] -- 0:01:34
333000 -- (-892.596) (-891.028) (-899.126) [-895.480] * (-893.748) [-897.839] (-893.365) (-892.445) -- 0:01:34
333500 -- (-891.615) (-893.059) [-893.888] (-889.705) * (-894.356) (-895.061) [-893.485] (-893.743) -- 0:01:33
334000 -- [-890.031] (-904.044) (-900.914) (-895.461) * (-890.925) [-890.057] (-892.848) (-891.055) -- 0:01:33
334500 -- [-892.231] (-889.287) (-892.840) (-896.740) * (-896.782) (-899.015) [-891.738] (-890.089) -- 0:01:33
335000 -- [-890.928] (-892.272) (-890.108) (-894.857) * (-891.947) (-889.793) (-890.053) [-887.570] -- 0:01:33
Average standard deviation of split frequencies: 0.004209
335500 -- (-888.635) [-890.194] (-891.285) (-892.119) * [-893.390] (-892.554) (-891.646) (-892.050) -- 0:01:35
336000 -- (-893.659) [-890.578] (-898.074) (-891.398) * (-892.137) (-895.016) (-888.935) [-890.817] -- 0:01:34
336500 -- (-891.917) [-888.599] (-889.363) (-896.179) * (-892.001) [-890.156] (-894.300) (-891.607) -- 0:01:34
337000 -- (-892.263) [-890.488] (-891.181) (-891.246) * (-897.038) [-889.712] (-898.255) (-890.971) -- 0:01:34
337500 -- (-893.684) [-888.313] (-894.035) (-895.151) * [-888.343] (-892.294) (-892.772) (-890.602) -- 0:01:34
338000 -- (-893.201) [-889.337] (-891.567) (-889.273) * (-895.866) (-893.033) [-889.796] (-888.124) -- 0:01:34
338500 -- [-893.226] (-889.264) (-894.363) (-888.829) * [-890.464] (-889.213) (-888.471) (-890.243) -- 0:01:33
339000 -- (-891.652) [-891.682] (-891.246) (-892.109) * (-894.995) (-892.323) (-889.750) [-888.186] -- 0:01:33
339500 -- (-899.829) (-889.867) [-889.710] (-889.345) * (-892.175) (-891.157) (-892.524) [-890.026] -- 0:01:33
340000 -- (-896.051) (-891.571) (-897.034) [-886.676] * (-891.861) (-893.272) [-896.128] (-891.580) -- 0:01:33
Average standard deviation of split frequencies: 0.008303
340500 -- (-890.891) [-889.452] (-889.364) (-892.439) * (-891.924) (-890.240) [-892.110] (-891.723) -- 0:01:32
341000 -- (-892.784) [-888.280] (-890.564) (-891.818) * [-893.156] (-893.030) (-891.933) (-890.488) -- 0:01:32
341500 -- (-895.233) (-888.575) (-891.346) [-893.092] * (-896.813) [-888.481] (-885.318) (-890.781) -- 0:01:32
342000 -- (-892.129) [-891.845] (-897.414) (-889.860) * (-898.688) (-892.054) (-891.278) [-893.523] -- 0:01:32
342500 -- (-892.033) (-897.764) (-890.331) [-891.782] * (-893.955) [-894.963] (-893.780) (-894.192) -- 0:01:32
343000 -- (-902.260) (-890.642) [-892.011] (-888.202) * [-891.804] (-888.550) (-892.672) (-890.576) -- 0:01:33
343500 -- (-894.711) [-889.587] (-894.102) (-895.756) * (-894.259) (-894.071) [-894.146] (-894.008) -- 0:01:33
344000 -- (-890.069) (-895.237) (-894.202) [-894.949] * (-895.222) (-897.093) (-900.183) [-891.063] -- 0:01:33
344500 -- (-891.270) [-889.545] (-896.486) (-896.986) * (-896.250) (-899.789) [-892.991] (-890.595) -- 0:01:33
345000 -- [-892.362] (-896.709) (-891.262) (-894.506) * (-890.150) (-900.635) (-894.173) [-894.096] -- 0:01:33
Average standard deviation of split frequencies: 0.008175
345500 -- (-891.470) (-895.770) [-895.771] (-894.591) * (-894.715) (-900.153) [-897.932] (-895.624) -- 0:01:32
346000 -- (-894.189) (-900.251) (-895.664) [-891.594] * (-890.060) (-901.997) (-893.668) [-889.978] -- 0:01:32
346500 -- (-891.615) (-893.255) [-892.416] (-894.190) * (-890.539) [-894.238] (-893.462) (-892.882) -- 0:01:32
347000 -- [-900.437] (-893.905) (-896.053) (-890.613) * (-890.061) (-894.417) [-893.670] (-896.877) -- 0:01:32
347500 -- (-893.158) [-890.572] (-891.599) (-891.758) * (-899.400) (-896.742) [-900.281] (-894.114) -- 0:01:32
348000 -- (-894.142) (-892.158) (-890.158) [-892.838] * (-891.938) [-889.227] (-893.212) (-894.270) -- 0:01:31
348500 -- (-889.632) [-892.940] (-890.625) (-891.256) * (-895.458) (-892.877) (-890.065) [-896.518] -- 0:01:31
349000 -- (-889.583) (-890.475) (-895.512) [-890.532] * (-890.134) (-891.789) [-890.332] (-895.713) -- 0:01:31
349500 -- [-891.435] (-887.274) (-895.494) (-891.107) * (-892.676) [-892.977] (-888.959) (-892.746) -- 0:01:33
350000 -- (-891.048) (-888.621) (-890.232) [-892.090] * (-892.437) (-897.337) (-892.806) [-892.377] -- 0:01:32
Average standard deviation of split frequencies: 0.009410
350500 -- (-895.474) (-890.594) [-892.045] (-890.585) * (-891.850) (-891.682) (-890.924) [-890.186] -- 0:01:32
351000 -- (-893.445) (-895.061) [-891.884] (-899.057) * [-889.041] (-892.203) (-896.654) (-891.873) -- 0:01:32
351500 -- [-891.900] (-898.895) (-894.639) (-892.650) * (-892.144) (-893.080) [-890.566] (-900.513) -- 0:01:32
352000 -- (-899.241) [-892.262] (-895.312) (-895.922) * (-889.781) (-893.605) [-888.478] (-891.942) -- 0:01:32
352500 -- (-894.564) (-893.849) [-893.376] (-899.211) * [-893.083] (-898.996) (-896.541) (-892.447) -- 0:01:31
353000 -- (-891.345) [-889.452] (-889.161) (-893.782) * [-890.867] (-893.842) (-890.175) (-894.148) -- 0:01:31
353500 -- [-889.575] (-891.506) (-898.501) (-891.388) * (-897.588) [-890.187] (-889.914) (-899.126) -- 0:01:31
354000 -- (-890.442) (-891.183) [-894.300] (-888.853) * (-892.913) (-893.117) [-889.376] (-896.176) -- 0:01:31
354500 -- [-890.908] (-889.616) (-888.678) (-892.481) * [-890.246] (-892.425) (-900.832) (-891.787) -- 0:01:31
355000 -- (-893.294) (-893.160) [-892.141] (-892.264) * [-894.514] (-895.067) (-888.533) (-893.585) -- 0:01:30
Average standard deviation of split frequencies: 0.009269
355500 -- (-890.198) (-896.341) [-893.633] (-894.128) * (-892.871) (-891.763) [-889.208] (-892.588) -- 0:01:30
356000 -- (-889.829) [-892.226] (-894.141) (-893.839) * (-891.285) (-888.803) [-891.309] (-892.415) -- 0:01:30
356500 -- (-892.899) [-891.747] (-894.091) (-892.741) * (-896.130) (-892.775) [-891.766] (-895.731) -- 0:01:30
357000 -- (-888.289) (-895.936) [-887.549] (-891.381) * (-892.200) [-891.061] (-891.458) (-898.365) -- 0:01:31
357500 -- [-897.163] (-896.457) (-891.330) (-895.769) * [-891.493] (-895.595) (-891.177) (-895.269) -- 0:01:31
358000 -- (-891.993) (-890.368) (-894.213) [-888.474] * (-898.352) [-891.292] (-889.709) (-896.359) -- 0:01:31
358500 -- (-889.087) (-898.310) (-891.728) [-892.155] * [-890.370] (-893.339) (-889.658) (-896.542) -- 0:01:31
359000 -- (-892.459) (-899.271) [-891.828] (-891.943) * [-894.754] (-893.627) (-892.419) (-891.339) -- 0:01:31
359500 -- (-901.857) (-897.970) (-900.540) [-891.717] * (-890.342) [-893.675] (-893.360) (-894.154) -- 0:01:30
360000 -- (-893.859) (-892.485) (-895.436) [-887.240] * (-888.303) [-887.508] (-895.789) (-889.557) -- 0:01:30
Average standard deviation of split frequencies: 0.007842
360500 -- (-893.631) [-894.695] (-893.992) (-892.118) * (-890.621) (-891.390) [-892.694] (-892.037) -- 0:01:30
361000 -- (-894.852) (-892.690) (-897.137) [-897.958] * (-892.859) (-901.871) [-893.941] (-897.952) -- 0:01:30
361500 -- (-889.660) (-895.933) [-895.668] (-898.475) * [-891.897] (-897.090) (-896.937) (-894.501) -- 0:01:30
362000 -- (-898.467) (-893.529) (-899.019) [-893.464] * [-895.670] (-891.045) (-890.631) (-890.130) -- 0:01:29
362500 -- (-893.146) (-889.166) [-895.058] (-893.254) * (-892.895) (-896.616) [-891.803] (-892.326) -- 0:01:29
363000 -- [-896.446] (-894.569) (-893.737) (-893.438) * [-888.163] (-888.582) (-892.889) (-890.785) -- 0:01:29
363500 -- [-888.484] (-890.450) (-898.271) (-890.785) * [-894.680] (-899.427) (-896.756) (-892.794) -- 0:01:29
364000 -- (-894.898) (-897.574) [-889.571] (-890.662) * [-887.638] (-891.896) (-894.681) (-890.855) -- 0:01:30
364500 -- [-893.042] (-897.702) (-892.341) (-892.319) * [-895.773] (-893.297) (-891.754) (-887.612) -- 0:01:30
365000 -- (-892.894) (-891.364) (-888.303) [-896.919] * (-891.416) [-894.671] (-889.930) (-892.973) -- 0:01:30
Average standard deviation of split frequencies: 0.007728
365500 -- (-892.061) (-894.383) (-888.751) [-893.933] * [-897.082] (-896.009) (-893.737) (-892.719) -- 0:01:30
366000 -- (-889.616) (-892.271) [-889.438] (-891.676) * (-894.688) (-894.454) (-896.483) [-889.406] -- 0:01:30
366500 -- (-892.753) (-896.866) [-893.128] (-894.719) * [-888.892] (-892.939) (-892.779) (-889.004) -- 0:01:29
367000 -- (-890.937) (-893.674) (-896.535) [-893.273] * [-888.710] (-892.214) (-892.932) (-889.961) -- 0:01:29
367500 -- (-893.427) [-890.991] (-891.702) (-891.991) * [-890.172] (-888.148) (-888.530) (-895.020) -- 0:01:29
368000 -- (-894.348) (-887.745) (-892.708) [-893.451] * (-890.532) (-891.099) [-893.570] (-899.112) -- 0:01:29
368500 -- [-889.691] (-891.975) (-899.205) (-891.106) * [-890.922] (-892.715) (-891.021) (-896.207) -- 0:01:29
369000 -- [-892.356] (-890.072) (-893.216) (-889.487) * [-892.663] (-894.809) (-891.120) (-888.651) -- 0:01:28
369500 -- [-898.518] (-890.575) (-898.601) (-891.002) * [-891.623] (-891.164) (-888.864) (-892.867) -- 0:01:28
370000 -- (-892.206) (-894.623) [-892.888] (-889.747) * (-890.191) [-889.298] (-889.514) (-895.856) -- 0:01:28
Average standard deviation of split frequencies: 0.006359
370500 -- (-891.355) [-891.367] (-896.851) (-889.831) * (-887.673) (-895.311) (-894.629) [-889.635] -- 0:01:28
371000 -- [-887.734] (-890.263) (-897.027) (-890.378) * (-889.879) [-893.903] (-892.032) (-887.218) -- 0:01:29
371500 -- [-891.473] (-892.012) (-897.119) (-892.206) * [-892.015] (-893.427) (-891.828) (-894.151) -- 0:01:29
372000 -- (-898.753) (-891.151) (-888.777) [-890.891] * (-895.522) [-895.637] (-892.144) (-890.532) -- 0:01:29
372500 -- (-888.735) (-898.535) [-888.661] (-891.076) * (-892.861) (-896.782) (-894.782) [-891.867] -- 0:01:29
373000 -- (-887.505) [-891.657] (-898.352) (-889.176) * (-895.063) (-892.478) [-892.313] (-891.170) -- 0:01:29
373500 -- (-891.356) [-893.736] (-895.652) (-887.425) * (-888.022) (-892.633) [-892.549] (-888.626) -- 0:01:28
374000 -- (-893.355) [-897.515] (-893.851) (-898.170) * (-890.563) (-898.341) [-894.681] (-892.844) -- 0:01:28
374500 -- (-888.531) [-889.537] (-889.775) (-890.412) * [-893.240] (-892.837) (-894.746) (-889.731) -- 0:01:28
375000 -- (-898.435) (-888.947) (-889.693) [-889.031] * (-894.002) (-890.817) [-888.509] (-896.506) -- 0:01:28
Average standard deviation of split frequencies: 0.005015
375500 -- (-889.252) [-891.619] (-895.708) (-890.795) * (-900.464) [-896.137] (-891.592) (-895.199) -- 0:01:28
376000 -- (-895.014) (-895.522) (-889.322) [-895.266] * [-890.375] (-899.520) (-890.163) (-897.737) -- 0:01:27
376500 -- (-892.571) [-892.161] (-896.848) (-893.611) * (-893.894) (-895.442) [-890.653] (-891.491) -- 0:01:27
377000 -- (-897.381) (-890.022) [-892.223] (-896.433) * (-893.557) [-892.597] (-890.631) (-890.737) -- 0:01:27
377500 -- (-892.017) [-891.407] (-892.454) (-891.195) * [-891.732] (-891.761) (-895.150) (-891.271) -- 0:01:27
378000 -- [-889.844] (-894.130) (-893.581) (-887.987) * (-892.702) [-890.785] (-889.069) (-889.699) -- 0:01:28
378500 -- (-892.386) (-893.075) [-897.210] (-894.969) * (-893.982) (-889.950) (-888.410) [-893.513] -- 0:01:28
379000 -- (-890.154) [-892.784] (-889.029) (-892.169) * (-892.295) (-891.135) [-889.114] (-894.349) -- 0:01:28
379500 -- (-889.338) [-891.763] (-894.220) (-891.415) * (-889.190) (-889.252) (-891.571) [-891.222] -- 0:01:28
380000 -- (-895.667) (-892.486) (-890.868) [-892.971] * (-890.923) (-890.769) (-893.426) [-891.703] -- 0:01:28
Average standard deviation of split frequencies: 0.003715
380500 -- [-891.563] (-892.437) (-892.312) (-891.005) * [-894.574] (-889.895) (-891.184) (-890.027) -- 0:01:27
381000 -- (-891.583) (-888.260) (-890.022) [-895.203] * (-894.547) (-892.749) (-891.514) [-886.779] -- 0:01:27
381500 -- (-889.166) [-889.839] (-892.205) (-887.796) * (-900.506) [-892.988] (-890.657) (-892.616) -- 0:01:27
382000 -- (-890.499) (-892.494) [-891.979] (-892.763) * (-894.208) [-890.053] (-892.487) (-898.480) -- 0:01:27
382500 -- (-889.668) (-888.694) [-890.450] (-895.711) * (-894.257) (-892.479) (-895.580) [-897.103] -- 0:01:27
383000 -- [-893.145] (-890.676) (-899.385) (-892.333) * [-894.191] (-893.894) (-889.968) (-891.366) -- 0:01:26
383500 -- (-893.818) (-888.647) [-894.686] (-896.087) * (-890.143) (-891.319) [-894.491] (-894.060) -- 0:01:26
384000 -- [-890.565] (-891.119) (-887.320) (-899.131) * [-888.743] (-896.502) (-891.517) (-893.304) -- 0:01:26
384500 -- (-895.612) [-891.044] (-889.710) (-890.891) * (-890.548) (-894.467) (-890.282) [-892.791] -- 0:01:26
385000 -- (-896.148) (-895.919) [-887.559] (-889.927) * [-889.544] (-897.183) (-893.981) (-892.703) -- 0:01:27
Average standard deviation of split frequencies: 0.003664
385500 -- (-893.035) [-892.891] (-886.935) (-889.681) * (-892.664) (-891.942) [-890.670] (-890.936) -- 0:01:27
386000 -- (-896.921) (-894.305) [-890.473] (-895.864) * [-889.232] (-893.427) (-897.990) (-896.173) -- 0:01:27
386500 -- [-891.298] (-887.894) (-893.387) (-892.349) * (-892.472) (-889.518) [-895.150] (-889.445) -- 0:01:27
387000 -- (-893.386) [-894.760] (-894.576) (-893.996) * [-889.148] (-891.262) (-893.056) (-892.605) -- 0:01:27
387500 -- (-887.639) (-896.346) [-892.067] (-892.298) * [-892.308] (-892.730) (-895.338) (-891.179) -- 0:01:26
388000 -- (-889.488) (-897.022) [-893.893] (-896.227) * (-889.746) (-889.941) [-893.092] (-894.107) -- 0:01:26
388500 -- (-889.568) (-888.505) [-901.149] (-895.216) * [-891.903] (-889.725) (-890.957) (-893.453) -- 0:01:26
389000 -- (-896.548) [-889.726] (-891.847) (-892.251) * (-896.236) (-892.196) (-890.411) [-890.204] -- 0:01:26
389500 -- (-890.626) (-895.000) [-891.644] (-889.972) * (-901.229) (-895.184) (-895.655) [-888.853] -- 0:01:26
390000 -- (-887.572) (-891.584) (-896.673) [-889.865] * (-898.380) [-892.446] (-892.204) (-891.999) -- 0:01:26
Average standard deviation of split frequencies: 0.003620
390500 -- (-897.631) (-893.269) [-892.794] (-893.818) * (-900.673) [-892.338] (-894.944) (-891.567) -- 0:01:25
391000 -- (-896.968) (-890.965) [-896.118] (-895.951) * (-897.824) [-889.687] (-889.205) (-890.805) -- 0:01:25
391500 -- (-893.550) (-887.470) [-889.720] (-888.139) * (-898.129) [-890.247] (-889.147) (-893.197) -- 0:01:25
392000 -- (-893.043) (-890.428) [-900.794] (-896.712) * (-892.272) (-893.229) [-888.882] (-891.116) -- 0:01:26
392500 -- (-900.065) [-890.953] (-895.579) (-894.060) * (-899.849) (-890.714) (-890.951) [-891.105] -- 0:01:26
393000 -- (-899.250) (-894.662) (-892.140) [-892.890] * (-898.702) (-895.545) [-893.410] (-892.710) -- 0:01:26
393500 -- (-889.683) (-898.325) [-893.459] (-892.274) * (-900.414) (-894.867) [-893.915] (-887.207) -- 0:01:26
394000 -- (-890.850) [-896.424] (-894.111) (-896.733) * (-902.037) (-894.449) (-898.201) [-891.817] -- 0:01:26
394500 -- (-891.107) [-889.267] (-897.932) (-891.381) * (-891.821) (-892.350) (-890.078) [-890.172] -- 0:01:25
395000 -- (-894.461) (-890.336) (-894.173) [-888.426] * (-894.003) [-900.606] (-893.308) (-888.947) -- 0:01:25
Average standard deviation of split frequencies: 0.004762
395500 -- (-893.316) (-890.265) [-888.601] (-891.942) * [-900.063] (-894.694) (-897.732) (-887.188) -- 0:01:25
396000 -- (-895.461) (-892.526) [-890.617] (-894.688) * [-894.962] (-897.092) (-900.199) (-892.593) -- 0:01:25
396500 -- [-890.392] (-895.355) (-887.324) (-894.602) * (-889.428) [-897.248] (-898.505) (-894.269) -- 0:01:25
397000 -- (-891.259) (-889.614) [-887.543] (-898.338) * [-890.074] (-892.035) (-891.574) (-890.235) -- 0:01:25
397500 -- [-892.156] (-892.866) (-889.840) (-895.549) * (-891.071) (-892.585) (-891.619) [-888.769] -- 0:01:24
398000 -- [-890.122] (-897.435) (-892.221) (-898.195) * [-892.451] (-891.586) (-892.898) (-901.866) -- 0:01:24
398500 -- (-890.344) (-896.057) [-887.730] (-900.290) * (-890.624) (-890.930) (-895.170) [-894.736] -- 0:01:24
399000 -- (-887.719) (-894.744) [-892.590] (-897.044) * (-890.186) [-891.687] (-894.337) (-889.800) -- 0:01:25
399500 -- [-893.011] (-892.670) (-890.362) (-898.506) * (-891.678) [-888.484] (-892.084) (-892.099) -- 0:01:25
400000 -- (-893.736) (-888.355) [-895.147] (-896.098) * (-893.723) (-894.628) [-891.626] (-890.511) -- 0:01:25
Average standard deviation of split frequencies: 0.003530
400500 -- [-890.508] (-894.483) (-895.116) (-890.497) * [-891.105] (-893.157) (-892.189) (-894.758) -- 0:01:25
401000 -- (-887.068) (-891.089) (-892.943) [-890.326] * [-892.788] (-893.811) (-894.978) (-889.643) -- 0:01:25
401500 -- (-893.572) [-889.264] (-892.373) (-899.134) * (-892.027) (-892.561) [-894.015] (-891.804) -- 0:01:24
402000 -- [-888.006] (-889.755) (-893.814) (-890.107) * [-889.492] (-891.477) (-892.262) (-895.370) -- 0:01:24
402500 -- (-891.111) (-892.395) (-893.236) [-889.432] * [-890.769] (-890.600) (-892.286) (-890.680) -- 0:01:24
403000 -- (-895.717) [-889.247] (-890.461) (-889.504) * (-899.017) (-899.520) (-891.288) [-888.358] -- 0:01:24
403500 -- (-893.663) [-887.528] (-890.737) (-894.062) * (-889.453) [-890.025] (-892.848) (-890.665) -- 0:01:24
404000 -- (-890.453) [-891.414] (-890.508) (-892.043) * (-890.957) (-895.012) (-892.109) [-888.964] -- 0:01:24
404500 -- (-890.812) [-890.107] (-893.483) (-893.361) * (-898.308) [-887.994] (-890.686) (-890.684) -- 0:01:23
405000 -- (-893.168) [-892.574] (-892.982) (-888.728) * (-892.945) [-888.653] (-890.489) (-889.806) -- 0:01:23
Average standard deviation of split frequencies: 0.003483
405500 -- (-892.674) (-892.855) [-896.910] (-897.834) * (-893.819) (-888.976) (-893.347) [-891.047] -- 0:01:23
406000 -- (-893.344) (-891.104) (-891.360) [-892.054] * [-894.074] (-892.730) (-893.844) (-894.382) -- 0:01:24
406500 -- (-898.971) (-889.320) [-889.195] (-894.192) * (-892.900) (-889.957) [-894.476] (-899.085) -- 0:01:24
407000 -- [-895.561] (-895.841) (-888.885) (-892.918) * (-892.617) (-889.800) [-893.197] (-897.680) -- 0:01:24
407500 -- (-892.812) (-898.451) [-889.761] (-889.375) * [-889.773] (-891.693) (-890.007) (-890.987) -- 0:01:24
408000 -- (-892.103) (-897.935) (-889.746) [-888.589] * (-892.043) (-892.716) (-890.988) [-889.574] -- 0:01:24
408500 -- (-889.338) (-893.359) [-893.572] (-891.313) * (-893.626) [-889.095] (-891.875) (-890.323) -- 0:01:23
409000 -- (-889.369) (-889.692) [-887.652] (-891.121) * [-895.082] (-895.945) (-893.248) (-892.510) -- 0:01:23
409500 -- [-889.932] (-890.297) (-888.161) (-889.102) * (-892.165) (-891.392) [-892.998] (-887.367) -- 0:01:23
410000 -- (-888.548) (-893.129) [-889.401] (-892.953) * (-889.849) (-895.023) (-888.298) [-890.423] -- 0:01:23
Average standard deviation of split frequencies: 0.003444
410500 -- (-889.234) [-890.284] (-893.777) (-890.279) * (-891.260) (-894.327) (-890.483) [-898.089] -- 0:01:23
411000 -- (-890.630) (-890.075) [-891.141] (-897.461) * (-895.431) (-887.102) [-893.257] (-893.321) -- 0:01:23
411500 -- (-890.738) (-889.474) [-890.110] (-891.566) * (-891.738) (-896.696) [-894.133] (-893.234) -- 0:01:22
412000 -- (-891.052) (-894.506) (-888.319) [-889.958] * (-892.576) [-894.111] (-897.344) (-896.715) -- 0:01:22
412500 -- [-892.516] (-889.125) (-891.795) (-891.186) * (-895.104) [-890.739] (-895.899) (-892.698) -- 0:01:22
413000 -- (-893.303) [-891.279] (-890.343) (-890.891) * (-892.155) [-890.959] (-889.672) (-891.482) -- 0:01:23
413500 -- (-892.551) [-889.289] (-888.236) (-896.078) * [-896.769] (-891.225) (-892.760) (-894.187) -- 0:01:23
414000 -- (-894.386) [-888.357] (-890.776) (-893.004) * [-900.161] (-890.284) (-898.646) (-894.054) -- 0:01:23
414500 -- (-896.060) (-894.354) [-893.813] (-894.789) * (-891.671) [-893.410] (-893.328) (-903.155) -- 0:01:23
415000 -- (-892.678) (-891.675) (-892.014) [-893.341] * [-889.273] (-897.328) (-890.246) (-899.968) -- 0:01:23
Average standard deviation of split frequencies: 0.001133
415500 -- (-893.748) [-891.160] (-894.287) (-890.373) * (-892.682) (-891.175) (-893.455) [-892.306] -- 0:01:22
416000 -- (-890.539) [-887.992] (-898.663) (-890.720) * (-888.667) (-891.820) (-890.762) [-896.050] -- 0:01:22
416500 -- (-894.010) (-892.643) (-898.008) [-901.358] * (-896.931) (-897.455) (-894.135) [-894.460] -- 0:01:22
417000 -- (-894.330) (-896.224) [-895.178] (-895.750) * (-891.658) (-894.754) (-897.073) [-896.379] -- 0:01:22
