--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 25 22:11:50 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/1/825-Oak-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -889.70 -897.64 2 -889.77 -897.94 -------------------------------------- TOTAL -889.74 -897.80 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.522852 0.020542 0.280878 0.803748 0.497287 787.91 1144.45 1.000 r(A<->C){all} 0.117885 0.005050 0.001770 0.257085 0.106542 560.09 568.91 1.001 r(A<->G){all} 0.212347 0.007059 0.059244 0.372296 0.205007 496.56 558.65 1.002 r(A<->T){all} 0.237229 0.007176 0.082699 0.399957 0.227723 783.27 809.42 1.002 r(C<->G){all} 0.128731 0.002684 0.044040 0.235406 0.121330 807.66 845.39 1.001 r(C<->T){all} 0.176114 0.003498 0.060535 0.285755 0.171138 747.84 807.13 1.000 r(G<->T){all} 0.127694 0.003661 0.019685 0.240768 0.119516 654.97 697.32 1.000 pi(A){all} 0.120025 0.000213 0.090364 0.147662 0.119679 1375.25 1395.52 1.000 pi(C){all} 0.365767 0.000461 0.325288 0.409917 0.365668 1293.21 1397.11 1.000 pi(G){all} 0.239168 0.000388 0.201284 0.278077 0.238387 1314.49 1321.00 1.000 pi(T){all} 0.275040 0.000406 0.236830 0.315056 0.274351 1274.11 1346.44 1.000 alpha{1,2} 0.203478 0.033950 0.000260 0.524118 0.160956 1094.65 1217.07 1.001 alpha{3} 0.906771 0.349609 0.137599 2.074984 0.748727 1246.15 1273.14 1.000 pinvar{all} 0.278017 0.027465 0.000033 0.566670 0.264733 756.55 978.69 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -776.102101 Model 2: PositiveSelection -771.423592 Model 0: one-ratio -786.152998 Model 3: discrete -771.423592 Model 7: beta -776.207867 Model 8: beta&w>1 -771.425925 Model 0 vs 1 20.101794000000154 Model 2 vs 1 9.357017999999925 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB) Pr(w>1) post mean +- SE for w 10 A 0.506 3.073 66 A 0.961* 5.722 68 P 0.990* 5.891 69 L 0.993** 5.907 73 V 0.999** 5.943 76 K 0.989* 5.883 77 Y 0.978* 5.821 78 A 0.985* 5.860 80 T 0.670 4.029 89 K 0.991** 5.895 90 A 0.970* 5.773 92 T 0.670 4.029 97 R 0.501 3.046 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB) Pr(w>1) post mean +- SE for w 66 A 0.791 5.415 +- 3.049 68 P 0.873 5.892 +- 2.795 69 L 0.915 6.176 +- 2.651 73 V 0.941 6.345 +- 2.530 76 K 0.882 5.967 +- 2.772 77 Y 0.822 5.569 +- 2.947 78 A 0.880 5.979 +- 2.796 80 T 0.542 3.742 +- 3.303 89 K 0.896 6.053 +- 2.722 90 A 0.784 5.315 +- 3.023 92 T 0.542 3.742 +- 3.303 Model 8 vs 7 9.563883999999916 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB) Pr(w>1) post mean +- SE for w 10 A 0.505 3.074 66 A 0.959* 5.713 68 P 0.989* 5.889 69 L 0.992** 5.906 73 V 0.999** 5.944 76 K 0.988* 5.881 77 Y 0.977* 5.816 78 A 0.984* 5.857 80 T 0.669 4.029 89 K 0.990** 5.894 90 A 0.968* 5.765 92 T 0.669 4.029 97 R 0.501 3.048 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB) Pr(w>1) post mean +- SE for w 66 A 0.864 5.566 +- 2.800 68 P 0.933 5.974 +- 2.516 69 L 0.956* 6.131 +- 2.415 73 V 0.976* 6.257 +- 2.305 76 K 0.936 6.002 +- 2.509 77 Y 0.895 5.728 +- 2.675 78 A 0.930 5.985 +- 2.544 80 T 0.618 3.981 +- 3.254 89 K 0.945 6.059 +- 2.467 90 A 0.867 5.540 +- 2.764 92 T 0.618 3.981 +- 3.254
>C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTA TSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAAT PLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo >C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI >C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI >C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYTAPAPVVTATSSQVIA RNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLAAPLAAPLAAPLAY SSPLAYSAPLSYAAAPAPLLIoooooooooooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=149 C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP *** ***.