417500 -- (-890.938) [-891.098] (-894.417) (-895.543) * [-891.729] (-892.056) (-896.279) (-891.287) -- 0:01:22
418000 -- (-890.840) (-893.188) (-892.821) [-890.215] * (-896.114) [-890.617] (-902.043) (-895.698) -- 0:01:22
418500 -- (-897.126) (-891.531) [-891.760] (-891.126) * (-897.974) (-890.065) (-895.649) [-887.920] -- 0:01:21
419000 -- (-898.554) (-897.218) [-891.275] (-890.579) * (-895.464) [-889.870] (-893.049) (-891.263) -- 0:01:21
419500 -- (-897.204) (-895.771) (-891.999) [-889.412] * (-898.083) [-898.962] (-894.366) (-893.446) -- 0:01:21
420000 -- (-897.513) [-890.897] (-893.679) (-893.290) * (-895.636) (-895.451) [-890.152] (-890.799) -- 0:01:22
Average standard deviation of split frequencies: 0.001121
420500 -- (-893.141) (-893.841) (-892.241) [-891.018] * [-891.494] (-890.741) (-889.943) (-890.079) -- 0:01:22
421000 -- (-890.981) (-888.505) [-892.226] (-894.282) * (-891.979) [-892.502] (-891.079) (-891.393) -- 0:01:22
421500 -- (-893.473) (-891.030) (-890.400) [-890.657] * (-894.036) [-890.012] (-888.983) (-893.266) -- 0:01:22
422000 -- (-889.864) (-888.093) [-891.572] (-899.372) * (-891.536) (-888.438) [-890.420] (-895.925) -- 0:01:22
422500 -- (-893.263) [-892.291] (-894.007) (-899.798) * (-893.200) [-890.529] (-890.865) (-893.378) -- 0:01:22
423000 -- (-895.256) (-890.112) (-889.055) [-891.816] * (-893.621) (-892.510) [-894.544] (-891.945) -- 0:01:21
423500 -- (-892.274) [-889.874] (-894.725) (-888.733) * [-892.757] (-894.453) (-890.547) (-892.228) -- 0:01:21
424000 -- (-890.887) (-898.521) [-897.241] (-888.801) * (-891.272) [-891.098] (-891.704) (-891.213) -- 0:01:21
424500 -- (-893.441) (-888.855) (-891.755) [-890.019] * (-888.135) (-897.481) [-892.536] (-888.213) -- 0:01:21
425000 -- (-891.097) (-890.325) [-892.996] (-891.596) * (-890.140) (-893.044) [-895.415] (-896.691) -- 0:01:21
Average standard deviation of split frequencies: 0.001107
425500 -- [-893.120] (-889.665) (-893.894) (-904.458) * (-890.142) [-895.831] (-893.022) (-891.793) -- 0:01:21
426000 -- (-888.311) (-891.156) [-889.387] (-896.051) * (-892.193) [-895.262] (-890.695) (-890.551) -- 0:01:20
426500 -- (-892.079) (-891.417) (-890.210) [-891.470] * (-895.170) (-889.843) (-895.279) [-892.901] -- 0:01:20
427000 -- (-889.233) (-891.983) (-891.101) [-890.539] * [-891.789] (-890.896) (-892.527) (-893.606) -- 0:01:21
427500 -- (-894.805) [-893.794] (-890.345) (-894.641) * (-892.631) (-891.787) (-894.356) [-887.847] -- 0:01:21
428000 -- (-896.192) [-889.290] (-898.880) (-890.971) * (-891.585) (-889.925) [-890.441] (-889.081) -- 0:01:21
428500 -- (-892.212) (-891.188) (-899.203) [-889.458] * (-893.523) (-894.137) (-891.016) [-891.005] -- 0:01:21
429000 -- [-892.785] (-892.299) (-894.106) (-890.290) * (-892.934) (-896.624) (-896.253) [-889.127] -- 0:01:21
429500 -- (-890.415) (-894.957) (-900.151) [-889.543] * (-891.847) [-893.379] (-890.273) (-889.113) -- 0:01:21
430000 -- (-892.787) (-892.962) [-893.113] (-894.998) * (-889.067) [-890.163] (-886.826) (-893.100) -- 0:01:20
Average standard deviation of split frequencies: 0.001095
430500 -- (-889.270) [-890.685] (-891.199) (-890.926) * (-893.138) [-892.399] (-891.395) (-896.185) -- 0:01:20
431000 -- (-895.917) (-893.021) (-890.436) [-891.373] * (-895.502) [-889.371] (-890.817) (-888.536) -- 0:01:20
431500 -- (-894.339) (-897.093) [-887.504] (-890.190) * (-891.198) [-891.510] (-896.343) (-890.419) -- 0:01:20
432000 -- (-894.544) (-897.734) [-892.274] (-893.907) * (-893.778) (-891.128) (-889.258) [-888.192] -- 0:01:20
432500 -- (-889.915) (-900.620) (-896.840) [-889.836] * (-889.340) [-893.961] (-891.013) (-889.790) -- 0:01:20
433000 -- (-893.903) [-893.354] (-892.695) (-890.809) * [-893.661] (-889.926) (-891.681) (-891.177) -- 0:01:19
433500 -- (-899.622) (-899.207) [-889.337] (-891.689) * (-895.968) [-887.617] (-892.223) (-887.385) -- 0:01:19
434000 -- [-891.158] (-898.901) (-892.387) (-892.561) * (-894.976) (-892.744) [-892.611] (-890.300) -- 0:01:20
434500 -- (-894.670) (-898.614) [-887.981] (-893.812) * [-892.088] (-888.806) (-894.205) (-896.447) -- 0:01:20
435000 -- (-893.683) (-900.308) (-894.746) [-891.374] * (-895.229) (-890.589) (-892.163) [-889.837] -- 0:01:20
Average standard deviation of split frequencies: 0.002162
435500 -- (-888.016) (-890.630) (-894.590) [-890.285] * (-896.073) (-894.731) [-889.621] (-892.925) -- 0:01:20
436000 -- (-892.059) (-892.318) (-900.428) [-893.117] * (-895.409) [-894.074] (-892.152) (-889.203) -- 0:01:20
436500 -- [-891.430] (-894.458) (-893.289) (-887.181) * (-893.293) (-889.115) (-894.300) [-891.813] -- 0:01:20
437000 -- [-890.605] (-889.255) (-893.742) (-886.254) * (-895.886) [-890.957] (-889.553) (-891.873) -- 0:01:19
437500 -- (-888.110) (-889.655) (-887.787) [-887.407] * [-896.594] (-893.010) (-889.555) (-892.810) -- 0:01:19
438000 -- (-891.830) (-896.325) [-892.551] (-892.050) * (-889.187) (-895.198) [-889.195] (-889.112) -- 0:01:19
438500 -- (-891.553) (-889.353) (-887.655) [-888.438] * [-893.526] (-894.582) (-890.418) (-889.771) -- 0:01:19
439000 -- [-890.471] (-895.338) (-891.613) (-898.117) * (-891.200) [-891.474] (-895.300) (-891.557) -- 0:01:19
439500 -- (-893.574) (-890.292) [-889.494] (-892.170) * (-891.598) [-894.069] (-889.748) (-891.677) -- 0:01:19
440000 -- (-895.596) (-891.144) (-892.664) [-889.967] * [-891.577] (-892.459) (-891.791) (-893.115) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
440500 -- [-887.874] (-892.385) (-893.163) (-889.819) * (-889.497) (-890.138) [-892.782] (-893.501) -- 0:01:18
441000 -- (-895.766) [-899.948] (-892.246) (-892.898) * (-890.149) [-893.042] (-898.961) (-889.398) -- 0:01:18
441500 -- (-894.902) (-895.848) [-892.132] (-897.218) * [-887.814] (-892.030) (-894.892) (-894.028) -- 0:01:19
442000 -- (-890.634) (-894.693) (-894.668) [-892.867] * (-890.495) (-894.126) [-888.593] (-889.017) -- 0:01:19
442500 -- (-893.109) (-897.255) [-891.143] (-897.388) * [-890.391] (-889.379) (-889.675) (-896.795) -- 0:01:19
443000 -- [-896.748] (-893.157) (-890.995) (-895.008) * (-891.386) (-900.509) (-893.711) [-892.750] -- 0:01:19
443500 -- (-898.459) (-893.174) [-893.868] (-894.990) * [-890.352] (-901.532) (-893.873) (-886.916) -- 0:01:19
444000 -- (-893.431) (-896.183) [-890.166] (-893.194) * (-890.904) (-894.947) (-891.870) [-889.854] -- 0:01:18
444500 -- (-895.528) [-896.329] (-890.924) (-891.872) * (-894.191) [-892.416] (-891.889) (-895.501) -- 0:01:18
445000 -- (-892.860) (-893.633) (-891.758) [-891.909] * (-889.414) [-892.735] (-894.759) (-889.258) -- 0:01:18
Average standard deviation of split frequencies: 0.001057
445500 -- (-894.079) (-895.567) [-888.713] (-887.676) * (-896.183) [-891.529] (-896.610) (-891.668) -- 0:01:18
446000 -- [-891.994] (-894.656) (-890.929) (-889.383) * (-891.351) (-893.517) (-892.214) [-892.363] -- 0:01:18
446500 -- (-899.580) [-897.009] (-890.865) (-890.149) * (-894.389) (-893.493) (-894.414) [-891.924] -- 0:01:18
447000 -- (-895.485) [-889.802] (-889.279) (-897.862) * (-890.816) (-893.435) (-892.391) [-897.676] -- 0:01:17
447500 -- (-892.726) (-889.160) [-892.904] (-894.203) * (-893.483) (-889.038) (-896.967) [-896.656] -- 0:01:17
448000 -- (-891.868) (-893.042) [-894.221] (-891.401) * [-890.786] (-888.197) (-892.082) (-899.638) -- 0:01:17
448500 -- (-891.660) (-894.102) [-891.459] (-895.855) * (-895.144) (-892.102) [-889.807] (-892.295) -- 0:01:18
449000 -- [-890.465] (-898.337) (-898.777) (-893.296) * (-889.878) [-892.164] (-888.635) (-897.942) -- 0:01:18
449500 -- (-893.793) (-894.076) (-895.175) [-890.252] * (-892.998) (-893.413) [-893.307] (-895.739) -- 0:01:18
450000 -- (-889.725) (-896.663) (-890.884) [-890.339] * [-897.997] (-888.245) (-888.978) (-889.262) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
450500 -- [-889.150] (-892.654) (-888.526) (-893.642) * (-892.895) (-888.619) [-894.288] (-890.899) -- 0:01:18
451000 -- (-893.412) (-890.729) (-891.650) [-890.001] * (-893.328) (-893.842) (-895.085) [-890.213] -- 0:01:17
451500 -- (-891.706) (-887.820) (-889.553) [-886.462] * (-892.151) [-893.130] (-890.997) (-897.136) -- 0:01:17
452000 -- (-889.105) (-894.052) [-892.011] (-890.336) * (-891.869) [-892.263] (-888.448) (-893.398) -- 0:01:17
452500 -- (-893.844) (-890.349) [-893.901] (-891.512) * [-891.089] (-894.276) (-890.462) (-901.888) -- 0:01:17
453000 -- (-893.595) (-893.661) (-891.118) [-890.503] * (-889.060) (-893.593) [-892.204] (-898.827) -- 0:01:17
453500 -- (-891.480) [-889.315] (-896.345) (-889.369) * (-888.764) [-891.287] (-888.773) (-896.572) -- 0:01:17
454000 -- (-894.916) [-894.439] (-898.103) (-889.662) * (-891.336) (-891.440) (-891.105) [-892.801] -- 0:01:16
454500 -- [-892.437] (-897.210) (-895.322) (-892.611) * (-895.019) (-894.418) (-891.680) [-894.011] -- 0:01:16
455000 -- (-891.771) (-891.859) (-894.551) [-890.922] * (-893.772) (-891.795) (-895.276) [-889.661] -- 0:01:17
Average standard deviation of split frequencies: 0.002068
455500 -- (-892.816) [-892.652] (-888.627) (-897.163) * (-890.446) [-891.541] (-897.329) (-897.330) -- 0:01:17
456000 -- [-895.359] (-891.090) (-892.955) (-902.499) * (-892.028) [-889.423] (-897.186) (-897.315) -- 0:01:17
456500 -- (-894.722) (-890.971) [-889.385] (-893.170) * (-890.104) (-890.483) [-893.059] (-888.020) -- 0:01:17
457000 -- (-894.542) (-888.093) (-891.542) [-889.410] * [-894.835] (-900.350) (-890.520) (-891.031) -- 0:01:17
457500 -- (-892.096) [-890.562] (-897.646) (-888.946) * (-890.154) (-893.780) [-894.912] (-894.768) -- 0:01:17
458000 -- (-891.923) [-890.598] (-894.239) (-896.205) * [-890.489] (-894.634) (-890.706) (-893.040) -- 0:01:16
458500 -- (-895.508) (-891.419) [-892.610] (-900.055) * (-894.199) [-891.282] (-892.015) (-891.491) -- 0:01:16
459000 -- (-892.324) (-894.981) [-890.588] (-887.014) * [-893.360] (-896.529) (-891.317) (-891.382) -- 0:01:16
459500 -- (-890.767) (-891.010) [-890.301] (-894.742) * (-897.467) [-893.646] (-892.751) (-902.189) -- 0:01:16
460000 -- (-895.297) [-892.041] (-891.852) (-893.298) * [-890.388] (-889.534) (-890.877) (-896.217) -- 0:01:16
Average standard deviation of split frequencies: 0.001023
460500 -- (-892.275) [-896.341] (-892.952) (-893.592) * (-895.518) (-895.007) [-892.037] (-893.031) -- 0:01:16
461000 -- [-889.812] (-888.682) (-896.255) (-896.347) * (-896.954) (-902.061) [-888.705] (-896.999) -- 0:01:15
461500 -- [-900.412] (-888.556) (-893.312) (-890.735) * [-893.330] (-894.587) (-889.988) (-893.271) -- 0:01:15
462000 -- (-888.727) [-888.898] (-895.564) (-895.378) * (-889.432) (-893.739) (-895.580) [-896.299] -- 0:01:15
462500 -- (-891.738) (-892.667) [-890.611] (-891.023) * [-889.173] (-897.754) (-890.835) (-895.869) -- 0:01:16
463000 -- (-892.356) [-893.800] (-893.121) (-894.649) * (-886.058) (-893.594) [-893.006] (-895.625) -- 0:01:16
463500 -- [-891.025] (-899.233) (-891.132) (-893.285) * (-900.240) (-892.834) [-891.357] (-892.684) -- 0:01:16
464000 -- (-895.075) (-894.117) (-892.877) [-888.780] * [-896.197] (-893.643) (-893.381) (-893.792) -- 0:01:16
464500 -- (-893.980) (-893.969) [-891.648] (-888.793) * [-890.743] (-894.898) (-893.772) (-898.812) -- 0:01:16
465000 -- [-891.562] (-893.156) (-894.531) (-889.831) * [-889.493] (-890.146) (-890.439) (-898.443) -- 0:01:15
Average standard deviation of split frequencies: 0.001012
465500 -- [-891.458] (-896.597) (-892.101) (-889.921) * (-889.899) [-892.216] (-892.338) (-895.704) -- 0:01:15
466000 -- (-892.028) [-890.268] (-891.873) (-893.307) * (-890.090) (-892.151) [-893.872] (-894.554) -- 0:01:15
466500 -- (-891.874) [-893.300] (-899.270) (-896.124) * [-891.587] (-891.356) (-895.890) (-892.471) -- 0:01:15
467000 -- [-893.316] (-892.955) (-889.567) (-894.491) * [-889.043] (-889.046) (-891.468) (-893.242) -- 0:01:15
467500 -- (-889.885) (-891.080) (-899.794) [-896.123] * [-900.213] (-889.322) (-889.399) (-892.250) -- 0:01:15
468000 -- [-888.539] (-892.315) (-890.864) (-892.411) * (-895.667) [-892.870] (-889.125) (-896.835) -- 0:01:15
468500 -- [-888.441] (-893.657) (-893.743) (-893.497) * (-889.230) (-893.013) (-889.928) [-892.932] -- 0:01:14
469000 -- (-890.778) (-893.063) [-891.843] (-893.381) * (-888.519) (-896.471) (-893.327) [-893.622] -- 0:01:14
469500 -- (-888.866) (-892.859) [-889.647] (-888.680) * (-892.274) (-892.937) (-890.847) [-887.258] -- 0:01:15
470000 -- (-893.520) [-893.201] (-888.690) (-887.699) * (-892.103) [-890.580] (-889.555) (-899.215) -- 0:01:15
Average standard deviation of split frequencies: 0.001002
470500 -- [-890.205] (-891.627) (-894.771) (-889.686) * (-894.890) [-895.260] (-895.044) (-890.894) -- 0:01:15
471000 -- [-891.741] (-894.303) (-891.723) (-893.521) * [-890.518] (-892.061) (-892.346) (-892.108) -- 0:01:15
471500 -- (-891.801) (-891.337) (-894.953) [-893.764] * (-894.627) [-894.325] (-890.228) (-895.243) -- 0:01:15
472000 -- [-891.620] (-897.259) (-893.628) (-896.411) * [-895.083] (-889.054) (-892.021) (-899.504) -- 0:01:14
472500 -- (-901.744) (-893.579) (-892.604) [-893.352] * (-889.675) [-892.698] (-894.351) (-893.677) -- 0:01:14
473000 -- (-892.006) (-892.664) (-887.868) [-898.507] * (-891.921) (-899.978) (-890.246) [-892.524] -- 0:01:14
473500 -- [-891.881] (-895.481) (-894.472) (-896.572) * (-889.496) (-894.750) (-893.122) [-889.311] -- 0:01:14
474000 -- (-889.504) [-887.966] (-894.070) (-895.245) * [-890.591] (-891.356) (-890.225) (-891.510) -- 0:01:14
474500 -- (-895.563) (-894.295) (-898.321) [-899.580] * [-897.430] (-891.491) (-898.573) (-888.687) -- 0:01:14
475000 -- (-893.830) (-890.572) (-894.302) [-891.120] * (-897.731) (-892.650) (-892.406) [-889.513] -- 0:01:14
Average standard deviation of split frequencies: 0.000990
475500 -- [-891.611] (-890.333) (-891.972) (-891.053) * [-894.091] (-890.364) (-894.395) (-897.430) -- 0:01:13
476000 -- (-892.091) [-890.107] (-892.762) (-889.916) * (-890.813) (-890.103) [-890.801] (-903.119) -- 0:01:13
476500 -- [-888.744] (-890.273) (-889.229) (-892.693) * (-899.864) (-891.193) [-893.253] (-888.542) -- 0:01:14
477000 -- (-895.443) (-888.386) [-889.052] (-893.260) * (-891.930) (-890.256) [-891.468] (-890.277) -- 0:01:14
477500 -- (-892.689) [-893.522] (-893.357) (-887.848) * (-893.386) [-893.384] (-892.477) (-891.979) -- 0:01:14
478000 -- (-888.060) (-890.334) [-889.591] (-891.303) * [-893.818] (-890.080) (-890.575) (-894.973) -- 0:01:14
478500 -- [-892.110] (-894.061) (-891.910) (-894.816) * (-900.310) (-892.053) [-891.546] (-895.084) -- 0:01:14
479000 -- [-893.284] (-895.129) (-892.691) (-891.052) * (-897.457) [-891.539] (-890.444) (-891.358) -- 0:01:13
479500 -- [-894.694] (-887.953) (-891.811) (-894.249) * (-893.468) (-891.642) [-895.106] (-891.110) -- 0:01:13
480000 -- [-890.032] (-891.584) (-891.752) (-892.156) * (-892.204) [-888.718] (-891.382) (-892.014) -- 0:01:13
Average standard deviation of split frequencies: 0.000981
480500 -- (-895.964) (-889.572) (-896.996) [-892.518] * (-888.185) [-892.639] (-899.137) (-894.986) -- 0:01:13
481000 -- (-894.358) (-893.577) [-890.292] (-890.603) * [-890.333] (-891.098) (-901.345) (-889.841) -- 0:01:13
481500 -- [-887.717] (-894.669) (-889.524) (-893.624) * [-893.575] (-888.510) (-890.439) (-896.470) -- 0:01:13
482000 -- (-893.993) [-889.490] (-890.058) (-895.443) * [-889.683] (-892.369) (-891.657) (-895.386) -- 0:01:13
482500 -- (-892.744) [-888.704] (-894.795) (-890.257) * [-892.018] (-892.764) (-890.245) (-892.715) -- 0:01:12
483000 -- (-889.881) [-890.710] (-893.253) (-896.811) * [-890.474] (-891.376) (-894.108) (-887.469) -- 0:01:12
483500 -- (-894.546) (-889.957) [-891.307] (-893.700) * (-892.901) [-890.168] (-897.745) (-889.274) -- 0:01:13
484000 -- (-888.820) [-890.887] (-892.261) (-887.877) * [-892.524] (-890.273) (-895.712) (-893.412) -- 0:01:13
484500 -- (-896.952) (-891.836) (-892.151) [-889.955] * (-891.060) [-888.914] (-895.697) (-890.299) -- 0:01:13
485000 -- (-891.075) [-890.625] (-895.076) (-889.019) * [-893.033] (-889.905) (-892.081) (-890.602) -- 0:01:13
Average standard deviation of split frequencies: 0.000970
485500 -- (-889.992) (-893.819) (-891.300) [-892.139] * (-889.275) (-892.838) (-890.811) [-889.336] -- 0:01:13
486000 -- [-893.474] (-889.915) (-898.904) (-890.156) * (-894.707) [-891.003] (-892.556) (-892.159) -- 0:01:12
486500 -- (-893.182) (-895.388) (-891.082) [-894.290] * (-893.853) (-891.670) (-896.287) [-890.393] -- 0:01:12
487000 -- (-891.645) (-891.552) [-893.755] (-889.685) * [-892.035] (-896.062) (-890.785) (-891.735) -- 0:01:12
487500 -- (-891.073) (-889.633) (-896.687) [-891.923] * (-890.233) (-893.595) (-891.419) [-894.745] -- 0:01:12
488000 -- [-888.110] (-902.520) (-901.654) (-893.363) * (-892.529) (-894.384) (-890.136) [-892.381] -- 0:01:12
488500 -- (-894.277) (-897.909) (-896.533) [-889.555] * (-889.786) [-894.054] (-888.479) (-889.760) -- 0:01:12
489000 -- [-889.087] (-891.173) (-892.635) (-892.030) * (-892.591) (-890.160) (-889.932) [-891.182] -- 0:01:12
489500 -- [-888.457] (-895.257) (-888.785) (-890.269) * (-888.956) (-890.819) [-888.250] (-902.414) -- 0:01:11
490000 -- [-890.658] (-897.768) (-897.209) (-893.250) * (-898.425) (-894.168) (-895.062) [-899.736] -- 0:01:11
Average standard deviation of split frequencies: 0.000961
490500 -- [-891.590] (-894.255) (-889.973) (-889.417) * (-896.348) [-890.714] (-897.970) (-888.584) -- 0:01:12
491000 -- [-889.335] (-890.837) (-888.836) (-892.192) * [-890.690] (-890.081) (-892.838) (-894.482) -- 0:01:12
491500 -- [-887.089] (-892.987) (-891.494) (-891.318) * [-894.081] (-899.113) (-886.944) (-888.724) -- 0:01:12
492000 -- (-893.240) [-890.753] (-892.366) (-897.128) * [-890.812] (-888.937) (-892.588) (-891.882) -- 0:01:12
492500 -- (-890.794) [-891.893] (-891.165) (-894.232) * (-887.402) [-891.355] (-891.220) (-895.131) -- 0:01:12
493000 -- (-889.028) (-897.231) [-891.179] (-896.337) * (-893.748) [-888.957] (-895.250) (-892.397) -- 0:01:11
493500 -- (-888.019) [-895.780] (-896.503) (-891.143) * (-888.875) [-891.863] (-898.412) (-893.977) -- 0:01:11
494000 -- [-893.492] (-888.410) (-893.162) (-889.307) * (-889.994) [-890.340] (-894.870) (-896.918) -- 0:01:11
494500 -- [-889.102] (-894.875) (-892.621) (-891.536) * (-889.293) [-890.462] (-903.406) (-888.946) -- 0:01:11
495000 -- (-892.861) (-887.186) (-895.025) [-888.439] * (-891.046) [-893.529] (-897.956) (-892.472) -- 0:01:11
Average standard deviation of split frequencies: 0.001901
495500 -- (-897.937) (-893.606) (-889.477) [-891.817] * [-892.994] (-895.033) (-898.390) (-890.300) -- 0:01:11
496000 -- (-894.366) (-889.547) [-891.039] (-895.442) * [-890.242] (-896.655) (-895.847) (-891.829) -- 0:01:11
496500 -- (-892.660) [-891.155] (-890.027) (-896.030) * (-894.925) (-891.993) (-892.775) [-888.048] -- 0:01:10
497000 -- [-892.665] (-896.467) (-899.552) (-887.716) * (-895.529) [-891.371] (-890.953) (-893.489) -- 0:01:10
497500 -- (-889.339) (-891.218) [-894.319] (-894.942) * [-892.918] (-893.718) (-891.157) (-891.876) -- 0:01:11
498000 -- [-889.564] (-892.971) (-896.353) (-893.650) * (-892.246) [-893.719] (-894.752) (-893.252) -- 0:01:11
498500 -- [-890.273] (-891.990) (-889.511) (-892.389) * (-890.489) (-888.650) (-898.774) [-890.814] -- 0:01:11
499000 -- (-889.641) [-888.012] (-899.315) (-891.545) * [-891.983] (-893.260) (-891.738) (-893.712) -- 0:01:11
499500 -- [-894.649] (-890.330) (-891.634) (-891.137) * [-889.978] (-889.880) (-889.747) (-896.580) -- 0:01:11
500000 -- [-893.676] (-890.865) (-896.682) (-893.473) * [-890.048] (-895.159) (-890.953) (-891.399) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
500500 -- (-893.018) [-890.304] (-894.835) (-902.150) * (-900.128) [-891.273] (-892.292) (-891.810) -- 0:01:10
501000 -- (-897.169) [-890.652] (-895.648) (-891.398) * (-889.153) [-893.863] (-888.787) (-888.591) -- 0:01:10
501500 -- (-890.886) [-889.769] (-890.563) (-889.808) * (-893.887) (-896.671) [-891.835] (-897.890) -- 0:01:10
502000 -- (-892.322) (-893.199) (-891.094) [-892.115] * [-897.729] (-890.728) (-898.761) (-892.788) -- 0:01:10
502500 -- (-901.179) [-889.236] (-894.870) (-890.046) * [-891.287] (-895.540) (-898.922) (-893.290) -- 0:01:10
503000 -- (-893.834) (-890.403) [-892.515] (-898.161) * (-895.347) (-898.493) [-889.552] (-894.921) -- 0:01:10
503500 -- (-890.706) (-889.937) [-891.023] (-890.879) * (-896.410) (-888.640) [-893.047] (-892.795) -- 0:01:10
504000 -- (-889.655) (-889.315) [-895.763] (-897.075) * (-893.016) (-896.829) [-891.212] (-897.575) -- 0:01:09
504500 -- (-893.967) (-893.479) [-894.036] (-897.917) * (-894.897) (-896.532) [-888.492] (-891.295) -- 0:01:10
505000 -- (-896.728) [-889.185] (-890.777) (-889.383) * (-894.022) [-890.274] (-888.917) (-898.925) -- 0:01:10
Average standard deviation of split frequencies: 0.000932
505500 -- (-891.399) (-892.591) (-897.173) [-891.287] * [-891.630] (-886.833) (-894.557) (-889.878) -- 0:01:10
506000 -- [-887.153] (-889.461) (-894.834) (-894.052) * (-889.778) [-891.898] (-892.852) (-895.205) -- 0:01:10
506500 -- (-890.645) (-888.705) [-890.634] (-895.254) * (-889.744) [-891.483] (-890.874) (-894.247) -- 0:01:10
507000 -- (-889.229) [-893.290] (-891.736) (-893.522) * [-890.398] (-891.036) (-897.102) (-896.871) -- 0:01:10
507500 -- [-890.686] (-892.216) (-890.361) (-889.638) * (-886.797) (-894.860) [-893.047] (-899.201) -- 0:01:09
508000 -- (-892.064) (-901.362) [-892.346] (-891.398) * [-887.991] (-897.697) (-887.026) (-898.562) -- 0:01:09
508500 -- [-891.285] (-896.590) (-893.607) (-895.757) * (-889.761) [-892.214] (-888.831) (-897.645) -- 0:01:09
509000 -- [-892.182] (-890.791) (-891.080) (-890.307) * (-895.235) (-891.895) [-887.415] (-899.182) -- 0:01:09
509500 -- (-891.034) (-892.756) (-894.223) [-894.677] * (-892.764) [-892.269] (-890.502) (-897.974) -- 0:01:09
510000 -- (-891.793) (-891.995) (-897.162) [-895.991] * (-888.137) [-892.658] (-887.911) (-894.080) -- 0:01:09
Average standard deviation of split frequencies: 0.000923
510500 -- (-898.800) (-898.038) [-898.369] (-901.958) * (-894.420) [-891.897] (-892.626) (-895.733) -- 0:01:09
511000 -- [-899.746] (-894.440) (-894.730) (-903.171) * (-893.687) [-893.000] (-889.577) (-892.330) -- 0:01:08
511500 -- (-891.566) [-895.225] (-890.365) (-888.980) * (-892.247) (-894.264) (-889.511) [-891.431] -- 0:01:09
512000 -- (-889.338) (-894.697) [-891.229] (-900.345) * (-888.221) (-894.378) [-889.987] (-895.369) -- 0:01:09
512500 -- [-889.769] (-894.978) (-890.814) (-896.055) * (-889.011) (-890.166) [-890.289] (-888.361) -- 0:01:09
513000 -- (-889.486) (-890.538) [-890.250] (-890.984) * (-890.144) [-889.308] (-890.524) (-895.481) -- 0:01:09
513500 -- [-897.367] (-893.581) (-887.661) (-894.194) * (-896.343) [-891.624] (-891.794) (-893.222) -- 0:01:09
514000 -- [-892.194] (-892.527) (-893.015) (-893.168) * (-897.177) (-888.484) (-890.778) [-896.269] -- 0:01:09
514500 -- [-890.842] (-896.904) (-889.356) (-892.262) * [-888.266] (-891.553) (-891.234) (-897.568) -- 0:01:08
515000 -- (-890.545) (-895.916) (-895.711) [-892.655] * (-891.709) (-890.499) [-890.293] (-890.704) -- 0:01:08
Average standard deviation of split frequencies: 0.000914
515500 -- [-896.409] (-888.378) (-892.268) (-892.894) * (-892.365) (-895.696) [-896.083] (-888.819) -- 0:01:08
516000 -- [-893.911] (-889.208) (-891.850) (-897.029) * (-896.311) (-892.396) (-889.953) [-890.265] -- 0:01:08
516500 -- [-891.328] (-892.393) (-894.343) (-890.231) * (-897.473) (-898.935) (-896.764) [-892.024] -- 0:01:08
517000 -- (-892.529) [-892.334] (-890.786) (-894.057) * (-891.192) [-886.557] (-893.952) (-889.649) -- 0:01:08
517500 -- (-890.172) (-897.317) (-893.151) [-890.165] * (-890.041) [-890.328] (-898.346) (-892.167) -- 0:01:08
518000 -- [-889.945] (-894.104) (-890.134) (-896.366) * (-889.591) (-889.913) (-891.688) [-890.311] -- 0:01:07
518500 -- (-899.552) (-894.252) (-893.407) [-894.538] * (-888.384) (-899.143) [-895.063] (-892.879) -- 0:01:08
519000 -- (-894.703) (-891.364) (-891.721) [-891.092] * [-888.058] (-894.203) (-892.447) (-890.309) -- 0:01:08
519500 -- [-894.448] (-893.786) (-891.201) (-892.031) * [-891.284] (-896.939) (-889.666) (-891.085) -- 0:01:08
520000 -- (-894.744) (-894.911) [-890.902] (-895.638) * (-888.684) (-893.486) [-890.296] (-891.095) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
520500 -- (-894.196) (-896.137) [-893.277] (-894.926) * (-887.718) (-894.552) [-888.744] (-889.535) -- 0:01:08
521000 -- (-897.765) (-895.333) [-893.904] (-893.829) * [-890.222] (-893.261) (-887.799) (-894.177) -- 0:01:08
521500 -- [-892.919] (-889.280) (-892.390) (-896.055) * [-889.427] (-891.420) (-894.213) (-892.217) -- 0:01:07
522000 -- (-894.359) [-895.032] (-891.332) (-889.820) * (-889.923) (-888.201) [-890.966] (-887.726) -- 0:01:07
522500 -- (-893.378) [-889.598] (-894.991) (-894.114) * (-890.128) (-889.664) [-889.917] (-896.353) -- 0:01:07
523000 -- (-890.290) (-892.257) (-891.987) [-891.245] * (-900.145) (-893.947) [-888.949] (-890.562) -- 0:01:07
523500 -- (-891.710) [-889.714] (-892.445) (-891.713) * (-898.473) (-891.722) (-893.230) [-893.867] -- 0:01:07
524000 -- [-890.802] (-891.189) (-895.599) (-893.481) * (-893.540) [-890.223] (-898.482) (-890.604) -- 0:01:07
524500 -- (-896.061) [-890.299] (-896.779) (-896.011) * (-890.285) [-888.790] (-891.915) (-894.770) -- 0:01:07
525000 -- (-891.478) [-891.025] (-893.474) (-893.619) * [-890.671] (-892.930) (-892.482) (-897.021) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
525500 -- (-892.382) [-894.012] (-889.526) (-891.193) * (-890.420) (-890.113) [-889.440] (-896.610) -- 0:01:07
526000 -- (-901.806) (-898.742) (-893.001) [-891.080] * (-890.808) [-889.187] (-896.022) (-902.127) -- 0:01:07
526500 -- (-895.665) (-890.911) (-892.066) [-895.227] * (-889.751) (-889.903) [-889.924] (-901.775) -- 0:01:07
527000 -- [-888.952] (-891.343) (-892.735) (-891.535) * (-895.044) (-890.679) (-888.500) [-892.455] -- 0:01:07
527500 -- (-890.747) [-889.243] (-888.263) (-890.552) * [-892.439] (-889.459) (-886.543) (-895.749) -- 0:01:07
528000 -- [-892.057] (-892.557) (-891.587) (-896.729) * [-888.845] (-892.158) (-888.875) (-895.533) -- 0:01:07
528500 -- (-898.142) (-895.742) [-889.691] (-892.878) * (-891.541) (-888.156) [-890.789] (-889.422) -- 0:01:06
529000 -- (-893.136) [-893.571] (-898.257) (-889.003) * [-893.374] (-889.073) (-891.041) (-897.910) -- 0:01:06
529500 -- (-896.836) [-889.047] (-896.013) (-896.285) * (-887.673) (-890.252) [-894.828] (-901.990) -- 0:01:06
530000 -- (-894.551) (-894.371) (-895.567) [-903.649] * (-895.123) (-890.124) [-887.606] (-895.815) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
530500 -- [-892.462] (-896.297) (-890.829) (-898.206) * (-895.922) [-888.549] (-894.403) (-891.714) -- 0:01:06
531000 -- (-894.544) (-894.643) (-892.347) [-901.630] * (-893.025) [-891.856] (-892.175) (-905.014) -- 0:01:06
531500 -- [-890.491] (-892.947) (-891.284) (-897.305) * (-892.349) (-893.306) (-892.192) [-890.455] -- 0:01:06
532000 -- (-895.093) (-895.672) [-897.424] (-893.560) * [-893.566] (-890.068) (-891.653) (-903.414) -- 0:01:05
532500 -- (-895.585) [-889.854] (-892.738) (-891.770) * (-895.426) [-890.479] (-891.208) (-895.342) -- 0:01:05
533000 -- [-893.385] (-892.900) (-895.020) (-890.156) * (-893.655) [-894.253] (-895.338) (-892.982) -- 0:01:06
533500 -- (-889.027) (-898.593) [-891.853] (-891.057) * (-897.337) [-893.123] (-894.635) (-895.891) -- 0:01:06
534000 -- (-889.323) [-890.003] (-894.529) (-893.979) * (-891.665) (-892.616) [-893.104] (-890.561) -- 0:01:06
534500 -- (-890.597) (-891.294) (-896.003) [-896.088] * [-895.219] (-890.567) (-893.091) (-893.517) -- 0:01:06
535000 -- [-890.314] (-890.471) (-896.758) (-895.749) * (-889.438) [-889.725] (-892.155) (-896.142) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
535500 -- [-888.432] (-889.769) (-890.780) (-894.603) * (-897.470) [-887.855] (-892.361) (-893.365) -- 0:01:05
536000 -- [-891.933] (-897.995) (-890.498) (-889.671) * (-890.834) (-890.867) [-893.230] (-893.515) -- 0:01:05
536500 -- (-891.542) [-894.361] (-891.862) (-890.061) * [-891.711] (-895.536) (-892.548) (-892.970) -- 0:01:05
537000 -- (-897.972) (-893.641) (-894.397) [-892.812] * (-895.015) (-896.443) (-893.006) [-889.192] -- 0:01:05
537500 -- (-899.566) [-893.914] (-889.839) (-892.300) * (-892.486) (-898.158) [-889.661] (-901.028) -- 0:01:05
538000 -- [-903.682] (-889.792) (-886.816) (-895.276) * (-889.583) (-889.271) (-890.318) [-895.395] -- 0:01:05
538500 -- [-895.796] (-897.916) (-889.970) (-892.944) * [-891.650] (-890.539) (-894.636) (-892.236) -- 0:01:05
539000 -- [-892.202] (-889.914) (-891.103) (-888.003) * [-899.147] (-890.867) (-890.788) (-896.117) -- 0:01:05
539500 -- (-900.397) [-893.533] (-892.136) (-889.920) * [-892.826] (-890.049) (-893.912) (-893.456) -- 0:01:04
540000 -- (-891.149) (-891.539) [-894.235] (-894.031) * (-895.152) (-889.597) (-890.825) [-889.057] -- 0:01:05
Average standard deviation of split frequencies: 0.000872
540500 -- [-890.882] (-894.616) (-891.344) (-898.122) * (-891.410) (-888.292) [-892.456] (-890.666) -- 0:01:05
541000 -- [-888.587] (-889.021) (-892.412) (-889.118) * (-893.428) (-892.291) [-890.405] (-892.654) -- 0:01:05
541500 -- [-895.370] (-887.909) (-890.781) (-893.945) * (-895.674) (-893.792) [-894.132] (-890.650) -- 0:01:05
542000 -- (-892.761) (-886.826) [-890.357] (-890.134) * [-888.025] (-894.484) (-895.564) (-889.267) -- 0:01:05
542500 -- [-890.529] (-889.403) (-890.844) (-896.388) * [-893.037] (-896.759) (-893.725) (-891.937) -- 0:01:04
543000 -- (-888.828) (-894.102) [-889.905] (-893.398) * (-897.532) (-897.336) (-892.012) [-889.892] -- 0:01:04
543500 -- (-895.274) (-893.732) [-889.619] (-889.352) * (-894.273) [-890.151] (-897.018) (-889.332) -- 0:01:04
544000 -- (-896.986) (-902.383) [-886.936] (-891.552) * [-893.305] (-892.328) (-891.649) (-891.331) -- 0:01:04
544500 -- (-893.720) [-892.980] (-894.270) (-896.425) * (-893.670) (-895.821) [-891.458] (-896.211) -- 0:01:04
545000 -- (-894.597) [-889.862] (-891.422) (-894.570) * (-893.094) [-890.857] (-887.719) (-893.213) -- 0:01:04
Average standard deviation of split frequencies: 0.000863
545500 -- [-888.986] (-892.562) (-890.300) (-899.460) * [-894.313] (-890.944) (-890.814) (-891.859) -- 0:01:04
546000 -- (-891.444) (-896.222) (-892.097) [-892.057] * (-893.447) (-893.328) (-894.258) [-895.579] -- 0:01:04
546500 -- (-892.493) (-894.510) (-889.622) [-891.063] * (-897.031) [-894.356] (-894.880) (-892.406) -- 0:01:03
547000 -- (-900.160) [-890.663] (-894.743) (-888.579) * (-891.729) (-892.044) [-889.013] (-897.997) -- 0:01:04
547500 -- (-890.949) (-893.133) [-890.080] (-889.398) * [-890.250] (-897.798) (-893.732) (-889.768) -- 0:01:04
548000 -- [-891.473] (-892.738) (-892.002) (-888.174) * [-889.756] (-893.189) (-889.132) (-890.037) -- 0:01:04
548500 -- (-892.766) (-891.882) [-893.012] (-889.872) * [-895.544] (-900.615) (-891.815) (-891.677) -- 0:01:04
549000 -- (-898.764) (-896.751) (-897.028) [-887.485] * [-891.857] (-889.306) (-892.323) (-892.759) -- 0:01:04
549500 -- (-899.251) [-890.096] (-890.474) (-893.036) * (-894.316) [-889.575] (-889.047) (-890.394) -- 0:01:03
550000 -- (-897.426) (-888.934) [-891.621] (-893.376) * (-891.540) [-893.072] (-893.202) (-895.125) -- 0:01:03
Average standard deviation of split frequencies: 0.000856
550500 -- [-891.617] (-895.792) (-887.850) (-899.028) * (-892.485) [-891.845] (-891.319) (-892.426) -- 0:01:03
551000 -- [-891.546] (-888.895) (-890.404) (-891.487) * (-891.063) [-892.059] (-892.791) (-895.546) -- 0:01:03
551500 -- (-901.878) [-892.165] (-892.706) (-894.971) * (-889.093) [-897.157] (-898.816) (-899.207) -- 0:01:03
552000 -- [-889.281] (-892.806) (-894.593) (-893.836) * [-892.033] (-889.375) (-893.189) (-891.027) -- 0:01:03
552500 -- (-891.638) [-889.248] (-889.590) (-899.440) * (-899.187) (-891.324) [-893.404] (-891.755) -- 0:01:03
553000 -- [-890.502] (-895.202) (-888.223) (-894.514) * (-898.875) (-892.167) [-891.297] (-888.426) -- 0:01:03
553500 -- (-894.250) [-894.798] (-891.158) (-896.002) * (-893.023) (-891.743) (-890.991) [-892.349] -- 0:01:02
554000 -- [-890.711] (-894.359) (-893.785) (-895.015) * (-893.534) (-891.190) [-892.145] (-891.354) -- 0:01:03
554500 -- (-893.475) (-889.676) [-891.214] (-891.016) * (-892.243) [-891.209] (-890.684) (-890.346) -- 0:01:03
555000 -- [-894.848] (-889.295) (-889.020) (-890.827) * (-893.664) [-887.053] (-896.101) (-888.560) -- 0:01:03
Average standard deviation of split frequencies: 0.000848
555500 -- (-894.289) (-889.471) (-893.815) [-894.598] * [-890.633] (-890.980) (-890.104) (-887.710) -- 0:01:03
556000 -- (-890.114) (-888.235) [-890.118] (-898.313) * (-893.572) (-894.030) (-890.456) [-892.741] -- 0:01:03
556500 -- (-895.620) (-890.612) [-892.477] (-896.843) * [-889.714] (-888.902) (-896.568) (-897.538) -- 0:01:02
557000 -- (-890.932) (-887.507) (-891.226) [-899.065] * (-889.873) [-892.770] (-893.372) (-894.483) -- 0:01:02
557500 -- (-892.067) [-893.252] (-891.651) (-894.863) * [-888.028] (-895.933) (-893.297) (-893.316) -- 0:01:02
558000 -- [-890.587] (-891.826) (-894.425) (-893.983) * (-890.222) [-890.447] (-892.763) (-891.329) -- 0:01:02
558500 -- [-890.095] (-888.658) (-893.198) (-896.912) * [-895.634] (-895.817) (-898.206) (-894.476) -- 0:01:02
559000 -- [-890.069] (-895.312) (-890.982) (-896.398) * (-889.854) [-894.638] (-895.237) (-890.384) -- 0:01:02
559500 -- [-889.862] (-889.968) (-895.403) (-898.091) * [-887.593] (-896.793) (-890.507) (-891.146) -- 0:01:02
560000 -- (-894.064) (-891.966) (-893.123) [-888.642] * (-896.925) (-896.372) [-893.808] (-897.670) -- 0:01:02
Average standard deviation of split frequencies: 0.001682
560500 -- (-888.779) (-898.280) [-890.452] (-897.275) * (-894.148) [-892.837] (-889.882) (-897.125) -- 0:01:02
561000 -- (-889.640) [-895.962] (-889.093) (-892.124) * (-902.020) [-888.245] (-894.678) (-892.740) -- 0:01:02
561500 -- [-898.027] (-892.199) (-888.416) (-891.309) * (-892.262) (-890.058) [-890.084] (-889.437) -- 0:01:02
562000 -- (-893.062) (-895.688) [-894.556] (-891.754) * (-890.795) [-892.244] (-891.344) (-891.000) -- 0:01:02
562500 -- [-889.020] (-899.470) (-891.044) (-892.358) * [-891.085] (-889.923) (-895.008) (-897.209) -- 0:01:02
563000 -- (-890.189) (-892.721) (-891.356) [-890.966] * (-890.811) (-891.087) (-890.638) [-889.513] -- 0:01:02
563500 -- (-895.343) [-895.008] (-896.366) (-891.951) * (-889.762) [-888.752] (-893.640) (-891.229) -- 0:01:01
564000 -- (-889.801) (-890.893) (-889.397) [-889.320] * [-897.243] (-888.350) (-893.129) (-891.187) -- 0:01:01
564500 -- (-892.787) (-892.507) (-890.691) [-892.090] * (-890.029) [-893.343] (-891.564) (-894.726) -- 0:01:01
565000 -- (-891.078) (-892.281) (-891.201) [-894.780] * [-889.149] (-890.785) (-891.816) (-895.016) -- 0:01:01
Average standard deviation of split frequencies: 0.002499
565500 -- (-895.000) [-896.003] (-892.776) (-892.194) * (-892.188) [-889.271] (-891.565) (-893.461) -- 0:01:01
566000 -- (-887.958) (-893.326) (-893.436) [-888.147] * (-894.016) (-889.555) (-891.632) [-895.801] -- 0:01:01
566500 -- [-889.946] (-893.354) (-889.107) (-890.895) * (-892.015) [-890.998] (-891.951) (-891.115) -- 0:01:01
567000 -- (-893.370) [-897.173] (-891.879) (-894.683) * [-887.437] (-893.177) (-894.136) (-893.036) -- 0:01:01
567500 -- (-892.025) [-889.294] (-890.199) (-894.670) * (-900.058) (-890.943) (-893.155) [-892.806] -- 0:01:01
568000 -- (-890.463) (-894.127) (-894.410) [-895.953] * (-890.758) [-896.363] (-893.755) (-894.043) -- 0:01:01
568500 -- [-894.400] (-890.478) (-891.898) (-901.867) * [-892.690] (-893.093) (-899.572) (-892.850) -- 0:01:01
569000 -- (-889.519) [-889.543] (-898.927) (-893.677) * (-891.548) [-895.934] (-894.435) (-896.314) -- 0:01:01
569500 -- [-891.813] (-889.605) (-891.810) (-896.860) * (-888.777) [-890.045] (-890.669) (-889.343) -- 0:01:01
570000 -- [-897.283] (-895.798) (-901.598) (-889.075) * [-888.663] (-890.148) (-894.972) (-890.370) -- 0:01:01
Average standard deviation of split frequencies: 0.002478
570500 -- (-892.472) (-888.378) (-895.622) [-888.338] * [-893.377] (-892.425) (-891.595) (-893.544) -- 0:01:00
571000 -- (-888.079) [-889.192] (-898.118) (-892.704) * (-888.286) (-891.402) [-895.159] (-893.204) -- 0:01:00
571500 -- (-888.625) (-891.854) (-900.839) [-888.443] * (-889.922) (-891.624) [-892.669] (-889.272) -- 0:01:00
572000 -- [-890.795] (-893.386) (-898.661) (-895.554) * (-891.595) (-890.914) [-887.895] (-890.275) -- 0:01:00
572500 -- (-896.062) (-893.161) (-894.527) [-894.116] * (-891.534) [-890.302] (-897.237) (-890.507) -- 0:01:00
573000 -- (-897.753) (-896.454) (-895.837) [-888.283] * (-890.448) (-892.808) [-896.423] (-894.920) -- 0:01:00
573500 -- (-892.673) [-891.083] (-897.081) (-894.371) * (-887.987) (-891.357) [-890.388] (-896.930) -- 0:01:00
574000 -- (-889.796) [-888.575] (-897.436) (-898.398) * (-888.894) [-893.166] (-890.397) (-898.774) -- 0:01:00
574500 -- (-893.353) [-891.722] (-893.120) (-894.914) * (-890.436) (-890.587) (-898.229) [-898.160] -- 0:01:00
575000 -- (-895.119) (-888.581) (-890.381) [-890.170] * (-895.025) [-888.337] (-901.295) (-895.247) -- 0:01:00
Average standard deviation of split frequencies: 0.001637
575500 -- (-897.267) (-889.550) (-892.358) [-889.438] * [-889.990] (-892.525) (-895.043) (-891.863) -- 0:01:00
576000 -- [-888.692] (-892.739) (-891.470) (-890.940) * (-893.909) (-887.405) [-893.398] (-893.428) -- 0:01:00
576500 -- (-891.260) [-887.980] (-893.180) (-891.956) * [-887.966] (-888.320) (-892.004) (-890.630) -- 0:01:00
577000 -- [-890.261] (-891.778) (-894.756) (-892.685) * (-900.052) (-888.735) [-891.800] (-891.875) -- 0:01:00
577500 -- (-899.485) (-890.212) [-893.960] (-890.781) * (-894.717) [-890.799] (-896.076) (-889.494) -- 0:00:59
578000 -- [-892.591] (-893.192) (-895.218) (-892.674) * (-891.822) (-890.438) [-891.101] (-892.711) -- 0:00:59
578500 -- (-893.972) [-886.463] (-889.169) (-895.703) * (-895.601) [-891.609] (-890.622) (-896.529) -- 0:00:59
579000 -- [-889.349] (-890.031) (-896.642) (-897.605) * (-891.155) (-893.001) [-888.788] (-898.480) -- 0:00:59
579500 -- (-892.295) [-889.376] (-894.110) (-894.369) * [-891.885] (-894.809) (-895.266) (-891.498) -- 0:00:59
580000 -- (-891.694) [-890.575] (-889.302) (-893.827) * [-901.922] (-899.490) (-891.470) (-891.595) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
580500 -- (-894.980) (-887.449) (-890.109) [-891.998] * (-892.188) (-890.688) (-891.416) [-892.544] -- 0:00:59
581000 -- (-893.334) (-891.380) (-892.054) [-892.655] * (-898.085) [-893.093] (-891.707) (-892.756) -- 0:00:59
581500 -- (-892.005) [-888.017] (-889.913) (-894.666) * (-898.928) (-889.504) (-889.040) [-888.080] -- 0:00:59
582000 -- [-886.965] (-895.807) (-889.137) (-891.653) * [-891.899] (-893.129) (-894.487) (-888.315) -- 0:00:59
582500 -- (-887.608) [-890.719] (-895.009) (-892.441) * (-896.926) (-892.315) (-892.654) [-894.383] -- 0:00:59
583000 -- (-894.253) (-891.042) [-887.968] (-889.997) * (-897.749) (-895.900) (-901.205) [-893.278] -- 0:00:59
583500 -- [-891.943] (-893.720) (-889.396) (-889.042) * (-891.781) [-892.746] (-894.241) (-894.079) -- 0:00:59
584000 -- (-891.482) [-898.213] (-890.063) (-893.853) * (-892.082) (-888.723) (-898.631) [-893.623] -- 0:00:59
584500 -- (-895.884) (-890.482) [-890.279] (-895.858) * (-891.925) (-891.700) [-892.135] (-891.863) -- 0:00:59
585000 -- [-887.567] (-892.884) (-891.757) (-890.421) * [-889.980] (-893.972) (-890.359) (-894.903) -- 0:00:58
Average standard deviation of split frequencies: 0.001609
585500 -- (-890.198) (-889.279) [-893.312] (-891.503) * (-891.771) (-892.804) [-894.150] (-896.079) -- 0:00:58
586000 -- (-894.457) (-901.695) (-893.778) [-887.133] * [-889.996] (-893.801) (-893.567) (-894.700) -- 0:00:58
586500 -- (-896.337) [-896.319] (-888.388) (-895.338) * (-890.603) [-889.020] (-894.069) (-893.895) -- 0:00:58
587000 -- (-892.547) [-899.541] (-886.021) (-891.857) * (-894.526) [-891.293] (-892.128) (-888.940) -- 0:00:58