*.:*****************:***** :** C1 APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV C2 APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV C3 APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV C4 APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA **************************** * **. :* *:**:**:. C1 AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo-------- C2 AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI-------------- C3 AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI-------------- C4 AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo * *:*:** *********************:** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2488] Library Relaxation: Multi_proc [72] Relaxation Summary: [2488]--->[2229] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.208 Mb, Max= 30.411 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo-------- >C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI-------------- >C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI-------------- >C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo FORMAT of file /tmp/tmp1440418097538211609aln Not Supported[FATAL:T-COFFEE] >C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo-------- >C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI-------------- >C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI-------------- >C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:149 S:89 BS:149 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 95.35 C1 C2 95.35 TOP 1 0 95.35 C2 C1 95.35 BOT 0 2 95.35 C1 C3 95.35 TOP 2 0 95.35 C3 C1 95.35 BOT 0 3 81.89 C1 C4 81.89 TOP 3 0 81.89 C4 C1 81.89 BOT 1 2 97.04 C2 C3 97.04 TOP 2 1 97.04 C3 C2 97.04 BOT 1 3 81.82 C2 C4 81.82 TOP 3 1 81.82 C4 C2 81.82 BOT 2 3 82.64 C3 C4 82.64 TOP 3 2 82.64 C4 C3 82.64 AVG 0 C1 * 90.86 AVG 1 C2 * 91.40 AVG 2 C3 * 91.68 AVG 3 C4 * 82.12 TOT TOT * 89.01 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC C2 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC C3 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC C4 ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC **********.*** ** ** * ** * .******************* C1 CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT C2 CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT C3 CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT C4 CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT ********************* ** * ** ***:******* ******* C1 AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC C2 ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC C3 ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC C4 AC---------------------------------------ACTGCTCCT ** .******* C1 GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA C2 GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA C3 GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA C4 GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA *****************.************** *********** ***** C1 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG C2 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG C3 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG C4 TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG ***.************** ************** * ** ..: : ** * C1 CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG C2 CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG C3 CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG C4 CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT ** *: **** .. . ****.********.*******: *.* C1 GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC C2 GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC C3 GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC C4 GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC ** .. *** .