587500 -- (-893.659) (-895.757) [-894.501] (-896.209) * (-891.439) [-889.471] (-895.751) (-888.746) -- 0:00:58
588000 -- (-890.098) (-894.420) [-889.703] (-889.343) * (-890.075) (-893.478) (-896.575) [-890.243] -- 0:00:58
588500 -- (-891.181) (-892.700) [-888.054] (-890.200) * (-891.072) [-890.517] (-898.262) (-889.086) -- 0:00:58
589000 -- (-890.600) [-892.120] (-890.091) (-895.250) * (-892.049) [-888.518] (-894.634) (-891.948) -- 0:00:58
589500 -- [-889.191] (-890.706) (-901.672) (-892.773) * (-893.271) (-894.623) (-892.264) [-892.336] -- 0:00:58
590000 -- [-894.931] (-893.486) (-892.684) (-891.955) * (-894.791) (-889.538) [-891.761] (-889.799) -- 0:00:58
Average standard deviation of split frequencies: 0.002394
590500 -- (-891.312) (-890.547) (-894.517) [-891.179] * (-892.407) [-894.041] (-889.629) (-891.871) -- 0:00:58
591000 -- (-891.191) (-891.437) (-898.674) [-890.827] * (-897.012) (-903.586) [-897.425] (-898.142) -- 0:00:58
591500 -- [-892.943] (-889.869) (-895.557) (-901.662) * (-900.984) [-891.420] (-895.323) (-888.385) -- 0:00:58
592000 -- [-888.449] (-889.901) (-894.798) (-894.853) * (-891.443) (-889.180) [-889.747] (-896.395) -- 0:00:57
592500 -- (-894.816) [-892.120] (-893.470) (-890.434) * (-892.976) (-891.090) [-893.082] (-894.807) -- 0:00:57
593000 -- (-892.393) (-891.498) (-895.186) [-890.292] * [-891.002] (-896.895) (-889.937) (-889.780) -- 0:00:57
593500 -- (-891.924) (-895.831) [-891.994] (-891.950) * (-893.461) [-891.540] (-887.938) (-888.991) -- 0:00:57
594000 -- [-888.527] (-889.416) (-895.899) (-893.750) * (-892.970) (-893.338) [-891.543] (-894.439) -- 0:00:57
594500 -- (-889.327) (-890.023) (-890.166) [-892.759] * (-890.419) (-899.839) [-896.100] (-894.343) -- 0:00:57
595000 -- [-892.352] (-888.693) (-893.561) (-892.043) * [-889.319] (-898.589) (-891.587) (-888.186) -- 0:00:57
Average standard deviation of split frequencies: 0.004746
595500 -- (-894.024) [-890.072] (-892.510) (-897.516) * [-888.790] (-895.013) (-895.843) (-890.453) -- 0:00:57
596000 -- (-893.282) (-893.090) [-890.177] (-892.671) * (-893.303) (-900.660) (-892.556) [-890.096] -- 0:00:57
596500 -- [-893.309] (-891.728) (-894.202) (-899.132) * (-888.786) [-893.819] (-895.200) (-888.316) -- 0:00:57
597000 -- (-906.066) (-888.306) (-889.898) [-890.535] * [-889.069] (-903.400) (-897.167) (-889.622) -- 0:00:57
597500 -- (-906.533) (-895.333) [-890.361] (-894.560) * (-889.806) (-899.037) [-893.422] (-889.402) -- 0:00:57
598000 -- (-900.237) [-891.536] (-890.778) (-892.870) * (-892.012) (-892.098) [-889.414] (-892.552) -- 0:00:57
598500 -- (-899.371) [-890.190] (-890.119) (-896.665) * (-891.326) (-889.918) (-889.843) [-896.955] -- 0:00:57
599000 -- (-893.618) (-887.736) [-890.367] (-899.387) * (-894.015) (-899.442) [-891.149] (-891.479) -- 0:00:56
599500 -- (-897.997) (-892.997) (-890.825) [-896.328] * [-887.559] (-898.417) (-891.219) (-894.764) -- 0:00:56
600000 -- [-897.949] (-892.927) (-889.603) (-893.507) * (-894.019) (-894.308) [-893.522] (-895.613) -- 0:00:56
Average standard deviation of split frequencies: 0.004709
600500 -- (-893.627) [-892.678] (-888.284) (-892.905) * (-893.521) (-892.549) (-893.138) [-888.028] -- 0:00:56
601000 -- (-892.027) (-888.784) [-888.328] (-894.006) * (-894.249) (-895.837) [-889.868] (-891.245) -- 0:00:56
601500 -- (-888.461) [-890.533] (-891.190) (-891.368) * (-892.414) (-899.159) (-892.833) [-893.341] -- 0:00:56
602000 -- (-891.642) (-891.247) [-892.618] (-893.542) * (-895.536) (-899.321) (-894.070) [-888.281] -- 0:00:56
602500 -- [-890.608] (-890.464) (-893.404) (-893.080) * (-894.567) [-895.068] (-903.458) (-892.308) -- 0:00:56
603000 -- [-896.824] (-894.722) (-896.442) (-888.142) * (-890.584) (-900.820) [-891.011] (-890.688) -- 0:00:56
603500 -- (-895.605) (-891.680) [-888.159] (-895.494) * (-894.982) (-895.981) (-892.092) [-892.520] -- 0:00:56
604000 -- (-891.576) (-893.172) (-895.030) [-891.247] * (-890.689) [-893.136] (-892.118) (-894.672) -- 0:00:56
604500 -- (-891.684) [-891.589] (-893.361) (-894.173) * (-890.846) (-896.802) [-891.360] (-894.322) -- 0:00:56
605000 -- (-891.680) (-889.730) (-892.753) [-895.098] * (-890.975) (-894.524) (-892.845) [-890.241] -- 0:00:56
Average standard deviation of split frequencies: 0.003889
605500 -- (-893.004) (-896.454) [-891.360] (-895.295) * (-891.187) (-894.536) [-897.471] (-891.255) -- 0:00:56
606000 -- [-890.909] (-897.817) (-893.602) (-890.169) * [-888.635] (-895.842) (-889.758) (-893.334) -- 0:00:55
606500 -- (-893.671) [-893.126] (-893.722) (-887.740) * (-889.772) (-894.679) [-891.410] (-898.013) -- 0:00:55
607000 -- (-889.637) [-888.603] (-894.596) (-892.624) * (-889.628) (-897.891) (-894.494) [-898.403] -- 0:00:55
607500 -- (-892.490) (-891.237) (-890.357) [-891.730] * (-889.373) (-895.258) [-895.708] (-891.057) -- 0:00:55
608000 -- [-887.430] (-892.079) (-890.990) (-890.657) * (-895.454) (-894.752) [-891.962] (-891.272) -- 0:00:55
608500 -- (-888.202) (-893.909) (-891.810) [-892.589] * [-895.942] (-893.610) (-889.000) (-892.330) -- 0:00:55
609000 -- (-895.223) (-892.784) (-894.515) [-892.788] * (-890.370) [-892.111] (-890.899) (-892.035) -- 0:00:55
609500 -- [-893.599] (-889.407) (-895.763) (-891.303) * (-890.622) [-890.300] (-893.005) (-888.275) -- 0:00:55
610000 -- (-898.517) (-896.475) (-890.887) [-889.446] * (-892.147) (-892.317) (-891.610) [-889.576] -- 0:00:55
Average standard deviation of split frequencies: 0.004632
610500 -- [-895.337] (-889.877) (-890.741) (-890.673) * (-894.720) (-887.756) (-895.500) [-889.390] -- 0:00:55
611000 -- (-891.540) (-898.351) [-893.456] (-895.415) * (-893.837) [-889.116] (-890.273) (-891.282) -- 0:00:55
611500 -- (-891.081) [-890.666] (-889.138) (-894.201) * (-895.403) (-891.000) [-889.158] (-890.206) -- 0:00:55
612000 -- (-888.310) (-890.604) [-895.013] (-892.444) * (-898.399) (-896.527) [-888.526] (-894.279) -- 0:00:55
612500 -- (-891.090) [-892.844] (-899.396) (-893.270) * (-892.027) (-892.042) (-890.507) [-890.330] -- 0:00:55
613000 -- [-892.468] (-891.484) (-893.893) (-897.701) * (-890.165) (-889.325) [-889.558] (-893.619) -- 0:00:54
613500 -- (-896.693) (-887.839) [-889.683] (-891.990) * (-892.582) (-895.996) [-888.716] (-894.393) -- 0:00:54
614000 -- (-898.252) (-894.749) (-894.045) [-889.771] * (-889.037) (-891.131) [-889.328] (-890.933) -- 0:00:54
614500 -- (-895.358) (-894.557) [-889.742] (-892.189) * (-890.456) [-891.801] (-894.771) (-894.432) -- 0:00:54
615000 -- (-891.050) (-898.298) (-889.836) [-889.860] * (-889.705) (-890.179) (-899.474) [-892.152] -- 0:00:54
Average standard deviation of split frequencies: 0.006887
615500 -- [-892.439] (-890.959) (-891.308) (-896.570) * (-889.905) (-888.411) (-894.448) [-887.523] -- 0:00:54
616000 -- (-891.061) [-889.101] (-891.343) (-897.459) * (-894.934) [-889.722] (-889.845) (-891.242) -- 0:00:54
616500 -- (-894.462) (-893.740) [-893.995] (-895.588) * (-892.627) (-891.158) (-892.079) [-892.258] -- 0:00:54
617000 -- (-891.392) (-891.592) [-890.291] (-897.637) * [-894.540] (-888.814) (-894.588) (-893.951) -- 0:00:54
617500 -- (-891.951) (-896.294) [-892.922] (-895.880) * (-890.797) (-887.493) [-892.913] (-889.305) -- 0:00:54
618000 -- (-892.534) (-891.532) [-892.923] (-894.629) * (-891.252) (-891.050) (-892.923) [-889.444] -- 0:00:54
618500 -- [-891.452] (-892.497) (-892.488) (-891.365) * [-894.345] (-893.603) (-898.411) (-892.851) -- 0:00:54
619000 -- (-890.366) (-888.658) [-898.756] (-890.358) * (-894.475) (-889.132) [-895.413] (-892.386) -- 0:00:54
619500 -- (-893.168) (-890.413) (-901.023) [-893.631] * (-891.435) [-891.464] (-898.105) (-890.391) -- 0:00:54
620000 -- (-891.245) [-891.118] (-903.238) (-894.879) * (-886.882) [-893.712] (-890.577) (-895.799) -- 0:00:53
Average standard deviation of split frequencies: 0.006836
620500 -- (-889.836) (-889.451) [-892.932] (-893.871) * (-894.082) (-890.634) (-895.885) [-894.425] -- 0:00:53
621000 -- (-887.347) (-892.129) [-890.871] (-898.012) * (-890.728) (-899.153) (-890.789) [-895.363] -- 0:00:53
621500 -- (-891.431) [-891.593] (-892.004) (-894.289) * [-890.441] (-900.367) (-894.136) (-893.305) -- 0:00:53
622000 -- (-893.974) [-893.970] (-892.009) (-892.737) * (-892.317) [-890.467] (-892.659) (-893.391) -- 0:00:53
622500 -- (-896.204) [-893.964] (-892.396) (-899.661) * [-890.060] (-890.966) (-891.594) (-889.808) -- 0:00:53
623000 -- [-896.979] (-893.982) (-889.730) (-903.520) * [-889.919] (-890.500) (-891.371) (-892.747) -- 0:00:53
623500 -- (-893.146) (-894.753) [-889.740] (-902.188) * (-893.044) (-890.249) (-892.736) [-895.627] -- 0:00:53
624000 -- (-893.578) [-890.395] (-890.285) (-897.476) * [-888.776] (-892.744) (-891.263) (-893.710) -- 0:00:53
624500 -- (-895.545) [-893.964] (-891.340) (-897.646) * (-888.310) (-893.655) [-890.814] (-893.483) -- 0:00:53
625000 -- [-892.096] (-898.254) (-897.571) (-892.818) * (-890.175) (-896.958) [-894.004] (-892.392) -- 0:00:53
Average standard deviation of split frequencies: 0.004518
625500 -- (-888.406) (-891.085) (-891.786) [-892.033] * [-889.148] (-898.066) (-890.988) (-889.478) -- 0:00:53
626000 -- (-888.712) (-894.432) (-888.102) [-890.650] * (-896.702) (-892.842) [-891.007] (-888.220) -- 0:00:53
626500 -- (-894.192) [-890.583] (-899.445) (-891.636) * (-890.235) (-892.976) (-889.346) [-888.717] -- 0:00:53
627000 -- (-893.042) (-894.171) [-890.941] (-893.671) * [-890.051] (-896.222) (-894.819) (-889.152) -- 0:00:52
627500 -- [-889.871] (-891.990) (-896.119) (-896.090) * (-894.299) (-889.510) [-890.408] (-888.956) -- 0:00:52
628000 -- [-896.300] (-893.102) (-894.276) (-894.711) * (-890.146) [-890.392] (-893.379) (-894.459) -- 0:00:52
628500 -- (-893.970) [-890.477] (-891.904) (-904.882) * (-890.630) [-890.357] (-891.418) (-894.546) -- 0:00:52
629000 -- (-892.675) (-892.190) [-892.250] (-898.701) * (-892.062) [-890.779] (-898.742) (-894.877) -- 0:00:52
629500 -- (-895.029) [-893.056] (-892.885) (-896.506) * [-888.576] (-896.459) (-901.305) (-888.698) -- 0:00:52
630000 -- (-889.306) (-892.230) (-897.762) [-891.705] * (-888.937) (-890.106) [-895.004] (-894.675) -- 0:00:52
Average standard deviation of split frequencies: 0.004485
630500 -- (-888.851) (-894.898) (-891.011) [-891.846] * (-894.006) (-896.345) [-894.595] (-887.149) -- 0:00:52
631000 -- (-890.884) [-889.965] (-890.548) (-892.011) * (-895.314) (-895.655) (-890.087) [-889.679] -- 0:00:52
631500 -- (-888.492) (-890.187) [-890.340] (-891.753) * (-894.735) (-892.869) (-891.454) [-886.768] -- 0:00:52
632000 -- (-890.652) (-887.170) (-891.991) [-892.382] * [-890.566] (-891.558) (-894.126) (-896.624) -- 0:00:52
632500 -- (-894.855) (-892.210) (-892.545) [-892.796] * (-891.267) [-890.360] (-892.211) (-892.809) -- 0:00:52
633000 -- [-890.225] (-889.922) (-888.922) (-899.982) * (-890.912) (-890.309) [-892.464] (-896.035) -- 0:00:52
633500 -- (-890.329) (-891.493) [-899.754] (-892.828) * (-891.046) (-891.907) [-888.887] (-888.777) -- 0:00:52
634000 -- (-889.753) [-893.350] (-891.336) (-893.446) * [-891.568] (-893.615) (-894.068) (-895.352) -- 0:00:51
634500 -- (-889.738) (-891.449) [-890.343] (-895.090) * (-895.863) (-891.455) [-890.837] (-891.936) -- 0:00:51
635000 -- (-891.387) (-896.906) [-890.557] (-896.808) * (-893.814) (-890.059) (-891.751) [-890.825] -- 0:00:51
Average standard deviation of split frequencies: 0.003706
635500 -- [-896.054] (-895.671) (-898.846) (-896.961) * (-895.638) [-890.633] (-892.266) (-888.087) -- 0:00:51
636000 -- (-891.508) (-894.369) (-893.600) [-891.863] * (-890.179) (-891.128) [-890.994] (-893.727) -- 0:00:51
636500 -- (-894.709) (-888.864) (-900.409) [-893.812] * (-890.359) (-895.950) (-892.877) [-893.524] -- 0:00:51
637000 -- (-891.504) (-894.330) (-897.156) [-889.395] * (-889.982) (-894.044) [-889.063] (-891.136) -- 0:00:51
637500 -- [-889.926] (-890.051) (-893.651) (-892.764) * (-894.444) (-891.902) (-893.480) [-899.110] -- 0:00:51
638000 -- (-888.772) (-890.159) (-893.811) [-889.194] * (-894.024) [-891.302] (-893.096) (-889.789) -- 0:00:51
638500 -- (-893.358) (-892.384) [-890.381] (-894.127) * [-891.222] (-892.444) (-895.131) (-886.383) -- 0:00:51
639000 -- [-895.739] (-891.922) (-893.726) (-893.532) * (-889.156) [-894.917] (-894.713) (-891.080) -- 0:00:51
639500 -- (-891.549) (-893.480) (-893.222) [-889.918] * [-894.167] (-891.430) (-890.768) (-887.828) -- 0:00:51
640000 -- [-892.610] (-888.014) (-898.273) (-893.814) * (-890.674) (-893.274) [-891.726] (-892.971) -- 0:00:51
Average standard deviation of split frequencies: 0.003679
640500 -- (-891.204) (-890.219) (-895.149) [-895.813] * (-892.267) (-898.774) [-889.088] (-896.073) -- 0:00:51
641000 -- [-888.936] (-890.910) (-890.503) (-893.103) * [-894.130] (-890.549) (-895.989) (-894.786) -- 0:00:50
641500 -- [-892.397] (-895.342) (-896.486) (-890.070) * [-888.081] (-891.095) (-893.337) (-892.163) -- 0:00:50
642000 -- (-893.863) (-890.820) (-898.792) [-891.127] * (-896.052) (-895.447) [-887.945] (-889.855) -- 0:00:50
642500 -- (-892.086) (-891.178) [-892.400] (-893.939) * (-888.226) (-894.706) [-889.577] (-890.075) -- 0:00:50
643000 -- (-895.552) (-891.098) [-892.907] (-893.014) * [-890.509] (-899.037) (-894.788) (-890.690) -- 0:00:50
643500 -- (-892.102) (-889.983) (-894.737) [-902.571] * (-890.733) (-893.250) (-891.585) [-894.691] -- 0:00:50
644000 -- [-891.291] (-895.203) (-889.965) (-901.153) * (-887.610) (-899.734) [-892.624] (-889.811) -- 0:00:50
644500 -- (-890.348) (-901.389) [-893.294] (-894.921) * (-895.569) (-893.140) [-890.755] (-893.775) -- 0:00:50
645000 -- [-892.793] (-897.854) (-896.081) (-892.615) * [-890.247] (-900.420) (-887.883) (-891.487) -- 0:00:50
Average standard deviation of split frequencies: 0.005108
645500 -- (-892.450) (-890.356) [-896.034] (-896.486) * (-888.148) (-894.653) [-891.693] (-887.684) -- 0:00:50
646000 -- (-891.364) (-889.604) (-889.303) [-894.716] * (-890.207) [-890.342] (-894.594) (-888.975) -- 0:00:50
646500 -- (-892.780) [-888.829] (-888.719) (-894.987) * (-888.093) (-893.347) (-889.812) [-891.611] -- 0:00:50
647000 -- (-891.352) [-889.636] (-890.544) (-894.852) * (-891.116) (-891.036) (-889.146) [-895.820] -- 0:00:50
647500 -- [-893.532] (-890.157) (-897.439) (-900.173) * [-891.868] (-893.504) (-895.533) (-893.802) -- 0:00:50
648000 -- (-891.634) (-889.268) (-892.801) [-893.093] * (-891.184) [-893.284] (-894.559) (-893.416) -- 0:00:49
648500 -- (-899.817) (-896.261) [-894.576] (-896.404) * (-887.770) (-890.550) (-898.753) [-891.040] -- 0:00:49
649000 -- (-891.670) (-892.712) (-893.399) [-892.013] * (-898.138) [-894.333] (-894.727) (-892.722) -- 0:00:49
649500 -- (-891.344) (-893.023) [-891.035] (-892.055) * (-893.010) (-893.697) [-892.101] (-890.074) -- 0:00:49
650000 -- [-892.527] (-889.464) (-889.931) (-889.899) * (-896.319) [-889.316] (-893.667) (-891.787) -- 0:00:49
Average standard deviation of split frequencies: 0.005796
650500 -- (-898.390) (-887.769) (-892.561) [-891.560] * (-891.988) [-890.687] (-891.932) (-890.528) -- 0:00:49
651000 -- (-894.420) [-891.073] (-896.685) (-896.231) * (-895.227) [-888.218] (-894.255) (-894.330) -- 0:00:49
651500 -- (-890.425) (-892.762) (-895.691) [-891.343] * (-894.085) [-893.559] (-895.600) (-891.530) -- 0:00:49
652000 -- (-897.575) [-897.507] (-895.349) (-892.407) * (-891.611) [-888.555] (-892.703) (-891.064) -- 0:00:49
652500 -- (-900.856) [-888.641] (-893.710) (-889.610) * (-890.079) [-889.141] (-893.369) (-896.021) -- 0:00:49
653000 -- (-893.645) (-888.427) (-892.438) [-891.149] * (-888.829) (-891.041) (-890.076) [-890.912] -- 0:00:49
653500 -- (-891.933) [-889.532] (-891.479) (-894.091) * (-887.304) (-893.090) (-902.009) [-890.973] -- 0:00:49
654000 -- (-894.200) (-895.039) (-891.515) [-889.651] * (-893.155) (-887.035) (-888.087) [-893.461] -- 0:00:49
654500 -- (-892.959) [-893.071] (-892.077) (-889.998) * (-891.958) [-889.438] (-889.014) (-893.012) -- 0:00:49
655000 -- [-891.367] (-895.828) (-896.787) (-889.263) * [-892.750] (-896.087) (-890.452) (-890.687) -- 0:00:48
Average standard deviation of split frequencies: 0.005749
655500 -- [-889.494] (-893.459) (-892.561) (-890.813) * [-888.848] (-899.985) (-890.924) (-891.066) -- 0:00:48
656000 -- (-890.407) (-889.476) (-893.230) [-893.472] * (-900.471) (-893.804) (-895.016) [-893.154] -- 0:00:48
656500 -- [-891.569] (-893.361) (-889.373) (-891.354) * (-895.640) (-893.966) [-890.787] (-889.857) -- 0:00:48
657000 -- (-892.646) (-892.749) [-890.199] (-891.040) * [-891.391] (-897.960) (-897.862) (-895.046) -- 0:00:48
657500 -- (-898.333) (-892.475) (-894.557) [-892.034] * (-887.711) (-895.376) (-894.900) [-896.258] -- 0:00:48
658000 -- (-894.727) (-894.845) (-893.331) [-891.131] * (-895.366) (-893.795) (-893.220) [-889.675] -- 0:00:48
658500 -- [-897.270] (-891.657) (-891.135) (-896.277) * (-894.718) [-892.465] (-889.591) (-890.611) -- 0:00:48
659000 -- (-890.982) (-888.508) (-900.990) [-895.861] * [-892.021] (-895.648) (-891.534) (-891.690) -- 0:00:48
659500 -- [-891.630] (-893.207) (-887.857) (-905.311) * (-894.463) (-896.769) (-890.659) [-891.939] -- 0:00:48
660000 -- [-892.375] (-893.323) (-890.009) (-894.709) * (-895.329) (-894.329) [-895.399] (-888.843) -- 0:00:48
Average standard deviation of split frequencies: 0.005708
660500 -- (-889.668) [-898.916] (-889.566) (-892.151) * (-893.120) [-893.951] (-888.587) (-890.822) -- 0:00:48
661000 -- (-895.036) [-893.420] (-895.958) (-894.972) * (-893.054) [-891.810] (-893.393) (-888.943) -- 0:00:48
661500 -- (-890.930) (-892.900) (-893.208) [-890.410] * (-900.673) (-889.974) [-893.744] (-892.922) -- 0:00:48
662000 -- (-888.132) (-891.380) [-889.973] (-889.383) * (-892.229) [-896.920] (-892.454) (-889.030) -- 0:00:47
662500 -- [-892.429] (-892.412) (-895.788) (-893.210) * [-893.641] (-893.814) (-890.522) (-895.397) -- 0:00:47
663000 -- (-890.000) (-891.336) (-893.830) [-892.104] * [-893.661] (-894.567) (-888.788) (-893.032) -- 0:00:47
663500 -- (-894.865) (-893.799) (-891.841) [-890.145] * (-895.199) (-891.674) (-894.567) [-895.130] -- 0:00:47
664000 -- [-892.819] (-889.240) (-891.404) (-892.214) * (-894.352) (-891.044) (-894.560) [-893.584] -- 0:00:48
664500 -- (-893.212) (-893.340) (-895.372) [-891.699] * (-892.162) [-890.805] (-892.210) (-889.768) -- 0:00:47
665000 -- [-887.373] (-892.430) (-894.504) (-890.967) * [-897.045] (-892.283) (-892.299) (-897.512) -- 0:00:47
Average standard deviation of split frequencies: 0.006370
665500 -- (-889.498) (-895.087) [-891.731] (-893.275) * (-895.339) (-894.135) [-892.387] (-893.640) -- 0:00:47
666000 -- (-893.752) (-889.254) [-891.833] (-892.426) * (-889.317) (-898.080) (-889.566) [-894.358] -- 0:00:47
666500 -- (-892.291) (-893.727) [-890.365] (-891.149) * [-890.334] (-891.576) (-894.774) (-888.668) -- 0:00:47
667000 -- [-888.596] (-892.606) (-891.656) (-893.091) * (-896.193) [-887.464] (-891.072) (-890.606) -- 0:00:47
667500 -- (-891.967) (-896.290) (-889.961) [-889.144] * (-894.465) [-894.753] (-889.851) (-895.304) -- 0:00:47
668000 -- (-895.061) (-891.331) (-891.456) [-888.794] * (-889.220) (-898.727) [-888.514] (-899.423) -- 0:00:47
668500 -- (-892.449) (-889.230) [-890.311] (-892.229) * [-893.173] (-892.562) (-892.743) (-890.559) -- 0:00:47
669000 -- (-895.340) [-890.144] (-896.725) (-890.117) * (-893.448) (-890.787) (-890.395) [-896.449] -- 0:00:47
669500 -- (-893.975) [-888.956] (-896.151) (-889.314) * (-895.462) (-889.252) (-890.097) [-891.426] -- 0:00:46
670000 -- (-890.702) [-891.951] (-889.426) (-889.423) * [-892.567] (-894.354) (-888.830) (-894.982) -- 0:00:46
Average standard deviation of split frequencies: 0.005623
670500 -- (-890.131) (-892.980) (-894.309) [-892.340] * (-890.140) [-895.182] (-894.403) (-897.860) -- 0:00:46
671000 -- (-893.362) (-889.644) (-890.356) [-888.587] * [-890.604] (-890.671) (-897.139) (-894.213) -- 0:00:47
671500 -- (-894.657) (-889.564) [-889.111] (-894.763) * (-893.531) (-893.397) [-893.847] (-891.447) -- 0:00:46
672000 -- (-892.488) (-892.123) [-889.135] (-890.782) * [-893.761] (-890.930) (-889.533) (-892.734) -- 0:00:46
672500 -- (-888.469) (-892.602) [-897.535] (-890.754) * [-890.113] (-891.502) (-900.104) (-893.374) -- 0:00:46
673000 -- (-893.381) (-890.157) [-890.366] (-888.769) * [-892.131] (-890.138) (-892.706) (-891.086) -- 0:00:46
673500 -- (-893.546) [-894.200] (-894.223) (-888.096) * [-887.410] (-886.928) (-894.400) (-893.351) -- 0:00:46
674000 -- [-889.687] (-888.079) (-897.458) (-893.555) * (-888.297) (-895.464) (-896.653) [-889.468] -- 0:00:46
674500 -- (-893.278) (-892.232) (-890.091) [-890.138] * (-889.322) [-894.331] (-891.181) (-895.203) -- 0:00:46
675000 -- (-892.624) [-888.268] (-895.265) (-894.802) * (-891.391) (-891.119) [-890.017] (-892.905) -- 0:00:46
Average standard deviation of split frequencies: 0.004881
675500 -- (-892.577) (-890.046) (-893.372) [-895.953] * [-893.455] (-894.193) (-898.752) (-889.952) -- 0:00:46
676000 -- (-891.424) (-895.599) [-889.025] (-896.430) * (-889.903) [-887.077] (-897.291) (-895.242) -- 0:00:46
676500 -- (-896.271) [-890.976] (-889.435) (-894.069) * (-890.975) [-888.513] (-891.242) (-895.271) -- 0:00:45
677000 -- [-891.129] (-891.012) (-890.323) (-903.669) * (-890.942) [-893.894] (-892.547) (-895.261) -- 0:00:45
677500 -- [-895.350] (-892.807) (-893.026) (-890.520) * (-896.079) [-892.849] (-890.559) (-896.812) -- 0:00:45
678000 -- (-890.397) [-891.083] (-894.461) (-890.672) * (-895.843) (-894.093) (-888.054) [-889.073] -- 0:00:46
678500 -- (-893.357) (-892.490) (-893.675) [-889.474] * (-889.920) [-892.710] (-891.594) (-891.079) -- 0:00:45
679000 -- [-890.306] (-895.025) (-889.502) (-892.585) * (-891.688) (-891.813) (-892.612) [-889.928] -- 0:00:45
679500 -- [-889.346] (-893.802) (-891.684) (-887.977) * [-890.443] (-897.229) (-895.804) (-894.404) -- 0:00:45
680000 -- [-889.177] (-893.131) (-889.820) (-891.604) * (-895.159) [-890.928] (-891.602) (-895.122) -- 0:00:45
Average standard deviation of split frequencies: 0.004848
680500 -- (-893.413) (-892.040) [-893.004] (-892.660) * [-889.896] (-890.766) (-891.619) (-894.844) -- 0:00:45
681000 -- (-893.940) (-893.423) [-889.515] (-891.938) * (-894.052) [-889.885] (-894.662) (-891.620) -- 0:00:45
681500 -- (-895.968) (-890.704) (-889.490) [-890.279] * [-891.611] (-892.795) (-895.689) (-891.262) -- 0:00:45
682000 -- (-896.651) [-888.953] (-892.959) (-894.075) * [-891.479] (-891.368) (-895.398) (-892.364) -- 0:00:45
682500 -- (-895.862) (-892.700) [-891.914] (-892.806) * [-891.693] (-896.442) (-891.503) (-898.587) -- 0:00:45
683000 -- (-887.603) [-887.751] (-894.391) (-893.227) * (-888.866) (-891.902) (-893.863) [-902.787] -- 0:00:45
683500 -- (-892.017) (-889.771) (-893.189) [-889.331] * (-888.663) [-891.503] (-889.283) (-893.762) -- 0:00:44
684000 -- (-893.974) (-894.879) (-895.341) [-891.060] * (-891.495) (-888.927) [-889.992] (-894.487) -- 0:00:44
684500 -- (-891.748) [-892.391] (-893.085) (-892.917) * (-896.057) (-892.765) (-892.560) [-892.803] -- 0:00:44
685000 -- [-893.475] (-895.246) (-889.318) (-890.685) * (-901.734) (-890.080) [-887.885] (-889.420) -- 0:00:45
Average standard deviation of split frequencies: 0.004810
685500 -- [-889.163] (-894.921) (-889.691) (-896.932) * (-898.556) [-894.139] (-889.663) (-898.283) -- 0:00:44
686000 -- (-888.493) (-890.806) [-889.867] (-894.841) * (-899.404) [-894.728] (-890.328) (-894.908) -- 0:00:44
686500 -- (-894.312) [-894.733] (-891.579) (-893.396) * (-893.630) (-892.357) (-889.841) [-894.706] -- 0:00:44
687000 -- (-891.293) [-893.981] (-890.489) (-891.859) * (-891.081) (-888.564) (-891.343) [-896.303] -- 0:00:44
687500 -- (-892.227) (-890.497) [-889.933] (-901.749) * (-891.349) [-887.760] (-889.954) (-894.716) -- 0:00:44
688000 -- [-894.360] (-892.447) (-895.469) (-896.893) * (-890.695) (-891.382) (-888.809) [-894.006] -- 0:00:44
688500 -- (-889.134) [-888.379] (-891.284) (-896.990) * (-893.212) (-888.295) (-890.964) [-889.408] -- 0:00:44
689000 -- (-890.512) (-901.234) [-895.729] (-894.997) * (-897.182) [-894.024] (-892.569) (-896.295) -- 0:00:44
689500 -- [-894.363] (-896.766) (-888.105) (-890.072) * (-891.760) [-888.008] (-888.795) (-894.465) -- 0:00:44
690000 -- (-894.065) (-897.201) [-889.462] (-892.924) * [-890.582] (-889.441) (-891.181) (-890.713) -- 0:00:44
Average standard deviation of split frequencies: 0.006143
690500 -- (-890.413) (-896.126) (-897.255) [-887.194] * (-892.204) (-890.975) [-897.588] (-891.760) -- 0:00:43
691000 -- (-887.433) (-891.456) [-899.187] (-891.288) * (-891.420) [-889.758] (-891.930) (-890.499) -- 0:00:43
691500 -- [-888.162] (-894.791) (-894.131) (-894.535) * (-887.655) (-888.726) [-888.725] (-891.439) -- 0:00:43
692000 -- (-890.309) [-891.878] (-893.042) (-892.415) * (-890.274) (-890.343) (-888.444) [-889.177] -- 0:00:44
692500 -- [-893.360] (-892.676) (-891.157) (-893.056) * (-891.659) (-891.670) (-893.853) [-893.327] -- 0:00:43
693000 -- (-896.695) (-888.192) [-890.998] (-892.159) * (-895.786) (-895.274) [-892.468] (-896.076) -- 0:00:43
693500 -- [-894.418] (-894.344) (-893.439) (-894.160) * (-895.729) [-894.920] (-892.373) (-893.177) -- 0:00:43
694000 -- (-895.141) (-890.630) [-888.834] (-897.843) * (-891.172) (-897.210) [-888.815] (-889.708) -- 0:00:43
694500 -- (-892.035) (-888.573) [-893.503] (-890.268) * [-890.870] (-896.479) (-893.146) (-891.786) -- 0:00:43
695000 -- (-890.657) (-891.286) [-893.741] (-894.488) * [-890.756] (-894.999) (-890.697) (-886.556) -- 0:00:43
Average standard deviation of split frequencies: 0.005418
695500 -- (-893.572) (-894.518) [-892.395] (-890.651) * (-897.727) (-893.214) (-895.684) [-890.371] -- 0:00:43
696000 -- (-890.699) (-894.176) [-888.904] (-892.079) * (-891.769) [-891.282] (-892.389) (-889.693) -- 0:00:43
696500 -- (-893.216) [-893.910] (-891.687) (-890.992) * (-892.661) (-892.455) (-888.407) [-892.558] -- 0:00:43
697000 -- [-890.301] (-889.743) (-901.830) (-894.569) * (-896.150) (-893.475) [-889.716] (-892.346) -- 0:00:43
697500 -- (-893.493) [-896.140] (-896.220) (-893.516) * [-892.683] (-889.689) (-892.428) (-890.496) -- 0:00:42
698000 -- [-893.082] (-893.011) (-893.638) (-894.860) * (-889.279) [-896.801] (-892.619) (-890.744) -- 0:00:42
698500 -- (-897.328) (-892.533) [-890.153] (-895.673) * (-892.015) (-895.158) [-894.093] (-887.847) -- 0:00:43
699000 -- (-893.097) (-892.153) [-892.745] (-892.848) * (-890.813) (-890.513) (-894.218) [-891.446] -- 0:00:43
699500 -- [-891.508] (-890.889) (-890.671) (-897.455) * (-890.415) (-894.315) (-890.256) [-890.073] -- 0:00:42
700000 -- (-892.132) [-893.331] (-889.151) (-897.510) * (-894.614) (-898.113) (-888.661) [-898.317] -- 0:00:42
Average standard deviation of split frequencies: 0.003364
700500 -- (-894.047) [-891.802] (-900.134) (-894.800) * (-898.937) (-899.353) [-889.953] (-893.493) -- 0:00:42
701000 -- (-892.802) [-893.474] (-892.235) (-895.835) * (-891.862) (-890.182) [-891.339] (-891.944) -- 0:00:42
701500 -- [-887.567] (-894.397) (-889.524) (-898.499) * [-888.844] (-896.616) (-890.753) (-900.349) -- 0:00:42
702000 -- (-892.320) (-894.028) (-894.815) [-893.962] * (-894.892) (-893.276) (-892.383) [-892.378] -- 0:00:42
702500 -- [-888.952] (-895.390) (-890.567) (-894.040) * (-894.057) (-898.393) (-896.510) [-891.740] -- 0:00:42
703000 -- (-896.929) [-889.460] (-889.963) (-892.920) * (-894.107) [-887.595] (-893.658) (-890.925) -- 0:00:42
703500 -- (-896.408) (-894.783) (-893.816) [-895.772] * [-891.628] (-892.469) (-893.315) (-891.184) -- 0:00:42
704000 -- (-893.371) [-888.521] (-891.249) (-897.900) * (-893.471) (-894.819) (-890.489) [-888.730] -- 0:00:42
704500 -- [-892.394] (-893.478) (-890.533) (-896.980) * [-890.153] (-893.165) (-890.841) (-889.881) -- 0:00:41
705000 -- (-889.864) [-893.175] (-889.541) (-891.589) * [-890.077] (-893.273) (-890.140) (-894.628) -- 0:00:41
Average standard deviation of split frequencies: 0.003339
705500 -- (-889.328) [-889.917] (-889.776) (-890.633) * [-891.681] (-892.762) (-887.724) (-891.172) -- 0:00:42
706000 -- [-889.994] (-893.115) (-891.911) (-892.444) * (-895.884) (-895.284) [-894.267] (-899.134) -- 0:00:42
706500 -- (-896.937) (-891.456) [-889.516] (-891.575) * (-896.624) (-891.933) (-891.842) [-891.433] -- 0:00:41
707000 -- (-888.785) (-893.266) (-891.544) [-889.233] * (-891.798) (-887.728) (-891.029) [-893.167] -- 0:00:41
707500 -- [-893.174] (-891.726) (-894.418) (-889.591) * [-892.782] (-892.965) (-895.864) (-890.058) -- 0:00:41
708000 -- (-887.992) (-892.133) [-891.318] (-894.424) * [-890.217] (-893.309) (-891.313) (-891.583) -- 0:00:41
708500 -- (-897.592) [-890.794] (-891.650) (-892.351) * (-894.509) (-887.114) (-892.240) [-890.660] -- 0:00:41
709000 -- (-891.669) [-888.283] (-895.951) (-890.538) * (-892.326) (-887.712) (-894.753) [-890.246] -- 0:00:41
709500 -- (-891.728) (-897.165) [-891.686] (-898.300) * (-895.319) (-888.192) [-892.825] (-890.837) -- 0:00:41
710000 -- (-890.425) (-890.582) [-894.929] (-892.944) * [-893.039] (-889.302) (-889.934) (-886.706) -- 0:00:41
Average standard deviation of split frequencies: 0.002653
710500 -- [-890.183] (-894.483) (-891.317) (-893.565) * [-891.955] (-888.392) (-890.361) (-890.738) -- 0:00:41
711000 -- (-890.908) (-895.651) [-894.238] (-900.559) * (-904.782) (-890.939) [-890.338] (-897.469) -- 0:00:41
711500 -- [-894.642] (-888.148) (-891.480) (-896.851) * (-896.464) (-892.114) (-891.091) [-891.490] -- 0:00:40
712000 -- [-890.463] (-897.752) (-895.269) (-893.688) * (-889.523) [-892.748] (-888.587) (-895.993) -- 0:00:40
712500 -- (-898.197) (-897.689) [-894.216] (-891.499) * (-892.457) (-894.635) [-892.159] (-890.583) -- 0:00:41
713000 -- (-896.183) [-891.254] (-895.057) (-891.021) * (-894.219) (-894.405) [-887.632] (-896.198) -- 0:00:41
713500 -- [-892.279] (-893.369) (-900.873) (-888.378) * (-890.357) (-893.386) (-893.080) [-892.177] -- 0:00:40
714000 -- (-900.743) (-891.921) (-897.576) [-892.682] * [-890.632] (-895.475) (-895.251) (-893.589) -- 0:00:40
714500 -- (-889.102) [-888.525] (-893.085) (-893.262) * [-895.581] (-896.257) (-892.920) (-894.916) -- 0:00:40
715000 -- (-892.153) (-890.257) [-891.344] (-891.306) * (-896.690) (-897.204) [-893.841] (-889.569) -- 0:00:40
Average standard deviation of split frequencies: 0.001975
715500 -- (-897.864) [-893.947] (-888.837) (-890.267) * (-891.054) (-893.179) (-893.603) [-889.259] -- 0:00:40
716000 -- (-892.003) (-893.685) [-889.265] (-889.312) * [-892.083] (-894.982) (-893.895) (-890.930) -- 0:00:40
716500 -- (-896.387) (-889.474) [-890.036] (-892.245) * [-889.355] (-895.595) (-894.027) (-890.407) -- 0:00:40
717000 -- (-890.386) [-890.164] (-890.575) (-892.739) * (-889.530) (-889.472) [-892.401] (-891.953) -- 0:00:40
717500 -- (-888.385) (-890.996) (-889.389) [-889.163] * (-895.440) (-890.080) (-893.083) [-890.815] -- 0:00:40
718000 -- (-890.193) (-891.214) (-889.782) [-898.355] * (-891.854) [-891.134] (-891.660) (-898.021) -- 0:00:40
718500 -- (-893.710) (-893.596) (-891.849) [-894.026] * (-890.488) (-896.431) [-888.402] (-894.380) -- 0:00:39
719000 -- (-893.603) (-897.253) (-894.337) [-892.982] * (-891.129) [-886.989] (-894.766) (-896.450) -- 0:00:39
719500 -- [-891.361] (-893.043) (-891.341) (-893.744) * (-890.920) (-891.417) [-891.366] (-893.942) -- 0:00:40
720000 -- [-890.403] (-895.243) (-892.573) (-894.563) * (-892.522) (-893.562) [-890.647] (-894.726) -- 0:00:40
Average standard deviation of split frequencies: 0.001962
720500 -- (-891.813) (-896.537) (-893.210) [-890.410] * [-892.621] (-893.545) (-891.622) (-895.898) -- 0:00:39
721000 -- [-893.538] (-891.211) (-898.409) (-893.134) * (-892.549) [-891.009] (-895.317) (-901.331) -- 0:00:39
721500 -- (-891.882) (-890.716) [-892.065] (-889.922) * (-893.546) (-895.500) (-893.677) [-890.373] -- 0:00:39
722000 -- (-895.413) (-893.726) [-891.089] (-889.983) * (-891.035) [-894.037] (-890.921) (-889.415) -- 0:00:39
722500 -- (-889.336) [-892.205] (-898.473) (-894.892) * (-892.126) [-889.734] (-889.570) (-890.158) -- 0:00:39
723000 -- (-899.544) [-889.358] (-891.511) (-890.368) * (-888.284) [-892.330] (-896.101) (-890.418) -- 0:00:39
723500 -- (-895.446) [-890.884] (-891.342) (-894.271) * (-889.701) (-893.880) (-894.313) [-892.398] -- 0:00:39
724000 -- (-888.255) (-889.268) [-892.766] (-890.108) * [-888.120] (-891.274) (-891.641) (-892.197) -- 0:00:39
724500 -- (-888.433) [-890.732] (-895.424) (-891.926) * (-891.185) [-890.044] (-899.131) (-897.388) -- 0:00:39
725000 -- (-894.092) (-895.987) [-892.044] (-893.529) * (-891.491) (-890.563) (-895.957) [-890.019] -- 0:00:39
Average standard deviation of split frequencies: 0.001948
725500 -- [-893.914] (-894.964) (-897.557) (-889.552) * (-889.623) (-890.817) [-895.511] (-896.697) -- 0:00:38
726000 -- [-892.173] (-890.821) (-892.855) (-891.639) * (-889.156) (-889.019) [-890.014] (-889.305) -- 0:00:38
726500 -- (-891.685) [-889.417] (-887.124) (-892.538) * (-889.003) (-895.689) [-893.401] (-889.879) -- 0:00:39
727000 -- [-890.618] (-890.576) (-889.897) (-890.393) * [-891.483] (-892.937) (-892.216) (-889.823) -- 0:00:39
727500 -- [-891.420] (-889.677) (-888.085) (-891.395) * (-889.217) (-893.355) (-892.072) [-890.021] -- 0:00:38
728000 -- [-896.417] (-889.877) (-890.481) (-891.174) * (-890.947) (-890.757) (-899.226) [-889.029] -- 0:00:38
728500 -- (-889.473) [-889.513] (-890.999) (-897.396) * (-893.031) (-889.951) [-890.117] (-889.859) -- 0:00:38
729000 -- (-892.300) (-891.276) [-892.769] (-888.715) * (-894.861) (-889.521) [-887.983] (-893.937) -- 0:00:38
729500 -- (-889.894) [-891.931] (-893.594) (-896.852) * (-889.127) (-891.556) [-891.732] (-889.689) -- 0:00:38
730000 -- (-893.307) (-892.075) [-890.204] (-898.724) * (-889.992) (-897.127) [-896.410] (-894.320) -- 0:00:38
Average standard deviation of split frequencies: 0.002581
730500 -- (-892.845) [-891.071] (-895.151) (-895.224) * [-891.470] (-894.092) (-890.674) (-889.447) -- 0:00:38
731000 -- (-895.450) [-891.823] (-893.149) (-896.583) * (-899.012) [-894.437] (-893.394) (-891.156) -- 0:00:38
731500 -- (-892.102) (-895.184) [-888.043] (-902.432) * (-893.255) (-899.062) (-892.758) [-891.433] -- 0:00:38
732000 -- (-892.084) [-889.830] (-888.685) (-896.428) * (-897.945) (-896.402) (-894.170) [-888.366] -- 0:00:38
732500 -- [-890.190] (-892.510) (-896.366) (-890.567) * [-888.603] (-889.185) (-890.558) (-892.962) -- 0:00:37
733000 -- (-895.109) (-893.256) (-889.018) [-888.661] * (-896.086) (-896.389) [-891.536] (-892.106) -- 0:00:38
733500 -- (-890.607) (-892.925) (-887.945) [-887.528] * (-891.355) (-893.986) (-891.975) [-888.770] -- 0:00:38
734000 -- (-891.741) [-897.366] (-897.760) (-892.662) * (-892.523) (-889.192) (-891.282) [-887.233] -- 0:00:38
734500 -- (-893.747) (-894.517) (-895.122) [-889.904] * (-892.313) (-890.411) [-888.562] (-890.557) -- 0:00:37
735000 -- [-889.643] (-892.580) (-899.754) (-890.957) * (-888.690) (-892.046) (-889.944) [-892.745] -- 0:00:37
Average standard deviation of split frequencies: 0.002562
735500 -- (-894.142) [-892.405] (-897.302) (-893.063) * (-893.251) (-893.097) (-888.761) [-890.639] -- 0:00:37
736000 -- (-890.226) (-893.239) (-896.107) [-893.581] * (-892.612) [-889.573] (-892.890) (-897.502) -- 0:00:37
736500 -- (-889.015) [-890.281] (-898.034) (-892.916) * (-892.828) (-894.159) [-889.696] (-888.811) -- 0:00:37
737000 -- (-889.941) [-900.539] (-895.244) (-895.064) * (-888.026) [-888.935] (-890.332) (-890.138) -- 0:00:37
737500 -- (-890.530) (-891.762) (-895.786) [-890.361] * (-891.733) [-890.986] (-888.767) (-887.680) -- 0:00:37
738000 -- (-895.594) (-890.111) [-891.052] (-895.377) * (-893.993) (-889.212) [-889.088] (-891.506) -- 0:00:37
738500 -- (-892.666) [-888.410] (-890.934) (-892.986) * (-889.776) [-895.893] (-889.970) (-895.003) -- 0:00:37
739000 -- (-892.999) (-897.405) (-892.953) [-890.958] * (-889.604) (-893.367) (-893.545) [-891.788] -- 0:00:37
739500 -- (-898.015) (-892.336) (-896.251) [-890.713] * [-890.855] (-893.851) (-895.266) (-889.956) -- 0:00:36
740000 -- (-896.976) [-890.020] (-890.965) (-888.808) * (-889.544) (-891.214) [-890.855] (-897.251) -- 0:00:37
Average standard deviation of split frequencies: 0.003819
740500 -- [-888.323] (-891.929) (-890.868) (-895.849) * (-896.509) (-892.988) [-889.577] (-895.907) -- 0:00:37
741000 -- [-888.236] (-890.235) (-893.939) (-894.501) * [-890.660] (-897.410) (-892.390) (-890.947) -- 0:00:37
741500 -- (-894.126) (-893.478) (-893.638) [-893.853] * (-888.593) (-894.642) [-890.261] (-888.515) -- 0:00:36
742000 -- (-895.025) (-895.912) (-893.093) [-889.398] * (-890.969) [-894.501] (-891.444) (-890.444) -- 0:00:36
742500 -- (-892.719) [-892.098] (-888.437) (-892.399) * (-891.256) (-891.556) (-892.932) [-890.926] -- 0:00:36
743000 -- (-898.665) (-892.808) [-890.006] (-892.955) * (-895.254) (-896.923) [-895.123] (-890.764) -- 0:00:36
743500 -- (-895.235) [-895.104] (-892.059) (-895.341) * (-890.933) (-897.846) [-887.300] (-894.172) -- 0:00:36
744000 -- (-896.341) (-890.883) [-890.697] (-893.349) * (-891.799) [-894.195] (-893.715) (-894.631) -- 0:00:36
744500 -- [-892.721] (-889.345) (-897.267) (-895.309) * (-890.155) (-888.463) [-893.982] (-892.698) -- 0:00:36
745000 -- (-899.176) [-891.938] (-892.799) (-905.223) * (-892.213) [-887.942] (-893.893) (-892.051) -- 0:00:36
Average standard deviation of split frequencies: 0.003791
745500 -- (-889.102) (-894.588) (-893.422) [-896.874] * (-892.883) (-890.712) (-897.301) [-889.698] -- 0:00:36
746000 -- [-893.551] (-892.143) (-893.196) (-891.474) * (-893.253) (-890.335) [-895.018] (-892.887) -- 0:00:36
746500 -- (-889.754) [-897.098] (-890.411) (-888.066) * (-892.980) (-898.888) [-888.927] (-896.634) -- 0:00:35
747000 -- [-891.389] (-891.363) (-889.079) (-891.916) * [-893.761] (-892.968) (-887.837) (-892.864) -- 0:00:36
747500 -- [-896.188] (-895.714) (-890.451) (-898.042) * (-892.191) (-899.148) (-890.801) [-889.335] -- 0:00:36
748000 -- [-897.431] (-892.797) (-892.615) (-901.070) * (-889.190) (-896.220) [-890.542] (-892.794) -- 0:00:36
748500 -- [-891.192] (-895.560) (-891.683) (-890.066) * (-892.220) [-896.733] (-891.472) (-887.756) -- 0:00:35
749000 -- (-892.085) (-895.360) [-888.128] (-892.945) * (-890.217) (-891.150) [-893.778] (-890.281) -- 0:00:35
749500 -- (-893.818) [-896.887] (-887.232) (-890.334) * (-888.396) [-888.909] (-890.179) (-886.767) -- 0:00:35
750000 -- [-888.420] (-890.553) (-893.015) (-891.039) * (-890.801) [-894.443] (-890.112) (-888.578) -- 0:00:35
Average standard deviation of split frequencies: 0.003140
750500 -- (-895.384) (-893.454) [-893.488] (-894.947) * (-887.580) (-898.137) [-896.235] (-892.616) -- 0:00:35
751000 -- [-891.728] (-890.156) (-903.269) (-891.451) * [-895.413] (-898.749) (-894.537) (-890.833) -- 0:00:35
751500 -- (-890.246) (-890.617) (-893.422) [-888.064] * (-894.020) (-894.931) (-889.601) [-890.154] -- 0:00:35
752000 -- [-893.522] (-895.594) (-890.817) (-889.085) * (-894.789) (-894.644) (-892.900) [-891.212] -- 0:00:35
752500 -- (-892.672) (-900.696) [-891.890] (-895.815) * (-891.727) (-892.031) [-889.069] (-889.562) -- 0:00:35
753000 -- (-889.464) [-888.940] (-891.392) (-892.193) * [-893.611] (-897.525) (-891.406) (-893.162) -- 0:00:35
753500 -- (-890.922) (-887.435) (-890.513) [-893.465] * (-896.907) (-892.863) (-893.483) [-892.537] -- 0:00:35
754000 -- [-890.277] (-893.546) (-891.986) (-892.136) * (-893.124) (-894.699) [-887.462] (-888.653) -- 0:00:35
754500 -- (-889.654) (-894.089) (-888.921) [-889.550] * (-889.819) (-891.567) (-893.351) [-890.560] -- 0:00:35
755000 -- (-891.416) (-906.900) [-892.947] (-888.308) * [-893.552] (-893.003) (-890.661) (-888.749) -- 0:00:35
Average standard deviation of split frequencies: 0.003118
755500 -- (-895.077) [-887.676] (-894.495) (-893.026) * (-893.001) [-891.961] (-892.404) (-892.569) -- 0:00:34
756000 -- (-887.749) (-897.150) [-890.146] (-893.832) * (-888.905) [-892.277] (-889.167) (-892.053) -- 0:00:34