***** *******:* **************** C1 TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC C2 ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC C3 ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC C4 GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC ***** *********************** *************** *** C1 TCATC------------------------------------------ C2 TCATC------------------------------------------ C3 TCATC------------------------------------------ C4 TCATC------------------------------------------ ***** >C1 ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC TCATC------------------------------------------ >C2 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC TCATC------------------------------------------ >C3 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC TCATC------------------------------------------ >C4 ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT AC---------------------------------------ACTGCTCCT GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC TCATC------------------------------------------ >C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYooooooSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI >C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI >C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI >C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYoooooooooooooTAP APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA APoLAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLI MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 447 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480111724 Setting output file names to "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 959365650 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9304270436 Seed = 1177419686 Swapseed = 1480111724 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 25 unique site patterns Division 2 has 19 unique site patterns Division 3 has 33 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1043.858344 -- -26.620141 Chain 2 -- -1043.106005 -- -26.620141 Chain 3 -- -1043.858344 -- -26.620141 Chain 4 -- -1043.106005 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1043.858344 -- -26.620141 Chain 2 -- -1043.106005 -- -26.620141 Chain 3 -- -1019.873051 -- -26.620141 Chain 4 -- -1043.106005 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1043.858] (-1043.106) (-1043.858) (-1043.106) * [-1043.858] (-1043.106) (-1019.873) (-1043.106) 500 -- (-911.357) [-908.058] (-905.959) (-907.199) * (-910.720) [-910.150] (-897.476) (-902.731) -- 0:00:00 1000 -- (-896.578) (-900.751) [-897.406] (-898.907) * (-901.378) (-908.613) (-892.982) [-892.962] -- 0:00:00 1500 -- [-890.704] (-894.488) (-898.893) (-890.291) * (-902.080) (-898.299) (-890.089) [-890.443] -- 0:00:00 2000 -- (-890.971) (-888.918) [-897.468] (-892.637) * (-896.904) [-889.807] (-889.236) (-892.706) -- 0:00:00 2500 -- (-892.157) [-895.701] (-894.155) (-892.364) * (-900.795) (-892.550) (-891.458) [-889.345] -- 0:00:00 3000 -- [-892.786] (-894.602) (-892.891) (-891.720) * (-901.307) (-894.178) (-892.664) [-893.636] -- 0:00:00 3500 -- (-892.934) (-890.036) (-890.542) [-889.764] * [-892.139] (-892.830) (-895.223) (-894.182) -- 0:04:44 4000 -- (-898.397) (-889.582) (-890.974) [-892.548] * (-891.026) (-890.961) [-892.130] (-891.889) -- 0:04:09 4500 -- [-895.615] (-892.791) (-895.937) (-896.387) * [-896.389] (-897.418) (-891.345) (-891.894) -- 0:03:41 5000 -- [-894.348] (-889.416) (-892.866) (-888.086) * (-892.021) (-891.916) (-891.237) [-895.462] -- 0:03:19 Average standard deviation of split frequencies: 0.078567 5500 -- [-891.318] (-895.283) (-890.305) (-890.195) * (-889.502) (-893.491) (-890.971) [-891.820] -- 0:03:00 6000 -- [-889.577] (-892.156) (-889.913) (-892.791) * (-888.274) (-896.298) [-896.062] (-892.399) -- 0:02:45 6500 -- (-887.814) (-891.665) [-894.818] (-897.383) * (-891.952) [-896.695] (-894.613) (-890.999) -- 0:02:32 7000 -- (-890.824) (-892.247) (-898.357) [-899.606] * [-890.587] (-899.053) (-891.022) (-891.708) -- 0:02:21 7500 -- (-894.104) (-891.395) [-889.663] (-904.184) * (-892.418) (-893.019) (-888.502) [-895.467] -- 0:02:12 8000 -- (-895.381) (-897.562) [-892.908] (-894.485) * (-899.617) [-892.987] (-889.980) (-901.577) -- 0:02:04 8500 -- [-897.337] (-892.526) (-894.785) (-898.871) * (-891.703) [-893.728] (-894.007) (-894.384) -- 0:01:56 9000 -- (-891.434) (-893.522) [-891.482] (-891.126) * [-891.519] (-890.032) (-891.251) (-896.333) -- 0:01:50 9500 -- (-891.051) (-893.722) [-893.971] (-893.527) * [-891.926] (-894.590) (-894.093) (-892.695) -- 0:01:44 10000 -- [-892.692] (-890.891) (-894.602) (-893.562) * [-891.633] (-896.424) (-898.231) (-893.029) -- 0:01:39 Average standard deviation of split frequencies: 0.044194 10500 -- [-894.048] (-895.332) (-892.699) (-893.792) * (-893.717) (-893.584) [-890.432] (-891.463) -- 0:01:34 11000 -- (-889.215) [-890.292] (-900.933) (-891.019) * (-888.386) (-889.702) (-897.953) [-888.114] -- 0:02:59 11500 -- (-888.921) (-896.219) [-894.354] (-894.815) * (-892.675) [-891.788] (-894.736) (-890.141) -- 0:02:51 12000 -- [-889.862] (-887.547) (-895.801) (-893.636) * [-892.173] (-892.107) (-891.978) (-897.445) -- 0:02:44 12500 -- (-892.692) (-895.395) [-890.765] (-894.551) * (-890.289) [-890.039] (-892.499) (-891.628) -- 0:02:38 13000 -- [-893.417] (-896.011) (-891.345) (-889.126) * (-889.192) (-890.758) [-891.690] (-893.349) -- 0:02:31 13500 -- (-895.722) (-891.209) [-889.764] (-893.722) * (-887.430) (-892.053) [-888.004] (-891.277) -- 0:02:26 14000 -- [-891.161] (-889.666) (-894.307) (-901.781) * (-897.946) [-902.908] (-888.032) (-888.878) -- 0:02:20 14500 -- (-895.416) [-889.290] (-892.154) (-891.784) * (-892.799) (-890.684) [-888.877] (-897.015) -- 0:02:15 15000 -- (-890.522) [-890.177] (-896.567) (-892.785) * (-890.159) (-894.592) [-892.394] (-896.592) -- 0:02:11 Average standard deviation of split frequencies: 0.058926 15500 -- [-892.297] (-892.048) (-895.976) (-897.439) * (-891.362) (-892.485) [-888.981] (-894.792) -- 0:02:07 16000 -- (-887.316) (-899.658) [-894.445] (-898.821) * (-889.245) (-897.817) [-888.548] (-892.301) -- 0:02:03 16500 -- [-888.980] (-896.040) (-894.961) (-892.465) * [-893.725] (-894.395) (-889.612) (-891.508) -- 0:01:59 17000 -- [-890.981] (-893.134) (-891.751) (-891.346) * (-893.780) [-891.471] (-895.008) (-890.625) -- 0:01:55 17500 -- (-892.453) (-895.765) (-895.004) [-891.371] * [-891.306] (-890.533) (-891.872) (-891.168) -- 0:01:52 18000 -- (-889.243) [-892.396] (-896.469) (-889.174) * [-892.944] (-891.752) (-893.424) (-891.861) -- 0:02:43 18500 -- (-891.376) (-893.329) (-893.598) [-891.190] * [-890.936] (-888.470) (-892.966) (-899.232) -- 0:02:39 19000 -- (-890.975) (-892.056) (-898.671) [-888.841] * (-892.759) [-888.386] (-890.186) (-891.322) -- 0:02:34 19500 -- (-891.928) (-894.977) (-898.003) [-893.687] * (-889.089) [-894.689] (-897.748) (-890.903) -- 0:02:30 20000 -- (-890.813) (-896.343) (-893.456) [-891.331] * (-892.647) (-896.062) (-889.503) [-886.453] -- 0:02:27 Average standard deviation of split frequencies: 0.114049 20500 -- (-893.656) [-894.954] (-894.342) (-890.417) * (-891.846) (-894.727) (-888.307) [-888.824] -- 0:02:23 21000 -- (-893.146) (-895.718) (-895.865) [-892.532] * (-898.376) [-888.072] (-892.467) (-893.624) -- 0:02:19 21500 -- (-892.623) (-894.155) (-897.066) [-889.214] * (-888.728) (-889.126) [-893.766] (-898.790) -- 0:02:16 22000 -- (-890.360) (-895.375) [-893.898] (-890.984) * (-889.536) [-890.630] (-897.159) (-888.983) -- 