756500 -- [-897.510] (-893.505) (-889.448) (-891.740) * (-887.597) (-892.824) [-893.014] (-890.275) -- 0:00:34
757000 -- [-895.099] (-891.777) (-889.985) (-892.910) * [-890.501] (-890.136) (-895.557) (-890.085) -- 0:00:34
757500 -- (-890.554) (-890.047) [-889.029] (-894.056) * [-891.224] (-890.941) (-893.194) (-898.026) -- 0:00:34
758000 -- (-897.559) [-888.325] (-892.321) (-893.329) * (-892.431) [-892.407] (-894.191) (-897.250) -- 0:00:34
758500 -- (-889.170) (-895.102) [-889.693] (-892.326) * (-887.893) (-892.201) (-894.267) [-890.933] -- 0:00:34
759000 -- (-890.732) (-893.769) [-893.034] (-890.313) * (-893.208) (-900.394) (-891.004) [-891.599] -- 0:00:34
759500 -- (-897.678) (-892.161) (-894.512) [-893.681] * (-895.351) [-898.337] (-890.905) (-893.530) -- 0:00:34
760000 -- (-892.154) (-892.849) [-888.883] (-892.118) * (-889.391) (-897.168) [-894.455] (-897.320) -- 0:00:34
Average standard deviation of split frequencies: 0.003099
760500 -- [-891.783] (-897.966) (-889.442) (-887.842) * (-888.854) (-893.081) [-891.018] (-889.997) -- 0:00:34
761000 -- (-890.272) (-895.303) (-894.819) [-892.543] * (-888.268) [-891.314] (-893.830) (-905.188) -- 0:00:34
761500 -- (-895.852) (-895.700) (-891.788) [-891.432] * (-889.614) (-891.237) [-891.189] (-892.465) -- 0:00:34
762000 -- (-891.732) (-890.327) [-893.073] (-892.454) * (-889.112) (-902.921) (-892.696) [-889.798] -- 0:00:34
762500 -- [-889.946] (-900.048) (-890.227) (-890.458) * (-893.015) (-895.609) [-888.194] (-891.480) -- 0:00:33
763000 -- (-897.673) (-891.696) (-889.237) [-888.007] * (-896.037) [-890.673] (-889.518) (-896.421) -- 0:00:33
763500 -- (-897.058) (-888.433) (-889.095) [-891.097] * (-890.885) (-896.733) (-890.576) [-890.903] -- 0:00:33
764000 -- (-890.586) (-897.061) (-890.459) [-893.363] * (-895.471) (-892.990) [-891.890] (-893.376) -- 0:00:33
764500 -- (-893.327) (-894.841) (-900.178) [-889.700] * (-894.088) (-894.116) [-889.505] (-893.160) -- 0:00:33
765000 -- (-894.429) (-893.168) (-898.082) [-892.587] * (-891.037) (-893.655) (-888.892) [-890.469] -- 0:00:33
Average standard deviation of split frequencies: 0.002462
765500 -- (-896.549) (-895.885) [-887.887] (-898.959) * (-897.625) (-889.802) (-892.944) [-891.127] -- 0:00:33
766000 -- (-898.764) (-901.451) (-893.361) [-890.558] * (-887.524) [-890.969] (-897.592) (-892.270) -- 0:00:33
766500 -- (-894.381) (-895.633) [-890.237] (-889.599) * (-890.188) (-890.003) (-894.673) [-893.206] -- 0:00:33
767000 -- (-894.776) (-895.945) (-893.858) [-891.274] * (-896.194) (-893.334) (-892.428) [-888.346] -- 0:00:33
767500 -- (-888.997) (-892.566) (-895.544) [-888.295] * [-894.147] (-891.848) (-886.702) (-890.426) -- 0:00:33
768000 -- (-894.298) (-893.171) (-888.233) [-890.464] * (-893.633) (-893.555) [-888.685] (-894.550) -- 0:00:33
768500 -- [-888.687] (-899.695) (-890.535) (-896.218) * (-889.801) (-890.635) (-887.481) [-891.366] -- 0:00:33
769000 -- (-892.936) [-890.365] (-891.475) (-893.633) * (-891.317) (-893.326) [-896.992] (-896.538) -- 0:00:33
769500 -- (-891.195) (-891.412) [-896.208] (-895.727) * (-892.033) [-892.121] (-895.294) (-894.125) -- 0:00:32
770000 -- [-893.935] (-892.809) (-902.328) (-899.042) * [-890.964] (-893.239) (-887.538) (-900.139) -- 0:00:32
Average standard deviation of split frequencies: 0.001835
770500 -- (-893.458) [-896.276] (-890.381) (-896.943) * (-894.141) (-896.256) [-887.961] (-896.866) -- 0:00:32
771000 -- (-890.191) (-894.662) (-894.634) [-897.907] * (-892.543) (-896.227) (-892.888) [-897.307] -- 0:00:32
771500 -- [-895.670] (-894.894) (-892.928) (-897.720) * (-891.056) (-892.371) (-893.270) [-893.324] -- 0:00:32
772000 -- [-890.893] (-891.000) (-891.939) (-897.846) * (-890.047) (-891.438) (-895.119) [-889.935] -- 0:00:32
772500 -- (-890.623) (-889.323) (-890.195) [-894.061] * (-896.059) [-891.511] (-899.105) (-887.684) -- 0:00:32
773000 -- [-893.754] (-898.070) (-891.572) (-893.607) * (-894.235) (-893.559) [-888.426] (-892.217) -- 0:00:32
773500 -- (-893.933) (-895.771) [-893.090] (-895.142) * (-891.632) [-897.293] (-896.709) (-896.142) -- 0:00:32
774000 -- (-889.835) (-894.121) [-889.844] (-895.982) * (-890.583) (-890.535) [-892.649] (-891.468) -- 0:00:32
774500 -- (-894.704) [-889.907] (-894.674) (-890.995) * (-889.064) [-891.538] (-894.908) (-898.431) -- 0:00:32
775000 -- [-896.521] (-890.923) (-894.073) (-893.277) * [-891.782] (-900.432) (-888.803) (-897.444) -- 0:00:32
Average standard deviation of split frequencies: 0.001215
775500 -- (-893.925) (-896.226) [-887.069] (-891.987) * (-894.260) (-892.282) (-889.815) [-888.278] -- 0:00:32
776000 -- (-890.424) (-892.343) [-896.926] (-887.650) * (-893.057) (-889.949) [-888.789] (-894.888) -- 0:00:32
776500 -- (-894.490) (-900.473) (-890.283) [-889.060] * (-894.775) (-891.283) (-896.770) [-888.995] -- 0:00:31
777000 -- (-887.676) (-896.439) (-899.951) [-889.962] * (-889.748) (-891.988) (-895.604) [-890.289] -- 0:00:31
777500 -- (-891.071) (-889.404) (-889.428) [-891.925] * (-893.458) [-892.568] (-895.701) (-893.718) -- 0:00:31
778000 -- [-890.022] (-887.691) (-894.795) (-890.583) * (-890.071) [-890.634] (-894.968) (-896.835) -- 0:00:31
778500 -- (-890.802) [-891.303] (-897.852) (-890.286) * (-892.458) [-890.224] (-895.529) (-897.770) -- 0:00:31
779000 -- (-900.069) (-893.875) (-898.235) [-896.688] * [-892.031] (-897.046) (-886.684) (-893.967) -- 0:00:31
779500 -- [-892.349] (-896.195) (-897.312) (-889.421) * (-890.263) (-898.624) [-889.916] (-896.757) -- 0:00:31
780000 -- (-889.821) (-894.139) [-892.461] (-890.720) * (-893.917) [-897.807] (-898.093) (-891.420) -- 0:00:31
Average standard deviation of split frequencies: 0.001208
780500 -- (-890.145) [-897.042] (-890.362) (-889.327) * [-890.421] (-889.412) (-899.830) (-893.493) -- 0:00:31
781000 -- (-894.576) (-893.988) [-894.124] (-891.229) * (-890.712) [-890.923] (-891.452) (-892.220) -- 0:00:31
781500 -- (-887.867) (-892.742) (-892.490) [-891.257] * (-894.348) [-891.900] (-891.698) (-891.689) -- 0:00:31
782000 -- (-889.749) [-887.920] (-894.452) (-892.455) * (-891.922) (-896.891) [-892.192] (-890.318) -- 0:00:31
782500 -- (-892.040) (-889.039) [-892.360] (-890.830) * (-891.083) (-895.852) [-891.516] (-891.960) -- 0:00:31
783000 -- (-896.615) (-894.684) (-893.616) [-893.634] * (-891.297) [-893.703] (-892.342) (-891.149) -- 0:00:31
783500 -- (-891.907) (-900.509) [-890.217] (-891.463) * (-892.931) [-889.589] (-896.766) (-889.469) -- 0:00:30
784000 -- (-896.083) (-888.627) (-888.917) [-892.859] * (-891.116) (-890.159) [-893.296] (-889.456) -- 0:00:30
784500 -- [-891.714] (-892.352) (-893.545) (-902.400) * [-891.817] (-891.707) (-891.797) (-890.488) -- 0:00:30
785000 -- (-890.450) [-894.420] (-891.217) (-891.152) * [-897.928] (-897.595) (-894.291) (-893.572) -- 0:00:30
Average standard deviation of split frequencies: 0.001200
785500 -- (-895.884) (-891.849) (-891.561) [-892.627] * (-899.325) (-893.211) (-890.479) [-892.021] -- 0:00:30
786000 -- (-890.541) [-890.836] (-892.696) (-894.225) * (-890.755) (-891.264) [-896.674] (-895.731) -- 0:00:30
786500 -- (-892.045) [-894.307] (-894.859) (-892.308) * [-890.866] (-888.803) (-891.526) (-891.013) -- 0:00:30
787000 -- (-895.390) (-893.674) (-897.425) [-891.540] * (-895.332) [-891.182] (-892.290) (-894.659) -- 0:00:30
787500 -- (-889.224) [-890.694] (-888.135) (-892.743) * (-890.987) (-892.314) [-890.668] (-890.597) -- 0:00:30
788000 -- (-893.312) [-893.071] (-891.152) (-887.395) * (-890.231) (-894.843) [-890.507] (-889.083) -- 0:00:30
788500 -- (-897.710) [-892.114] (-893.632) (-890.544) * (-891.166) (-895.479) [-888.755] (-892.018) -- 0:00:30
789000 -- (-896.536) [-891.021] (-898.490) (-892.673) * [-889.499] (-894.207) (-891.933) (-896.030) -- 0:00:30
789500 -- (-899.335) (-888.513) (-898.348) [-891.964] * (-887.620) (-890.511) [-890.743] (-890.975) -- 0:00:30
790000 -- (-892.030) (-891.306) (-893.477) [-894.592] * (-900.050) (-895.291) [-888.323] (-894.313) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
790500 -- [-890.664] (-890.265) (-892.311) (-893.653) * (-902.393) (-888.814) [-892.533] (-892.168) -- 0:00:29
791000 -- (-892.719) [-893.722] (-896.639) (-891.197) * (-895.414) (-892.435) [-891.069] (-893.056) -- 0:00:29
791500 -- (-892.401) [-895.838] (-890.267) (-888.743) * (-894.972) [-891.648] (-892.434) (-891.880) -- 0:00:29
792000 -- (-893.245) (-902.957) [-888.215] (-896.071) * (-890.404) [-891.385] (-895.680) (-894.955) -- 0:00:29
792500 -- [-892.332] (-893.073) (-894.526) (-899.796) * (-889.672) [-893.096] (-893.222) (-898.314) -- 0:00:29
793000 -- (-896.322) (-892.016) (-895.098) [-892.095] * (-893.862) [-895.650] (-895.367) (-894.168) -- 0:00:29
793500 -- (-889.790) (-891.088) [-890.115] (-894.565) * (-897.067) [-891.267] (-897.874) (-894.044) -- 0:00:29
794000 -- (-886.878) [-891.998] (-888.895) (-893.089) * (-893.287) (-891.533) [-892.274] (-892.582) -- 0:00:29
794500 -- [-891.496] (-892.269) (-891.019) (-892.049) * [-893.522] (-896.277) (-889.219) (-896.898) -- 0:00:29
795000 -- (-895.785) (-891.460) [-891.389] (-895.743) * (-890.875) (-900.680) [-891.986] (-892.689) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
795500 -- (-892.599) (-890.606) [-895.871] (-895.037) * (-894.813) (-890.553) [-891.926] (-898.833) -- 0:00:29
796000 -- [-891.665] (-891.673) (-889.740) (-894.632) * [-889.848] (-889.792) (-888.334) (-898.232) -- 0:00:29
796500 -- [-891.509] (-893.125) (-890.483) (-895.230) * (-895.213) [-890.894] (-897.997) (-895.230) -- 0:00:29
797000 -- (-893.315) (-901.501) [-892.530] (-889.886) * [-891.768] (-887.371) (-891.410) (-892.209) -- 0:00:29
797500 -- (-893.617) (-897.695) [-891.794] (-894.871) * (-895.377) [-891.004] (-898.395) (-896.300) -- 0:00:28
798000 -- (-895.518) (-897.077) (-894.970) [-890.291] * [-894.458] (-893.340) (-893.936) (-892.416) -- 0:00:28
798500 -- (-894.859) (-894.293) (-892.117) [-891.750] * [-901.948] (-892.866) (-889.044) (-902.067) -- 0:00:28
799000 -- (-889.837) (-893.318) (-897.950) [-891.577] * [-889.615] (-895.314) (-900.969) (-891.248) -- 0:00:28
799500 -- (-888.679) (-890.810) (-894.933) [-888.992] * [-894.576] (-900.231) (-900.969) (-891.507) -- 0:00:28
800000 -- [-889.219] (-899.932) (-897.192) (-892.108) * (-892.640) (-896.749) (-892.684) [-891.946] -- 0:00:28
Average standard deviation of split frequencies: 0.000000
800500 -- (-892.770) (-892.165) [-889.597] (-893.021) * [-891.047] (-896.677) (-888.899) (-895.050) -- 0:00:28
801000 -- (-892.977) [-890.238] (-890.233) (-890.718) * (-890.673) [-891.443] (-893.819) (-888.944) -- 0:00:28
801500 -- [-893.737] (-893.853) (-896.867) (-891.854) * (-890.051) (-898.302) [-887.958] (-892.856) -- 0:00:28
802000 -- [-888.957] (-896.318) (-890.106) (-890.624) * (-892.942) [-893.937] (-889.445) (-893.520) -- 0:00:28
802500 -- (-890.705) (-890.534) (-896.011) [-890.045] * (-895.962) [-891.352] (-891.712) (-895.596) -- 0:00:28
803000 -- [-892.207] (-892.114) (-893.920) (-892.736) * [-891.254] (-904.368) (-888.844) (-892.052) -- 0:00:28
803500 -- (-889.704) [-891.074] (-895.536) (-889.147) * [-891.126] (-894.201) (-890.304) (-888.434) -- 0:00:28
804000 -- [-890.194] (-893.106) (-894.253) (-894.436) * (-892.535) (-894.468) [-889.709] (-891.668) -- 0:00:28
804500 -- (-887.766) (-897.801) [-891.577] (-895.852) * (-894.491) (-894.131) (-891.938) [-894.218] -- 0:00:27
805000 -- [-891.206] (-895.645) (-896.674) (-893.583) * (-894.480) [-896.700] (-895.248) (-892.315) -- 0:00:27
Average standard deviation of split frequencies: 0.000585
805500 -- [-887.319] (-892.100) (-895.794) (-892.129) * (-894.579) (-892.755) [-891.633] (-890.613) -- 0:00:27
806000 -- (-895.518) (-894.532) (-891.874) [-893.523] * (-897.213) (-897.377) [-890.816] (-889.345) -- 0:00:27
806500 -- [-891.472] (-896.641) (-894.294) (-893.237) * [-894.030] (-889.352) (-895.937) (-891.353) -- 0:00:27
807000 -- (-892.975) (-893.792) (-891.535) [-893.306] * (-889.783) (-891.235) [-888.138] (-894.381) -- 0:00:27
807500 -- [-896.205] (-888.815) (-890.945) (-894.442) * (-889.518) (-891.622) (-892.757) [-893.151] -- 0:00:27
808000 -- (-891.290) (-893.115) [-888.143] (-893.530) * [-888.545] (-896.141) (-890.257) (-890.052) -- 0:00:27
808500 -- (-887.687) [-888.617] (-894.484) (-895.627) * (-889.696) (-892.302) [-890.275] (-895.199) -- 0:00:27
809000 -- (-890.303) (-891.810) [-889.841] (-893.425) * (-889.385) (-894.537) (-900.875) [-894.512] -- 0:00:27
809500 -- (-895.243) [-889.339] (-891.240) (-895.411) * (-892.551) [-892.273] (-892.731) (-889.201) -- 0:00:27
810000 -- (-890.869) (-897.845) (-892.439) [-891.233] * [-887.689] (-893.716) (-891.078) (-894.348) -- 0:00:27
Average standard deviation of split frequencies: 0.000582
810500 -- (-891.242) (-893.169) (-887.872) [-888.350] * (-890.283) (-889.312) [-893.839] (-896.909) -- 0:00:27
811000 -- (-892.893) (-895.502) [-890.574] (-892.464) * (-896.417) (-891.842) (-894.671) [-890.409] -- 0:00:27
811500 -- (-887.667) (-902.265) (-888.242) [-890.896] * (-891.958) [-896.257] (-889.788) (-894.092) -- 0:00:26
812000 -- [-894.621] (-891.168) (-892.010) (-893.754) * [-893.794] (-896.027) (-892.482) (-892.886) -- 0:00:26
812500 -- (-901.445) (-896.014) [-892.585] (-888.998) * (-899.423) (-891.579) [-889.761] (-891.181) -- 0:00:26
813000 -- (-897.242) (-891.880) (-891.819) [-895.371] * (-898.446) [-892.407] (-894.388) (-894.554) -- 0:00:26
813500 -- (-896.633) (-894.532) (-897.521) [-891.503] * [-899.668] (-892.169) (-894.619) (-895.601) -- 0:00:26
814000 -- (-891.497) [-888.733] (-897.790) (-889.503) * [-890.850] (-889.280) (-892.707) (-896.444) -- 0:00:26
814500 -- (-889.767) [-891.441] (-890.590) (-889.926) * (-888.992) (-895.913) (-890.004) [-891.223] -- 0:00:26
815000 -- [-893.571] (-890.213) (-890.521) (-892.027) * [-887.285] (-892.452) (-891.405) (-895.636) -- 0:00:26
Average standard deviation of split frequencies: 0.002311
815500 -- (-896.260) (-892.988) [-889.992] (-890.018) * [-892.452] (-897.662) (-893.324) (-894.138) -- 0:00:26
816000 -- (-892.999) (-887.587) (-892.459) [-891.052] * (-890.382) [-891.853] (-891.435) (-890.475) -- 0:00:26
816500 -- (-892.292) (-890.137) (-889.494) [-890.230] * [-895.114] (-893.637) (-893.042) (-891.458) -- 0:00:26
817000 -- (-891.051) [-891.037] (-890.939) (-894.564) * (-894.550) [-888.357] (-894.877) (-892.210) -- 0:00:26
817500 -- [-895.721] (-893.757) (-890.704) (-895.098) * (-889.817) (-897.403) (-889.016) [-891.567] -- 0:00:26
818000 -- [-893.275] (-888.772) (-895.321) (-890.818) * (-892.662) [-889.840] (-889.171) (-890.882) -- 0:00:26
818500 -- (-894.639) (-895.533) [-891.278] (-895.455) * [-893.900] (-895.217) (-892.701) (-891.216) -- 0:00:25
819000 -- (-893.793) (-892.505) (-890.524) [-895.645] * (-892.275) (-896.590) [-891.404] (-902.014) -- 0:00:25
819500 -- (-905.104) (-892.468) [-890.818] (-896.659) * (-891.438) [-887.038] (-895.843) (-891.583) -- 0:00:25
820000 -- (-889.172) [-889.136] (-893.857) (-893.164) * [-890.573] (-888.862) (-889.507) (-895.059) -- 0:00:25
Average standard deviation of split frequencies: 0.002872
820500 -- [-894.962] (-890.000) (-894.255) (-900.486) * (-890.387) (-894.125) [-888.345] (-890.514) -- 0:00:25
821000 -- (-889.711) [-887.749] (-892.496) (-896.294) * (-895.304) (-893.044) [-888.723] (-893.849) -- 0:00:25
821500 -- (-891.451) [-891.860] (-887.424) (-889.777) * (-892.439) (-897.634) [-896.513] (-888.462) -- 0:00:25
822000 -- [-888.017] (-891.026) (-896.681) (-888.570) * (-892.086) (-901.256) [-890.314] (-893.587) -- 0:00:25
822500 -- [-890.112] (-888.615) (-898.665) (-889.397) * [-897.025] (-900.826) (-890.432) (-891.589) -- 0:00:25
823000 -- (-888.569) (-891.833) [-895.748] (-899.355) * [-888.660] (-893.907) (-888.837) (-893.373) -- 0:00:25
823500 -- [-893.685] (-891.153) (-892.840) (-895.171) * (-890.936) (-895.979) (-890.244) [-889.474] -- 0:00:25
824000 -- (-893.122) [-890.322] (-892.891) (-899.536) * [-890.065] (-887.271) (-892.561) (-890.506) -- 0:00:25
824500 -- (-889.698) (-888.477) (-888.619) [-890.770] * [-891.886] (-892.457) (-892.451) (-894.245) -- 0:00:25
825000 -- (-889.538) [-899.145] (-896.523) (-894.291) * [-893.396] (-891.035) (-890.676) (-890.782) -- 0:00:25
Average standard deviation of split frequencies: 0.001712
825500 -- (-892.182) (-897.765) [-889.332] (-890.443) * (-895.163) (-893.245) (-901.753) [-889.238] -- 0:00:24
826000 -- (-888.955) (-890.701) (-893.524) [-892.420] * (-900.436) (-899.850) [-898.464] (-891.405) -- 0:00:24
826500 -- (-890.889) [-892.885] (-890.047) (-890.081) * [-895.566] (-896.606) (-890.035) (-898.715) -- 0:00:24
827000 -- (-890.508) (-890.792) [-895.075] (-891.008) * (-888.893) (-897.392) (-894.589) [-890.516] -- 0:00:24
827500 -- (-891.588) [-893.060] (-888.872) (-894.252) * [-890.681] (-892.543) (-894.545) (-896.469) -- 0:00:24
828000 -- [-892.176] (-895.102) (-890.213) (-890.200) * [-896.247] (-890.612) (-890.946) (-894.929) -- 0:00:24
828500 -- (-899.493) (-894.208) [-890.135] (-893.162) * (-893.491) (-894.128) [-892.816] (-895.134) -- 0:00:24
829000 -- (-896.660) [-889.436] (-891.473) (-892.036) * [-893.582] (-893.678) (-900.399) (-890.784) -- 0:00:24
829500 -- (-896.334) [-893.168] (-892.307) (-893.657) * (-893.173) [-890.170] (-897.028) (-894.218) -- 0:00:24
830000 -- [-896.523] (-893.140) (-895.208) (-896.781) * (-892.703) [-888.702] (-889.203) (-896.810) -- 0:00:24
Average standard deviation of split frequencies: 0.002270
830500 -- (-892.987) [-891.073] (-899.464) (-889.408) * [-889.979] (-892.932) (-889.611) (-891.759) -- 0:00:24
831000 -- (-894.289) (-896.904) (-896.761) [-890.320] * (-893.617) (-892.213) (-894.280) [-889.149] -- 0:00:24
831500 -- [-891.823] (-890.020) (-896.440) (-895.290) * (-893.190) [-889.267] (-891.660) (-891.824) -- 0:00:24
832000 -- (-891.663) (-892.363) [-889.316] (-891.679) * (-890.704) [-891.758] (-892.257) (-892.190) -- 0:00:24
832500 -- (-894.485) (-892.909) (-895.287) [-895.121] * (-889.519) (-889.779) (-897.533) [-894.446] -- 0:00:23
833000 -- (-888.215) (-898.389) [-894.543] (-888.962) * (-898.833) (-890.456) (-893.896) [-890.825] -- 0:00:23
833500 -- (-891.753) (-895.179) (-890.171) [-889.901] * (-891.162) [-891.387] (-895.213) (-888.719) -- 0:00:23
834000 -- (-889.853) (-887.934) [-891.521] (-892.768) * [-893.798] (-894.418) (-889.198) (-891.087) -- 0:00:23
834500 -- (-887.693) (-888.905) [-889.507] (-892.704) * (-892.361) [-895.989] (-889.652) (-891.289) -- 0:00:23
835000 -- (-893.496) (-892.471) [-895.603] (-891.151) * (-890.954) (-895.089) [-891.978] (-892.496) -- 0:00:23
Average standard deviation of split frequencies: 0.002256
835500 -- (-900.467) (-892.864) [-891.707] (-887.983) * (-892.104) (-898.758) (-892.207) [-892.371] -- 0:00:23
836000 -- [-892.509] (-888.444) (-891.942) (-900.780) * (-894.129) [-890.189] (-893.180) (-893.311) -- 0:00:23
836500 -- (-892.711) [-893.912] (-891.641) (-891.537) * (-893.882) (-890.942) [-892.567] (-890.282) -- 0:00:23
837000 -- (-894.922) (-893.414) [-896.294] (-893.299) * (-896.914) (-898.241) (-890.082) [-888.211] -- 0:00:23
837500 -- (-889.749) [-891.394] (-896.238) (-895.576) * [-890.248] (-894.507) (-892.036) (-889.620) -- 0:00:23
838000 -- [-891.330] (-893.922) (-895.552) (-894.537) * (-891.874) (-893.444) [-897.388] (-888.971) -- 0:00:23
838500 -- (-890.434) [-892.601] (-892.021) (-891.171) * (-895.148) (-895.849) (-893.702) [-894.696] -- 0:00:23
839000 -- [-892.713] (-891.677) (-889.775) (-900.489) * (-894.660) (-896.796) [-895.782] (-891.421) -- 0:00:23
839500 -- (-890.130) [-895.516] (-887.610) (-896.177) * (-895.466) (-891.506) [-887.229] (-893.526) -- 0:00:22
840000 -- [-892.977] (-891.502) (-891.001) (-891.469) * (-893.318) (-897.479) [-892.886] (-891.543) -- 0:00:22
Average standard deviation of split frequencies: 0.002804
840500 -- [-892.477] (-891.091) (-894.638) (-893.484) * (-890.349) (-891.334) (-890.291) [-894.147] -- 0:00:22
841000 -- [-890.819] (-891.743) (-904.494) (-893.825) * (-897.634) [-891.575] (-893.168) (-894.020) -- 0:00:22
841500 -- (-899.496) [-897.645] (-896.882) (-895.957) * (-890.658) (-895.800) [-889.137] (-892.025) -- 0:00:22
842000 -- (-893.399) (-898.772) (-891.434) [-889.566] * (-891.679) (-897.969) (-888.564) [-894.651] -- 0:00:22
842500 -- (-893.505) (-895.691) (-899.050) [-890.878] * (-895.042) (-892.275) [-889.906] (-889.427) -- 0:00:22
843000 -- [-891.939] (-891.626) (-891.924) (-891.635) * [-888.713] (-892.325) (-890.767) (-889.587) -- 0:00:22
843500 -- (-887.869) (-892.137) (-892.032) [-895.322] * [-896.996] (-889.701) (-894.546) (-893.343) -- 0:00:22
844000 -- [-890.135] (-894.460) (-889.926) (-891.764) * (-891.143) (-895.588) (-894.886) [-890.719] -- 0:00:22
844500 -- (-890.812) (-894.451) [-889.293] (-892.866) * (-893.424) [-890.236] (-894.186) (-899.057) -- 0:00:22
845000 -- (-888.078) [-893.408] (-894.871) (-888.320) * (-897.355) (-895.940) (-889.444) [-892.985] -- 0:00:22
Average standard deviation of split frequencies: 0.003343
845500 -- (-893.605) [-890.029] (-892.901) (-891.554) * (-894.333) (-891.256) (-895.633) [-892.606] -- 0:00:22
846000 -- (-896.658) (-899.070) (-891.884) [-890.267] * [-898.007] (-897.038) (-898.262) (-891.492) -- 0:00:22
846500 -- (-894.001) (-892.469) (-897.251) [-894.258] * (-891.939) [-888.522] (-891.417) (-887.950) -- 0:00:21
847000 -- (-896.125) [-889.138] (-891.552) (-890.963) * (-895.516) (-895.310) (-894.768) [-895.452] -- 0:00:21
847500 -- [-890.788] (-888.639) (-899.217) (-891.931) * (-895.453) (-889.429) (-894.404) [-895.002] -- 0:00:21
848000 -- (-894.952) (-897.411) [-894.671] (-900.708) * (-890.592) (-890.269) [-898.059] (-893.118) -- 0:00:21
848500 -- (-892.286) [-897.104] (-891.052) (-897.801) * [-898.165] (-890.012) (-901.150) (-895.648) -- 0:00:21
849000 -- [-898.633] (-896.340) (-892.171) (-897.357) * (-896.080) [-889.666] (-890.500) (-889.611) -- 0:00:21
849500 -- (-893.697) (-888.982) [-889.491] (-894.753) * (-896.451) (-891.770) [-887.791] (-888.765) -- 0:00:21
850000 -- (-891.021) [-888.435] (-891.243) (-895.543) * (-894.327) (-894.601) [-888.327] (-891.256) -- 0:00:21
Average standard deviation of split frequencies: 0.002217
850500 -- [-890.290] (-894.968) (-896.514) (-894.372) * [-894.052] (-892.427) (-893.113) (-893.511) -- 0:00:21
851000 -- (-892.983) (-892.586) [-890.706] (-895.915) * (-891.157) (-889.883) [-891.375] (-890.500) -- 0:00:21
851500 -- (-893.958) [-891.333] (-895.664) (-891.499) * [-896.258] (-891.389) (-890.024) (-890.183) -- 0:00:21
852000 -- (-892.673) (-888.169) (-891.481) [-892.889] * (-895.351) (-891.565) (-894.959) [-891.249] -- 0:00:21
852500 -- (-888.687) [-889.373] (-890.026) (-893.003) * (-890.651) (-892.097) (-891.979) [-890.220] -- 0:00:21
853000 -- (-888.602) [-890.842] (-904.170) (-890.614) * [-892.872] (-891.326) (-895.021) (-892.948) -- 0:00:21
853500 -- (-891.466) (-892.647) (-890.993) [-897.582] * (-889.838) [-889.522] (-890.928) (-889.625) -- 0:00:20
854000 -- (-891.230) (-891.998) [-891.890] (-889.433) * [-892.276] (-890.930) (-890.713) (-890.715) -- 0:00:20
854500 -- (-893.959) (-889.465) [-892.585] (-894.662) * (-893.382) [-891.131] (-889.212) (-893.714) -- 0:00:20
855000 -- [-893.809] (-890.242) (-893.822) (-894.006) * (-888.849) (-891.128) (-891.604) [-893.976] -- 0:00:20
Average standard deviation of split frequencies: 0.002754
855500 -- (-888.097) [-890.829] (-897.065) (-892.998) * (-888.618) [-890.080] (-888.977) (-888.813) -- 0:00:20
856000 -- [-888.416] (-892.246) (-900.599) (-895.881) * (-895.858) (-889.255) (-891.164) [-890.813] -- 0:00:20
856500 -- (-888.649) (-893.014) [-895.583] (-900.147) * [-892.910] (-890.435) (-889.824) (-889.627) -- 0:00:20
857000 -- (-895.901) (-895.603) [-895.030] (-900.500) * (-897.910) (-894.958) (-889.799) [-893.313] -- 0:00:20
857500 -- (-892.620) (-893.558) [-889.576] (-891.580) * (-899.700) [-890.538] (-888.752) (-890.896) -- 0:00:20
858000 -- (-895.087) (-891.180) (-892.454) [-892.061] * (-890.599) (-893.283) [-892.384] (-892.834) -- 0:00:20
858500 -- (-892.217) (-891.757) (-891.445) [-891.125] * (-887.565) (-896.927) [-891.339] (-890.939) -- 0:00:20
859000 -- (-889.965) (-891.131) [-890.622] (-890.373) * (-889.320) [-893.796] (-892.813) (-895.500) -- 0:00:20
859500 -- (-891.517) [-890.599] (-890.583) (-891.991) * [-893.031] (-887.982) (-895.210) (-893.512) -- 0:00:20
860000 -- (-891.758) [-890.006] (-892.092) (-892.330) * (-893.063) (-891.065) [-893.517] (-890.315) -- 0:00:20
Average standard deviation of split frequencies: 0.003834
860500 -- (-894.939) (-892.384) [-895.288] (-896.323) * (-897.459) (-892.642) [-895.304] (-889.977) -- 0:00:19
861000 -- [-892.649] (-897.396) (-891.075) (-895.102) * [-890.125] (-891.993) (-895.004) (-892.124) -- 0:00:19
861500 -- (-891.759) (-896.885) (-892.695) [-895.127] * (-890.494) [-891.696] (-889.357) (-892.109) -- 0:00:19
862000 -- (-891.103) [-898.608] (-889.927) (-889.155) * [-890.720] (-895.965) (-892.062) (-889.207) -- 0:00:19
862500 -- (-893.034) (-896.731) (-890.105) [-889.759] * (-892.653) [-892.160] (-890.975) (-890.058) -- 0:00:19
863000 -- (-894.603) [-895.971] (-888.134) (-892.673) * (-896.067) (-899.899) (-892.456) [-891.327] -- 0:00:19
863500 -- (-889.583) [-896.528] (-890.331) (-894.960) * [-891.530] (-902.097) (-893.770) (-890.772) -- 0:00:19
864000 -- (-890.089) (-898.981) (-895.041) [-889.253] * [-892.447] (-892.195) (-896.017) (-894.748) -- 0:00:19
864500 -- [-890.861] (-892.446) (-892.086) (-895.062) * (-897.983) (-889.452) (-901.003) [-891.699] -- 0:00:19
865000 -- (-892.670) (-906.090) (-893.007) [-893.044] * (-893.699) (-888.911) (-901.968) [-893.367] -- 0:00:19
Average standard deviation of split frequencies: 0.003266
865500 -- (-889.496) (-895.907) [-891.633] (-892.784) * (-889.463) [-889.700] (-890.569) (-897.775) -- 0:00:19
866000 -- (-889.049) [-893.831] (-898.506) (-893.508) * (-891.641) (-891.133) [-888.515] (-900.203) -- 0:00:19
866500 -- [-898.377] (-892.077) (-896.671) (-891.684) * [-892.646] (-892.694) (-889.080) (-894.434) -- 0:00:19
867000 -- (-891.003) [-888.722] (-895.346) (-892.492) * (-897.123) (-893.944) (-893.627) [-889.857] -- 0:00:19
867500 -- [-892.245] (-889.697) (-893.560) (-896.864) * (-892.821) (-898.284) (-888.557) [-891.655] -- 0:00:18
868000 -- (-894.596) [-892.712] (-888.721) (-893.762) * (-892.042) (-891.500) (-891.984) [-891.633] -- 0:00:18
868500 -- (-892.361) [-892.805] (-895.561) (-893.678) * (-892.581) (-893.602) [-891.168] (-891.834) -- 0:00:18
869000 -- (-893.189) (-890.339) (-900.591) [-895.592] * [-888.642] (-894.350) (-892.134) (-898.439) -- 0:00:18
869500 -- (-889.926) [-891.523] (-895.332) (-888.806) * (-888.111) (-893.138) [-889.236] (-889.874) -- 0:00:18
870000 -- [-896.011] (-894.982) (-892.930) (-898.886) * (-894.334) (-892.077) (-893.199) [-889.916] -- 0:00:18
Average standard deviation of split frequencies: 0.003249
870500 -- (-893.908) [-888.510] (-894.401) (-891.900) * (-892.835) (-892.943) [-890.202] (-891.934) -- 0:00:18
871000 -- (-894.322) [-886.332] (-893.803) (-890.701) * (-895.670) (-896.543) [-892.268] (-892.835) -- 0:00:18
871500 -- (-892.771) (-894.724) (-897.038) [-895.759] * (-890.409) [-893.451] (-891.397) (-896.172) -- 0:00:18
872000 -- [-890.375] (-890.733) (-893.289) (-891.364) * (-891.960) [-891.530] (-897.752) (-892.844) -- 0:00:18
872500 -- [-888.390] (-900.563) (-894.019) (-889.784) * (-891.344) (-892.522) (-891.076) [-889.628] -- 0:00:18
873000 -- (-893.130) [-899.781] (-894.055) (-888.904) * (-890.907) (-891.380) [-895.855] (-893.943) -- 0:00:18
873500 -- [-891.966] (-894.008) (-893.027) (-889.197) * (-890.467) [-890.262] (-890.196) (-888.758) -- 0:00:18
874000 -- (-896.019) (-890.688) [-888.081] (-890.817) * (-888.673) (-888.913) [-894.155] (-892.483) -- 0:00:18
874500 -- (-894.385) (-895.900) (-892.062) [-888.340] * (-891.069) (-888.854) [-893.266] (-894.071) -- 0:00:17
875000 -- (-891.452) (-891.329) [-891.328] (-893.754) * (-890.309) (-887.743) (-892.307) [-893.170] -- 0:00:17
Average standard deviation of split frequencies: 0.003229
875500 -- [-890.631] (-894.060) (-891.231) (-892.630) * (-891.800) (-890.997) [-887.411] (-895.231) -- 0:00:17
876000 -- [-889.723] (-889.587) (-893.446) (-892.318) * (-892.055) (-893.977) [-891.793] (-896.545) -- 0:00:17
876500 -- (-895.775) (-890.071) (-890.643) [-889.070] * (-895.623) (-894.491) [-887.860] (-900.297) -- 0:00:17
877000 -- (-892.860) [-892.391] (-887.250) (-891.604) * (-892.248) (-893.252) [-901.976] (-893.235) -- 0:00:17
877500 -- (-892.770) [-892.189] (-896.465) (-889.177) * (-895.251) (-890.527) (-890.398) [-888.940] -- 0:00:17
878000 -- [-893.739] (-892.610) (-890.286) (-891.912) * (-890.236) (-894.601) (-891.209) [-890.222] -- 0:00:17
878500 -- (-895.351) (-898.269) [-890.925] (-894.736) * [-890.523] (-891.596) (-888.107) (-895.177) -- 0:00:17
879000 -- [-892.482] (-892.798) (-895.862) (-894.160) * (-894.898) (-889.306) [-886.929] (-888.451) -- 0:00:17
879500 -- [-889.958] (-896.396) (-890.416) (-889.151) * [-886.553] (-892.539) (-890.795) (-888.612) -- 0:00:17
880000 -- (-895.149) (-894.432) (-896.721) [-889.086] * (-892.601) (-891.404) [-889.120] (-890.168) -- 0:00:17
Average standard deviation of split frequencies: 0.003212
880500 -- (-892.192) [-896.191] (-889.997) (-889.738) * [-892.030] (-891.883) (-893.311) (-894.424) -- 0:00:17
881000 -- (-889.886) [-894.992] (-892.768) (-891.094) * (-891.177) [-888.995] (-892.132) (-901.152) -- 0:00:17
881500 -- (-893.445) [-894.311] (-892.418) (-893.720) * (-891.644) (-891.198) (-897.783) [-890.757] -- 0:00:16
882000 -- (-890.304) (-893.565) (-891.746) [-889.277] * (-890.037) (-889.607) (-892.987) [-891.236] -- 0:00:16
882500 -- (-894.225) (-892.697) (-891.779) [-896.991] * [-890.819] (-889.585) (-902.940) (-899.721) -- 0:00:16
883000 -- (-895.463) (-891.814) (-894.014) [-888.410] * (-889.168) (-893.565) (-892.169) [-895.285] -- 0:00:16
883500 -- (-892.156) [-886.918] (-895.471) (-889.001) * [-889.234] (-893.751) (-894.355) (-894.007) -- 0:00:16
884000 -- [-892.867] (-889.443) (-895.390) (-892.039) * [-890.416] (-896.640) (-891.407) (-895.767) -- 0:00:16
884500 -- (-892.357) (-895.414) (-894.751) [-892.202] * [-889.437] (-893.013) (-890.253) (-893.427) -- 0:00:16
885000 -- (-890.997) [-892.015] (-890.687) (-893.042) * (-887.072) (-889.284) (-893.190) [-894.522] -- 0:00:16
Average standard deviation of split frequencies: 0.002660
885500 -- (-893.432) [-896.958] (-893.461) (-888.974) * (-896.020) (-895.942) [-891.392] (-887.982) -- 0:00:16
886000 -- (-892.927) (-895.295) (-893.929) [-888.660] * [-889.090] (-892.245) (-892.211) (-890.832) -- 0:00:16
886500 -- (-889.059) (-892.509) [-895.022] (-902.040) * (-889.525) [-890.163] (-896.865) (-890.368) -- 0:00:16
887000 -- (-891.652) (-893.927) (-897.700) [-893.340] * (-898.635) [-894.226] (-892.682) (-890.382) -- 0:00:16
887500 -- [-890.111] (-889.826) (-896.349) (-895.801) * (-889.696) (-891.056) (-891.188) [-889.573] -- 0:00:16
888000 -- (-891.069) [-894.849] (-887.845) (-894.817) * [-889.368] (-887.947) (-891.200) (-892.935) -- 0:00:16
888500 -- [-894.158] (-890.782) (-894.199) (-896.454) * (-893.688) (-895.093) (-891.754) [-888.638] -- 0:00:15
889000 -- (-894.873) (-889.158) (-892.139) [-894.307] * (-891.027) (-894.527) [-893.679] (-893.235) -- 0:00:15
889500 -- (-892.549) [-892.967] (-892.099) (-893.977) * (-891.292) (-893.532) [-893.725] (-889.471) -- 0:00:15
890000 -- (-902.102) (-892.936) [-891.535] (-897.749) * (-895.069) [-893.544] (-895.130) (-889.029) -- 0:00:15
Average standard deviation of split frequencies: 0.002646
890500 -- [-891.055] (-897.671) (-891.284) (-888.244) * (-894.358) [-890.688] (-893.523) (-895.962) -- 0:00:15
891000 -- [-895.645] (-893.877) (-891.733) (-895.067) * (-895.555) (-890.571) (-887.528) [-892.299] -- 0:00:15
891500 -- (-894.575) (-893.196) (-893.995) [-893.560] * [-889.546] (-888.582) (-888.137) (-897.470) -- 0:00:15
892000 -- (-890.260) [-896.239] (-891.290) (-893.305) * [-893.975] (-890.581) (-894.463) (-898.802) -- 0:00:15
892500 -- [-891.877] (-891.812) (-898.064) (-891.895) * (-890.737) (-890.075) (-892.245) [-890.594] -- 0:00:15
893000 -- (-888.621) (-889.848) [-893.331] (-889.145) * (-890.179) (-895.269) (-891.856) [-889.635] -- 0:00:15
893500 -- (-894.886) (-894.728) [-892.493] (-894.036) * [-895.957] (-898.187) (-897.024) (-900.316) -- 0:00:15
894000 -- (-889.267) (-894.218) (-890.859) [-890.378] * (-888.099) [-889.103] (-901.286) (-892.941) -- 0:00:15
894500 -- (-892.153) [-896.359] (-890.635) (-892.373) * [-890.359] (-889.769) (-891.166) (-893.801) -- 0:00:15
895000 -- (-895.057) (-896.488) [-891.684] (-893.839) * (-896.997) [-888.382] (-894.624) (-893.482) -- 0:00:15
Average standard deviation of split frequencies: 0.002631
895500 -- (-894.532) [-891.664] (-892.221) (-889.578) * (-897.782) [-892.184] (-891.052) (-887.403) -- 0:00:14
896000 -- [-891.499] (-891.628) (-893.534) (-893.327) * (-888.893) (-890.463) (-890.240) [-890.266] -- 0:00:14
896500 -- (-892.964) [-892.763] (-898.268) (-891.983) * (-892.823) (-896.075) (-890.643) [-890.826] -- 0:00:14
897000 -- [-892.398] (-896.015) (-894.054) (-889.337) * (-894.356) (-893.533) (-895.448) [-893.049] -- 0:00:14
897500 -- [-888.386] (-891.181) (-897.735) (-887.756) * [-894.223] (-894.128) (-888.784) (-893.904) -- 0:00:14
898000 -- (-889.276) [-892.124] (-894.737) (-900.916) * (-890.649) [-890.399] (-891.998) (-900.759) -- 0:00:14
898500 -- [-890.249] (-894.873) (-887.739) (-894.909) * [-890.192] (-894.724) (-892.486) (-895.089) -- 0:00:14
899000 -- (-888.571) [-889.147] (-892.225) (-892.568) * (-894.203) (-891.329) [-898.562] (-891.926) -- 0:00:14
899500 -- (-889.722) (-891.459) (-890.649) [-891.186] * (-892.997) (-891.968) (-894.997) [-892.562] -- 0:00:14
900000 -- (-898.682) (-888.080) [-891.543] (-894.314) * (-895.540) [-893.437] (-892.636) (-897.731) -- 0:00:14
Average standard deviation of split frequencies: 0.002094
900500 -- (-891.664) (-891.416) (-887.795) [-898.117] * [-890.152] (-896.914) (-894.552) (-904.697) -- 0:00:14
901000 -- [-888.996] (-893.926) (-892.300) (-893.143) * (-889.824) (-890.622) [-901.004] (-891.047) -- 0:00:14
901500 -- [-889.504] (-893.478) (-899.004) (-894.499) * (-891.598) (-892.632) (-894.458) [-892.127] -- 0:00:14
902000 -- (-891.887) (-894.623) (-894.531) [-891.148] * (-888.851) [-895.095] (-894.761) (-891.577) -- 0:00:14
902500 -- (-892.309) [-892.945] (-898.137) (-891.599) * [-893.922] (-891.758) (-895.393) (-889.022) -- 0:00:13
903000 -- (-891.455) (-889.958) (-893.137) [-888.907] * (-895.970) [-894.342] (-891.142) (-895.189) -- 0:00:13
903500 -- (-894.351) (-894.048) [-890.572] (-893.226) * (-896.646) [-891.099] (-898.398) (-891.519) -- 0:00:13
904000 -- (-896.640) (-891.564) [-888.861] (-890.219) * [-892.574] (-890.909) (-891.599) (-891.233) -- 0:00:13
904500 -- (-895.801) (-895.077) (-891.121) [-889.732] * (-891.978) (-893.637) (-890.294) [-888.245] -- 0:00:13
905000 -- [-891.873] (-896.844) (-888.961) (-894.286) * (-891.662) (-898.087) (-891.945) [-891.830] -- 0:00:13
Average standard deviation of split frequencies: 0.002081
905500 -- (-894.034) (-891.219) (-889.101) [-892.408] * [-892.699] (-896.527) (-890.411) (-894.254) -- 0:00:13
906000 -- (-894.107) [-886.916] (-889.088) (-900.494) * (-893.434) (-892.210) (-891.384) [-890.855] -- 0:00:13
906500 -- (-890.834) (-890.878) [-888.949] (-891.890) * (-890.023) (-891.661) [-890.831] (-892.114) -- 0:00:13
907000 -- [-897.581] (-891.485) (-890.777) (-896.808) * (-890.990) (-888.224) [-891.235] (-893.341) -- 0:00:13
907500 -- (-895.479) (-891.197) [-892.010] (-893.591) * [-890.164] (-894.827) (-900.234) (-894.174) -- 0:00:13
908000 -- (-890.117) (-890.392) (-895.163) [-891.860] * (-891.436) (-890.809) (-894.044) [-893.360] -- 0:00:13
908500 -- (-888.332) (-899.546) [-890.858] (-894.893) * [-893.899] (-894.492) (-890.344) (-895.866) -- 0:00:13
909000 -- [-887.917] (-894.702) (-890.585) (-891.419) * (-893.554) (-888.280) [-891.688] (-896.019) -- 0:00:13
909500 -- (-890.932) (-890.474) [-894.202] (-891.812) * (-890.675) (-890.352) [-890.660] (-890.790) -- 0:00:12
910000 -- (-896.867) (-894.428) (-894.485) [-892.547] * (-891.870) [-891.176] (-898.250) (-891.741) -- 0:00:12
Average standard deviation of split frequencies: 0.003106
910500 -- (-897.761) (-889.073) [-892.277] (-897.215) * [-891.212] (-897.403) (-898.833) (-890.285) -- 0:00:12
911000 -- (-893.566) [-888.074] (-894.615) (-896.188) * (-889.096) (-894.250) (-892.769) [-891.928] -- 0:00:12
911500 -- [-891.506] (-892.267) (-894.139) (-894.702) * (-888.718) [-892.053] (-890.084) (-892.567) -- 0:00:12
912000 -- [-886.370] (-893.086) (-898.012) (-895.347) * (-890.329) (-892.136) [-888.461] (-891.013) -- 0:00:12
912500 -- (-890.571) (-891.191) (-896.905) [-890.445] * [-894.544] (-888.677) (-893.366) (-895.165) -- 0:00:12
913000 -- (-891.629) [-889.798] (-887.759) (-896.540) * (-894.308) [-888.950] (-893.775) (-889.548) -- 0:00:12
913500 -- (-892.139) (-896.133) [-890.782] (-895.631) * (-895.147) (-891.738) (-890.894) [-892.826] -- 0:00:12
914000 -- (-898.576) [-888.890] (-897.242) (-894.632) * (-896.447) (-890.469) (-894.932) [-889.871] -- 0:00:12
914500 -- (-896.329) [-892.671] (-897.900) (-892.492) * [-893.761] (-892.581) (-889.672) (-890.200) -- 0:00:12
915000 -- (-896.326) [-891.345] (-898.589) (-893.682) * [-896.044] (-890.692) (-893.129) (-895.393) -- 0:00:12
Average standard deviation of split frequencies: 0.004117
915500 -- [-897.366] (-889.080) (-899.169) (-892.607) * (-890.392) [-891.916] (-894.049) (-889.947) -- 0:00:12
916000 -- (-897.796) [-891.512] (-900.040) (-895.441) * (-891.076) [-889.065] (-897.913) (-892.187) -- 0:00:12
916500 -- [-890.843] (-896.185) (-893.947) (-891.207) * (-893.836) [-890.482] (-891.655) (-890.726) -- 0:00:11
917000 -- (-893.340) (-894.083) (-894.345) [-891.095] * [-890.580] (-890.705) (-889.137) (-890.940) -- 0:00:11
917500 -- (-890.989) (-888.803) [-896.466] (-891.574) * (-895.146) [-888.722] (-890.973) (-892.314) -- 0:00:11
918000 -- (-894.943) [-892.847] (-895.234) (-895.993) * (-896.737) (-896.529) (-892.088) [-888.473] -- 0:00:11
918500 -- (-890.191) (-890.536) [-891.765] (-898.537) * (-888.895) [-893.114] (-890.206) (-889.068) -- 0:00:11
919000 -- (-899.572) (-888.437) [-891.145] (-895.426) * [-889.446] (-894.842) (-895.944) (-891.376) -- 0:00:11
919500 -- (-898.637) (-890.009) [-897.001] (-893.256) * [-892.839] (-900.330) (-899.413) (-892.179) -- 0:00:11
920000 -- (-891.966) (-897.984) [-887.567] (-893.823) * (-893.611) (-893.269) (-895.335) [-895.786] -- 0:00:11
Average standard deviation of split frequencies: 0.004608
920500 -- [-889.060] (-891.616) (-892.598) (-897.907) * (-893.347) (-890.952) (-894.308) [-891.319] -- 0:00:11
921000 -- (-891.217) (-889.743) [-888.456] (-893.816) * (-892.636) (-896.076) [-893.345] (-893.344) -- 0:00:11
921500 -- (-894.145) (-889.491) (-893.137) [-890.862] * (-890.287) (-893.130) [-894.529] (-897.487) -- 0:00:11
922000 -- (-894.362) [-892.393] (-891.812) (-886.474) * (-890.943) (-892.006) [-892.238] (-898.187) -- 0:00:11
922500 -- (-891.473) (-895.094) [-892.515] (-893.613) * [-893.199] (-893.689) (-897.059) (-893.523) -- 0:00:11
923000 -- (-891.788) (-892.143) [-888.561] (-892.402) * (-895.826) (-894.438) [-890.427] (-894.861) -- 0:00:11
923500 -- (-889.121) (-892.869) [-890.936] (-892.298) * (-892.256) (-893.501) (-891.134) [-894.258] -- 0:00:10
924000 -- (-890.261) [-889.871] (-891.191) (-891.825) * [-892.085] (-890.403) (-888.929) (-895.725) -- 0:00:10
924500 -- (-894.518) [-892.004] (-892.989) (-891.417) * (-894.746) [-892.467] (-894.125) (-891.761) -- 0:00:10
925000 -- [-889.837] (-890.571) (-897.041) (-891.035) * (-889.250) (-890.795) [-891.828] (-888.720) -- 0:00:10
Average standard deviation of split frequencies: 0.004073
925500 -- (-888.512) [-889.794] (-892.120) (-894.338) * (-892.681) (-890.073) (-889.565) [-892.422] -- 0:00:10
926000 -- (-890.026) [-889.920] (-895.722) (-890.538) * (-897.234) [-892.900] (-895.784) (-895.937) -- 0:00:10
926500 -- (-892.554) [-892.127] (-889.857) (-890.021) * [-895.135] (-903.447) (-895.689) (-890.357) -- 0:00:10
927000 -- (-895.144) (-892.730) (-897.392) [-889.811] * (-890.243) (-893.542) (-895.661) [-896.002] -- 0:00:10
927500 -- [-889.132] (-892.376) (-889.144) (-891.030) * [-888.428] (-889.420) (-891.202) (-891.977) -- 0:00:10
928000 -- (-891.526) (-889.679) (-891.429) [-888.614] * (-892.387) [-888.383] (-893.052) (-898.250) -- 0:00:10
928500 -- (-889.673) (-889.586) [-890.284] (-892.726) * [-888.076] (-892.849) (-894.364) (-897.893) -- 0:00:10
929000 -- (-893.560) (-895.367) (-893.619) [-891.403] * [-892.474] (-898.037) (-892.418) (-897.657) -- 0:00:10
929500 -- (-891.166) (-891.847) (-895.689) [-887.428] * [-888.356] (-899.032) (-889.667) (-895.436) -- 0:00:10
930000 -- (-889.719) (-894.923) [-890.816] (-890.423) * (-895.029) [-893.023] (-889.457) (-893.238) -- 0:00:10
Average standard deviation of split frequencies: 0.004052
930500 -- (-892.538) (-898.093) (-890.850) [-889.137] * (-895.357) (-899.351) [-892.816] (-895.098) -- 0:00:09
931000 -- (-893.420) (-897.626) (-893.988) [-889.692] * [-892.529] (-895.966) (-895.892) (-895.908) -- 0:00:09
931500 -- (-895.371) (-894.766) (-892.533) [-890.733] * (-893.602) [-893.392] (-888.988) (-889.856) -- 0:00:09
932000 -- (-892.186) [-891.991] (-889.350) (-892.520) * [-892.255] (-897.420) (-893.453) (-890.558) -- 0:00:09
932500 -- (-897.745) (-887.577) (-893.969) [-897.669] * (-892.961) [-890.014] (-891.927) (-891.407) -- 0:00:09
933000 -- (-892.842) [-890.141] (-889.845) (-894.850) * (-890.934) [-892.857] (-890.842) (-890.540) -- 0:00:09
933500 -- [-890.649] (-890.736) (-892.017) (-892.355) * (-901.390) [-891.903] (-891.985) (-888.338) -- 0:00:09
934000 -- [-890.617] (-893.214) (-890.201) (-893.177) * (-898.485) (-891.329) [-888.715] (-887.885) -- 0:00:09
934500 -- [-894.243] (-894.022) (-892.884) (-893.642) * (-890.664) [-889.170] (-893.445) (-894.284) -- 0:00:09
935000 -- [-890.156] (-896.989) (-890.118) (-892.660) * (-892.431) [-894.654] (-893.111) (-896.175) -- 0:00:09
Average standard deviation of split frequencies: 0.004029
935500 -- [-888.612] (-895.283) (-892.150) (-890.789) * (-894.984) [-892.180] (-897.458) (-893.356) -- 0:00:09
936000 -- [-891.439] (-892.339) (-899.524) (-890.829) * (-895.104) [-890.827] (-896.303) (-896.974) -- 0:00:09
936500 -- [-889.606] (-891.270) (-890.844) (-892.958) * (-896.692) [-895.143] (-892.725) (-897.329) -- 0:00:09
937000 -- (-890.305) (-889.099) (-897.701) [-890.032] * (-896.959) [-890.511] (-890.269) (-892.799) -- 0:00:09
937500 -- (-889.424) (-893.918) [-892.929] (-890.188) * (-895.191) [-891.973] (-897.376) (-893.355) -- 0:00:08
938000 -- (-895.493) (-890.514) [-889.117] (-889.873) * (-890.185) [-895.249] (-895.918) (-892.078) -- 0:00:08
938500 -- (-891.312) (-893.870) [-893.471] (-892.508) * (-894.530) (-890.058) (-892.356) [-890.689] -- 0:00:08
939000 -- (-893.025) (-889.872) (-891.377) [-891.973] * (-894.262) [-893.410] (-891.713) (-887.789) -- 0:00:08
939500 -- (-892.185) [-890.790] (-892.149) (-890.874) * [-891.958] (-889.659) (-898.455) (-893.541) -- 0:00:08
940000 -- (-897.772) [-894.464] (-890.399) (-892.868) * (-895.823) [-891.229] (-893.955) (-892.910) -- 0:00:08
Average standard deviation of split frequencies: 0.004009
940500 -- (-888.893) (-895.073) (-902.837) [-894.114] * (-900.700) (-887.680) [-895.441] (-894.836) -- 0:00:08
941000 -- [-887.493] (-892.955) (-893.011) (-894.693) * [-890.139] (-896.508) (-889.436) (-891.439) -- 0:00:08
941500 -- (-888.704) (-888.356) (-892.000) [-891.913] * (-888.690) (-896.567) (-893.235) [-890.630] -- 0:00:08
942000 -- (-895.719) (-889.354) (-890.796) [-888.706] * (-892.454) (-891.897) [-894.759] (-893.055) -- 0:00:08
942500 -- (-900.007) [-892.180] (-887.336) (-893.337) * (-893.574) (-889.953) (-891.422) [-890.761] -- 0:00:08
943000 -- [-894.855] (-889.308) (-891.586) (-897.060) * (-893.446) (-888.602) [-892.936] (-889.957) -- 0:00:08
943500 -- (-893.114) (-889.807) (-893.922) [-888.910] * [-890.212] (-894.964) (-900.596) (-893.355) -- 0:00:08
944000 -- (-891.023) (-887.857) [-894.651] (-890.215) * (-890.241) (-893.917) (-894.372) [-891.993] -- 0:00:08
944500 -- (-893.964) (-890.912) [-891.157] (-892.599) * [-889.075] (-898.172) (-891.489) (-897.827) -- 0:00:07
945000 -- (-894.903) [-889.117] (-895.076) (-890.770) * (-894.173) (-889.844) [-894.525] (-893.446) -- 0:00:07
Average standard deviation of split frequencies: 0.003987
945500 -- (-888.991) [-890.004] (-890.001) (-894.148) * (-898.664) (-890.737) (-894.121) [-895.633] -- 0:00:07
946000 -- [-891.500] (-889.841) (-889.799) (-892.253) * (-901.148) (-890.161) [-890.571] (-891.055) -- 0:00:07
946500 -- (-898.963) (-893.350) [-897.223] (-896.410) * (-894.660) (-894.897) (-889.595) [-892.829] -- 0:00:07
947000 -- (-893.064) (-889.206) (-892.318) [-892.418] * (-890.114) [-889.685] (-892.603) (-894.881) -- 0:00:07
947500 -- (-892.995) [-889.145] (-888.071) (-897.774) * (-895.666) (-890.095) [-893.561] (-892.224) -- 0:00:07
948000 -- [-892.104] (-897.881) (-896.628) (-894.959) * (-890.287) [-893.811] (-894.391) (-891.691) -- 0:00:07
948500 -- (-893.594) (-894.776) [-897.849] (-892.403) * (-888.243) (-890.533) (-891.848) [-891.200] -- 0:00:07
949000 -- [-888.501] (-892.575) (-893.172) (-891.950) * (-891.162) (-894.861) (-889.012) [-887.969] -- 0:00:07
949500 -- (-892.595) [-896.303] (-897.175) (-889.958) * (-898.316) [-893.740] (-892.352) (-889.730) -- 0:00:07
950000 -- (-895.990) [-892.055] (-890.400) (-891.340) * (-892.466) (-901.209) [-888.441] (-890.953) -- 0:00:07
Average standard deviation of split frequencies: 0.003967
950500 -- (-895.729) (-890.166) (-899.545) [-891.149] * (-893.085) [-887.979] (-894.604) (-891.841) -- 0:00:07
951000 -- [-890.145] (-889.401) (-895.335) (-890.294) * [-892.049] (-887.824) (-889.332) (-890.827) -- 0:00:07
951500 -- (-896.869) (-891.704) [-891.049] (-894.620) * (-889.469) (-891.399) [-897.412] (-891.490) -- 0:00:06
952000 -- (-897.399) (-897.131) (-892.422) [-889.811] * (-890.510) [-893.749] (-896.586) (-891.734) -- 0:00:06
952500 -- (-898.244) (-890.982) [-890.203] (-889.670) * [-893.047] (-891.153) (-888.581) (-897.915) -- 0:00:06
953000 -- (-889.296) [-893.987] (-891.565) (-895.061) * (-894.284) (-892.991) [-889.733] (-893.112) -- 0:00:06
953500 -- (-891.388) (-893.171) (-898.599) [-890.189] * [-894.621] (-888.682) (-893.884) (-889.262) -- 0:00:06
954000 -- [-889.353] (-891.786) (-894.248) (-900.894) * (-890.892) [-890.590] (-895.533) (-890.101) -- 0:00:06
954500 -- (-892.995) (-892.991) (-889.964) [-895.533] * (-894.559) (-887.516) [-889.292] (-892.558) -- 0:00:06
955000 -- (-890.489) (-890.188) (-890.428) [-894.038] * (-893.491) [-889.287] (-890.304) (-891.680) -- 0:00:06
Average standard deviation of split frequencies: 0.004931
955500 -- (-894.179) [-888.681] (-899.220) (-893.659) * [-892.640] (-893.610) (-890.587) (-897.967) -- 0:00:06
956000 -- (-888.508) (-889.165) (-894.433) [-892.264] * (-892.923) (-888.697) [-889.363] (-892.036) -- 0:00:06
956500 -- (-890.171) [-893.261] (-893.976) (-889.271) * [-889.783] (-891.987) (-898.105) (-893.857) -- 0:00:06
957000 -- [-894.083] (-892.568) (-891.832) (-892.001) * (-890.210) (-895.902) (-893.952) [-893.402] -- 0:00:06
957500 -- (-888.421) (-891.782) [-893.605] (-890.196) * (-896.209) (-891.506) [-888.102] (-895.138) -- 0:00:06
958000 -- (-894.861) [-891.120] (-893.715) (-898.753) * [-890.456] (-893.124) (-889.950) (-892.413) -- 0:00:06
958500 -- [-890.556] (-894.770) (-887.367) (-894.935) * [-895.442] (-895.769) (-900.684) (-891.565) -- 0:00:05
959000 -- [-892.614] (-891.719) (-891.221) (-895.849) * [-895.094] (-889.730) (-889.151) (-894.319) -- 0:00:05
959500 -- (-894.326) (-888.817) [-890.637] (-897.039) * [-889.626] (-896.906) (-895.185) (-892.795) -- 0:00:05
960000 -- (-896.293) (-890.420) (-895.755) [-891.115] * (-896.144) (-895.030) [-890.568] (-889.610) -- 0:00:05
Average standard deviation of split frequencies: 0.004416
960500 -- (-891.728) (-893.033) [-893.087] (-891.989) * (-895.449) (-895.182) (-887.334) [-895.493] -- 0:00:05
961000 -- [-902.521] (-890.498) (-899.391) (-893.584) * [-896.615] (-899.872) (-889.261) (-894.279) -- 0:00:05
961500 -- (-889.940) (-888.771) (-899.561) [-891.195] * (-893.662) (-893.770) [-889.748] (-891.593) -- 0:00:05
962000 -- (-892.965) [-892.414] (-895.556) (-893.130) * (-891.108) (-890.621) (-897.413) [-888.107] -- 0:00:05
962500 -- (-892.976) [-889.246] (-894.984) (-897.862) * (-894.284) [-889.156] (-892.734) (-889.325) -- 0:00:05
963000 -- (-892.526) [-891.052] (-890.140) (-890.670) * (-895.507) (-888.810) [-891.675] (-893.259) -- 0:00:05
963500 -- [-888.979] (-894.018) (-889.408) (-898.305) * (-894.990) [-891.090] (-896.486) (-890.525) -- 0:00:05
964000 -- (-889.970) [-890.551] (-890.358) (-896.740) * [-891.077] (-888.244) (-899.043) (-893.964) -- 0:00:05
964500 -- (-889.671) (-890.953) [-890.880] (-890.242) * (-900.053) [-890.087] (-889.783) (-892.909) -- 0:00:05
965000 -- (-893.334) (-888.199) [-899.226] (-889.230) * (-898.429) [-890.708] (-892.950) (-892.749) -- 0:00:05
Average standard deviation of split frequencies: 0.003904
965500 -- (-892.781) [-891.705] (-890.529) (-896.977) * (-891.443) [-891.748] (-893.310) (-889.569) -- 0:00:04
966000 -- (-889.702) [-891.027] (-889.587) (-889.989) * (-894.025) [-892.868] (-897.315) (-893.633) -- 0:00:04
966500 -- (-895.341) [-892.245] (-895.176) (-889.009) * [-893.766] (-892.055) (-893.015) (-892.903) -- 0:00:04
967000 -- (-888.413) (-892.408) [-887.743] (-889.199) * (-894.363) [-890.437] (-891.754) (-897.028) -- 0:00:04
967500 -- (-892.494) (-897.621) [-891.799] (-893.118) * (-888.947) [-895.200] (-890.466) (-894.424) -- 0:00:04
968000 -- (-891.647) [-887.410] (-893.239) (-896.635) * [-892.492] (-900.733) (-891.890) (-896.168) -- 0:00:04
968500 -- [-893.730] (-890.102) (-888.673) (-895.469) * [-890.074] (-894.870) (-892.343) (-891.876) -- 0:00:04
969000 -- (-894.408) (-894.108) (-892.737) [-888.264] * (-894.252) [-890.364] (-893.184) (-889.211) -- 0:00:04
969500 -- (-896.140) (-897.819) (-893.343) [-891.798] * [-896.058] (-894.633) (-887.441) (-889.551) -- 0:00:04
970000 -- (-891.655) (-900.096) [-889.971] (-896.146) * (-899.899) [-889.812] (-896.543) (-893.840) -- 0:00:04
Average standard deviation of split frequencies: 0.002914
970500 -- (-888.711) (-897.789) (-891.384) [-888.284] * (-892.543) (-891.721) (-891.183) [-888.313] -- 0:00:04
971000 -- [-888.437] (-896.772) (-892.792) (-889.828) * (-896.637) (-890.870) [-893.002] (-891.412) -- 0:00:04
971500 -- (-890.300) (-891.931) [-891.046] (-886.469) * [-892.877] (-893.071) (-895.261) (-897.026) -- 0:00:04
972000 -- (-891.951) (-897.249) (-892.396) [-887.403] * (-891.429) [-891.850] (-894.069) (-890.782) -- 0:00:04
972500 -- (-893.687) (-898.810) (-891.172) [-893.619] * [-894.145] (-901.589) (-897.538) (-891.258) -- 0:00:03
973000 -- (-896.571) (-891.967) (-894.406) [-888.992] * (-892.021) [-892.685] (-893.724) (-890.973) -- 0:00:03
973500 -- (-893.578) [-889.889] (-900.079) (-892.147) * (-893.179) (-891.977) [-891.962] (-892.042) -- 0:00:03
974000 -- [-893.915] (-894.558) (-891.042) (-887.780) * (-900.624) (-890.732) (-899.477) [-890.751] -- 0:00:03
974500 -- (-900.584) (-889.929) (-891.059) [-888.296] * [-893.803] (-896.514) (-897.202) (-890.338) -- 0:00:03
975000 -- (-903.724) [-892.711] (-892.180) (-894.552) * (-893.676) (-898.952) [-897.103] (-896.586) -- 0:00:03
Average standard deviation of split frequencies: 0.002898
975500 -- (-899.446) (-893.383) [-891.924] (-891.898) * (-894.757) (-894.026) (-895.400) [-890.302] -- 0:00:03
976000 -- (-891.755) (-897.238) (-889.431) [-891.724] * (-893.129) (-901.859) (-897.754) [-890.227] -- 0:00:03
976500 -- [-889.859] (-894.771) (-892.334) (-892.259) * (-891.538) (-890.418) [-890.114] (-892.402) -- 0:00:03
977000 -- (-888.455) (-893.220) (-889.055) [-888.391] * (-892.175) (-891.507) (-893.316) [-893.076] -- 0:00:03
977500 -- [-889.306] (-899.711) (-893.142) (-892.789) * (-892.234) [-894.938] (-890.552) (-897.195) -- 0:00:03
978000 -- [-893.628] (-897.156) (-893.542) (-889.803) * (-893.999) [-904.463] (-898.938) (-890.834) -- 0:00:03
978500 -- [-894.840] (-892.888) (-890.171) (-890.267) * [-891.612] (-899.893) (-893.359) (-893.487) -- 0:00:03
979000 -- (-895.038) (-892.914) (-891.510) [-889.727] * [-891.137] (-899.430) (-890.964) (-893.364) -- 0:00:03
979500 -- (-895.088) [-889.271] (-892.538) (-893.840) * [-890.775] (-889.057) (-893.090) (-900.557) -- 0:00:02
980000 -- [-890.783] (-888.364) (-892.647) (-890.720) * [-892.484] (-897.268) (-890.830) (-894.158) -- 0:00:02
Average standard deviation of split frequencies: 0.002884
980500 -- [-891.353] (-889.444) (-890.080) (-890.371) * (-892.747) [-888.440] (-892.851) (-893.366) -- 0:00:02
981000 -- (-896.280) [-890.694] (-891.732) (-891.226) * (-892.315) [-889.365] (-891.574) (-889.591) -- 0:00:02
981500 -- (-894.021) (-894.846) [-890.284] (-887.805) * (-890.967) (-892.715) [-891.928] (-892.161) -- 0:00:02
982000 -- [-893.269] (-893.967) (-895.985) (-889.674) * (-892.115) [-890.065] (-890.685) (-897.359) -- 0:00:02
982500 -- (-895.762) (-894.332) (-892.644) [-892.109] * [-891.122] (-889.563) (-896.261) (-891.408) -- 0:00:02
983000 -- (-891.016) [-893.720] (-898.257) (-889.071) * (-890.634) (-891.191) (-891.601) [-891.366] -- 0:00:02
983500 -- (-894.331) (-888.256) (-893.438) [-898.605] * (-889.531) (-890.248) (-895.679) [-893.173] -- 0:00:02
984000 -- (-893.573) (-890.491) (-887.463) [-889.274] * [-894.939] (-888.584) (-898.308) (-895.727) -- 0:00:02
984500 -- [-888.938] (-893.429) (-892.935) (-894.514) * (-888.194) (-889.941) [-889.214] (-895.772) -- 0:00:02
985000 -- (-891.126) (-890.557) (-890.299) [-891.832] * (-899.232) (-891.666) [-889.283] (-892.324) -- 0:00:02
Average standard deviation of split frequencies: 0.002869
985500 -- [-893.279] (-889.510) (-894.052) (-888.438) * (-892.938) (-889.819) [-892.706] (-892.646) -- 0:00:02
986000 -- (-891.823) (-891.394) (-890.708) [-889.504] * (-890.812) (-895.670) (-891.531) [-888.675] -- 0:00:02
986500 -- (-888.318) (-896.465) [-889.365] (-891.206) * (-892.905) [-894.073] (-889.901) (-887.181) -- 0:00:01
987000 -- [-890.913] (-887.316) (-895.860) (-892.106) * (-892.507) [-892.032] (-891.751) (-893.615) -- 0:00:01
987500 -- (-892.091) (-892.111) (-894.775) [-892.824] * [-893.311] (-898.469) (-889.429) (-891.536) -- 0:00:01
988000 -- [-893.136] (-891.951) (-899.204) (-893.968) * (-888.944) (-900.156) [-890.931] (-891.652) -- 0:00:01
988500 -- (-896.363) (-887.859) [-891.784] (-903.366) * (-888.082) (-892.599) (-890.948) [-893.534] -- 0:00:01
989000 -- (-889.861) [-891.673] (-893.989) (-892.481) * (-888.813) [-892.025] (-886.665) (-896.720) -- 0:00:01
989500 -- (-888.806) [-890.410] (-895.294) (-888.850) * (-896.094) (-888.744) [-894.173] (-902.335) -- 0:00:01
990000 -- [-890.539] (-889.073) (-893.634) (-893.498) * (-894.869) [-890.212] (-893.220) (-892.801) -- 0:00:01
Average standard deviation of split frequencies: 0.003331
990500 -- (-891.856) (-893.181) [-890.394] (-888.809) * (-894.668) (-890.303) [-891.193] (-897.164) -- 0:00:01
991000 -- (-896.677) (-897.364) [-895.824] (-894.104) * (-890.694) (-895.660) [-890.106] (-890.999) -- 0:00:01
991500 -- [-891.380] (-896.831) (-892.965) (-894.305) * (-896.978) (-891.566) [-889.651] (-888.048) -- 0:00:01
992000 -- (-892.838) (-892.731) (-889.863) [-890.596] * (-890.395) [-891.678] (-891.536) (-893.506) -- 0:00:01
992500 -- [-891.532] (-890.961) (-893.189) (-895.599) * (-893.431) (-888.969) (-895.627) [-890.830] -- 0:00:01
993000 -- (-890.799) [-887.912] (-891.994) (-891.154) * (-889.866) (-895.474) (-890.761) [-890.117] -- 0:00:01
993500 -- (-892.095) (-898.830) (-893.113) [-893.869] * (-890.463) (-894.794) [-890.825] (-895.795) -- 0:00:00
994000 -- (-893.993) [-893.549] (-889.415) (-900.530) * (-895.768) (-888.037) (-893.338) [-897.594] -- 0:00:00
994500 -- (-889.646) (-890.407) (-891.295) [-900.023] * (-889.272) [-891.166] (-888.964) (-891.071) -- 0:00:00
995000 -- [-894.123] (-888.259) (-890.194) (-900.409) * [-891.736] (-891.584) (-894.640) (-894.526) -- 0:00:00
Average standard deviation of split frequencies: 0.003786
995500 -- (-892.545) (-892.430) (-892.798) [-894.132] * (-891.172) (-895.745) [-894.097] (-891.282) -- 0:00:00
996000 -- [-890.267] (-895.649) (-892.221) (-896.245) * [-892.121] (-893.620) (-889.099) (-894.867) -- 0:00:00
996500 -- (-894.034) (-893.164) [-890.577] (-894.208) * (-898.344) (-892.316) (-892.376) [-892.779] -- 0:00:00
997000 -- (-895.259) (-897.913) [-889.566] (-894.321) * [-894.571] (-888.899) (-895.389) (-889.419) -- 0:00:00
997500 -- (-893.818) [-886.846] (-891.746) (-892.612) * [-892.550] (-888.817) (-888.351) (-895.594) -- 0:00:00
998000 -- (-891.710) [-890.519] (-895.599) (-899.384) * (-891.661) [-888.294] (-891.999) (-894.103) -- 0:00:00
998500 -- (-890.319) [-888.375] (-894.178) (-895.719) * [-892.243] (-895.014) (-894.992) (-896.950) -- 0:00:00
999000 -- (-895.929) [-894.786] (-896.123) (-894.757) * [-894.061] (-893.290) (-894.517) (-893.298) -- 0:00:00
999500 -- (-896.694) [-895.691] (-895.753) (-891.803) * (-896.194) (-893.903) (-894.186) [-891.805] -- 0:00:00
1000000 -- (-890.852) (-891.066) (-892.648) [-898.292] * (-889.756) (-893.771) (-888.193) [-895.331] -- 0:00:00
Average standard deviation of split frequencies: 0.002827
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -890.851632 -- 10.840362
Chain 1 -- -890.851632 -- 10.840362
Chain 2 -- -891.066008 -- 12.892868
Chain 2 -- -891.066008 -- 12.892868
Chain 3 -- -892.648414 -- 11.106489
Chain 3 -- -892.648414 -- 11.106489
Chain 4 -- -898.291719 -- 12.488587
Chain 4 -- -898.291719 -- 12.488587
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -889.755832 -- 12.250880
Chain 1 -- -889.755832 -- 12.250880
Chain 2 -- -893.770506 -- 13.031470
Chain 2 -- -893.770506 -- 13.031470
Chain 3 -- -888.192769 -- 5.693924
Chain 3 -- -888.192769 -- 5.693924
Chain 4 -- -895.331365 -- 13.365909
Chain 4 -- -895.331365 -- 13.365909
Analysis completed in 2 mins 23 seconds
Analysis used 143.12 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -885.43
Likelihood of best state for "cold" chain of run 2 was -885.43
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.7 % ( 62 %) Dirichlet(Revmat{all})
78.4 % ( 59 %) Slider(Revmat{all})
30.5 % ( 29 %) Dirichlet(Pi{all})
31.0 % ( 26 %) Slider(Pi{all})
51.0 % ( 29 %) Multiplier(Alpha{1,2})
49.5 % ( 32 %) Multiplier(Alpha{3})
67.1 % ( 44 %) Slider(Pinvar{all})
7.1 % ( 6 %) NNI(Tau{all},V{all})
5.7 % ( 4 %) ParsSPR(Tau{all},V{all})
26.4 % ( 32 %) Multiplier(V{all})
37.2 % ( 41 %) Nodeslider(V{all})
26.1 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.7 % ( 61 %) Dirichlet(Revmat{all})
78.9 % ( 67 %) Slider(Revmat{all})
30.4 % ( 28 %) Dirichlet(Pi{all})
30.4 % ( 22 %) Slider(Pi{all})
51.1 % ( 24 %) Multiplier(Alpha{1,2})
49.8 % ( 27 %) Multiplier(Alpha{3})
66.4 % ( 52 %) Slider(Pinvar{all})
6.9 % ( 7 %) NNI(Tau{all},V{all})
5.5 % ( 3 %) ParsSPR(Tau{all},V{all})
26.3 % ( 24 %) Multiplier(V{all})
37.1 % ( 28 %) Nodeslider(V{all})
26.1 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166436 0.86 0.72
3 | 166868 166737 0.87
4 | 166253 166929 166777
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166519 0.85 0.73
3 | 167199 166365 0.87
4 | 166961 166471 166485
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -890.56
| 2 1 1 |
| 1 1 2 1 2 |
| 1 2 1 2 |
| 1 1 1 1 |
| 1 2 |
| 1 2 2 1 1 2 2 1 1 |
|1 2 1 2 2 2 2* 2 |
| * 2 1 2 2 2 1212 2 112 1 2 2 2 |
| 2 1 1 2 2 2121 2 |
|2 2 2 1 2 2 2 2 1 2 1 |
| 12 1 11 2 1 1 21 11121 1 12 1 2 21 22|
| 1 2 1 1 1|
| 1 2 22 1 2 1 1 |
| 2 2 1 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -892.82
^ 