0:02:13 22500 -- (-891.371) [-893.751] (-895.109) (-891.042) * (-890.606) [-888.762] (-892.288) (-890.379) -- 0:02:10 23000 -- (-890.348) (-895.563) (-897.906) [-892.268] * (-897.069) (-892.777) [-891.683] (-890.562) -- 0:02:07 23500 -- (-892.663) [-891.403] (-891.773) (-888.861) * (-890.521) (-893.427) (-892.609) [-890.327] -- 0:02:04 24000 -- (-891.406) (-894.127) [-890.552] (-893.931) * [-891.931] (-895.721) (-889.205) (-892.190) -- 0:02:02 24500 -- (-890.603) [-894.365] (-893.472) (-895.080) * (-892.898) (-895.345) [-893.407] (-891.549) -- 0:01:59 25000 -- (-888.559) (-893.996) [-893.901] (-890.189) * (-889.393) (-891.238) (-889.704) [-890.397] -- 0:02:36 Average standard deviation of split frequencies: 0.090655 25500 -- (-892.723) [-892.688] (-893.079) (-891.547) * (-892.204) [-892.086] (-889.001) (-891.946) -- 0:02:32 26000 -- (-889.229) (-894.090) (-893.805) [-890.593] * (-890.609) [-891.903] (-890.416) (-891.897) -- 0:02:29 26500 -- (-890.748) [-891.728] (-890.316) (-892.960) * [-893.485] (-893.089) (-891.197) (-889.329) -- 0:02:26 27000 -- (-889.730) [-893.787] (-893.910) (-897.351) * [-888.339] (-894.416) (-892.726) (-888.605) -- 0:02:24 27500 -- [-890.714] (-898.581) (-889.573) (-899.894) * (-892.643) (-897.188) (-896.108) [-892.054] -- 0:02:21 28000 -- (-890.660) (-897.916) [-891.335] (-901.140) * [-892.422] (-889.967) (-890.301) (-893.756) -- 0:02:18 28500 -- [-894.105] (-897.833) (-888.213) (-895.052) * (-896.001) [-888.806] (-889.698) (-892.847) -- 0:02:16 29000 -- (-896.828) [-894.850] (-893.789) (-893.342) * (-891.480) (-892.295) [-894.356] (-895.678) -- 0:02:13 29500 -- (-893.988) (-900.026) (-889.389) [-896.265] * (-893.696) [-889.442] (-891.613) (-895.968) -- 0:02:11 30000 -- (-889.790) (-893.271) (-893.631) [-893.185] * (-889.769) [-890.198] (-893.552) (-898.525) -- 0:02:09 Average standard deviation of split frequencies: 0.107603 30500 -- (-894.677) (-894.921) (-898.419) [-898.365] * (-889.773) [-891.514] (-897.380) (-896.787) -- 0:02:07 31000 -- (-893.492) [-895.379] (-893.212) (-894.244) * (-889.001) (-891.604) (-898.783) [-892.262] -- 0:02:05 31500 -- (-891.710) (-894.610) (-892.177) [-893.351] * (-892.132) [-890.915] (-891.513) (-903.102) -- 0:02:02 32000 -- (-893.520) (-892.864) [-891.333] (-894.527) * (-891.584) (-890.089) [-888.610] (-903.028) -- 0:02:31 32500 -- (-889.824) (-895.406) (-890.928) [-892.255] * [-889.971] (-889.656) (-890.511) (-904.225) -- 0:02:28 33000 -- (-889.239) (-894.773) [-890.825] (-892.070) * (-890.188) [-891.421] (-891.807) (-893.642) -- 0:02:26 33500 -- (-892.250) (-896.904) [-892.005] (-897.165) * (-892.334) [-890.730] (-893.494) (-892.683) -- 0:02:24 34000 -- (-892.443) (-893.623) (-897.284) [-889.786] * [-892.836] (-896.875) (-892.530) (-894.056) -- 0:02:22 34500 -- (-891.979) (-894.164) [-889.580] (-906.433) * (-889.131) (-895.106) (-893.854) [-886.976] -- 0:02:19 35000 -- (-892.910) [-896.731] (-891.412) (-896.640) * (-892.294) [-893.346] (-890.785) (-895.456) -- 0:02:17 Average standard deviation of split frequencies: 0.091662 35500 -- (-888.871) [-888.761] (-892.901) (-891.145) * (-894.553) (-894.836) [-893.137] (-890.945) -- 0:02:15 36000 -- [-887.153] (-889.197) (-895.897) (-892.943) * (-893.308) [-890.998] (-890.878) (-890.656) -- 0:02:13 36500 -- (-889.532) (-892.262) (-892.055) [-890.529] * [-890.467] (-891.522) (-893.470) (-893.158) -- 0:02:11 37000 -- [-891.630] (-888.920) (-891.233) (-892.683) * (-898.111) [-893.972] (-893.217) (-895.191) -- 0:02:10 37500 -- [-897.847] (-891.913) (-894.581) (-889.615) * (-892.352) (-894.390) [-894.856] (-894.594) -- 0:02:08 38000 -- (-896.380) (-888.792) [-895.651] (-889.114) * (-890.607) (-892.815) (-895.007) [-898.484] -- 0:02:06 38500 -- (-891.598) [-891.179] (-891.244) (-895.321) * (-891.277) (-897.779) [-893.729] (-896.513) -- 0:02:04 39000 -- (-893.903) (-889.032) [-891.655] (-893.212) * [-892.244] (-896.469) (-893.827) (-893.120) -- 0:02:27 39500 -- (-893.507) (-891.545) (-894.252) [-889.248] * (-891.555) (-890.498) (-893.828) [-892.105] -- 0:02:25 40000 -- (-895.898) (-890.420) (-893.102) [-891.410] * (-891.824) [-888.040] (-894.417) (-891.470) -- 0:02:24 Average standard deviation of split frequencies: 0.092735 40500 -- (-902.870) (-890.525) (-903.786) [-889.832] * [-891.579] (-891.828) (-890.546) (-895.868) -- 0:02:22 41000 -- (-895.202) (-891.416) [-888.086] (-891.948) * (-889.158) [-893.929] (-893.154) (-893.185) -- 0:02:20 41500 -- (-890.917) (-890.882) [-890.745] (-890.091) * [-891.907] (-891.010) (-895.040) (-893.780) -- 0:02:18 42000 -- (-895.481) [-891.198] (-894.361) (-889.241) * (-890.668) (-895.427) [-890.563] (-893.577) -- 0:02:16 42500 -- (-896.189) (-889.514) [-891.338] (-892.420) * [-892.326] (-895.554) (-892.875) (-892.753) -- 0:02:15 43000 -- (-900.388) [-890.391] (-893.772) (-890.925) * (-894.153) (-888.988) [-889.318] (-894.312) -- 0:02:13 43500 -- (-890.108) (-889.414) [-895.592] (-891.273) * (-889.970) (-888.810) [-889.464] (-896.287) -- 0:02:11 44000 -- [-890.066] (-887.899) (-891.976) (-889.657) * (-890.128) [-890.725] (-888.295) (-894.352) -- 0:02:10 44500 -- [-895.064] (-889.888) (-893.643) (-890.441) * [-888.728] (-892.542) (-896.476) (-893.429) -- 0:02:08 45000 -- (-894.704) (-893.118) (-904.665) [-893.839] * (-894.010) (-890.398) [-891.380] (-891.741) -- 0:02:07 Average standard deviation of split frequencies: 0.087107 45500 -- (-890.819) (-893.346) (-889.872) [-890.307] * (-894.558) [-892.516] (-890.673) (-897.306) -- 0:02:05 46000 -- (-900.924) (-890.820) (-898.494) [-889.628] * (-898.754) (-897.477) (-895.620) [-892.789] -- 0:02:04 46500 -- (-892.630) [-893.183] (-892.963) (-895.422) * (-897.977) (-891.825) [-889.251] (-893.986) -- 0:02:23 47000 -- (-891.099) (-892.789) [-890.251] (-892.149) * (-895.360) (-893.389) [-893.767] (-889.645) -- 0:02:21 47500 -- [-893.440] (-888.187) (-890.264) (-891.343) * (-895.195) (-894.278) (-892.846) [-891.785] -- 0:02:20 48000 -- (-891.618) (-896.895) [-893.636] (-892.330) * (-891.266) (-895.548) [-891.265] (-892.354) -- 0:02:18 48500 -- (-893.897) (-894.950) (-891.452) [-889.027] * (-889.872) [-890.660] (-890.259) (-891.355) -- 0:02:17 49000 -- (-894.189) (-889.907) (-890.652) [-890.563] * [-892.028] (-888.435) (-898.070) (-897.805) -- 0:02:15 49500 -- [-890.108] (-895.024) (-892.452) (-890.369) * (-888.736) (-894.515) (-896.458) [-898.968] -- 0:02:14 50000 -- (-895.587) (-888.977) [-888.493] (-892.371) * (-887.258) [-890.122] (-903.441) (-898.152) -- 0:02:13 Average standard deviation of split frequencies: 0.079084 50500 -- (-887.633) [-890.769] (-893.158) (-893.081) * (-893.055) [-890.947] (-895.713) (-896.519) -- 0:02:11 51000 -- (-888.028) (-890.407) (-896.784) [-890.760] * [-888.542] (-891.725) (-891.851) (-892.484) -- 0:02:10 51500 -- [-890.281] (-894.132) (-892.573) (-893.166) * (-888.838) [-891.705] (-903.610) (-892.481) -- 0:02:08 52000 -- (-899.320) (-892.518) (-893.771) [-893.772] * (-890.171) [-891.279] (-903.669) (-892.853) -- 0:02:07 52500 -- [-892.566] (-889.405) (-889.169) (-895.236) * [-890.989] (-888.127) (-896.887) (-894.863) -- 0:02:06 53000 -- (-890.546) (-889.239) [-893.570] (-892.862) * (-886.759) [-891.434] (-898.289) (-891.792) -- 0:02:05 53500 -- [-894.636] (-896.568) (-891.755) (-893.422) * (-887.599) (-887.981) [-890.541] (-893.132) -- 0:02:21 54000 -- [-887.763] (-897.317) (-893.080) (-893.410) * (-897.511) (-894.530) (-892.057) [-897.733] -- 0:02:20 54500 -- (-894.564) (-897.859) (-890.565) [-890.784] * (-886.993) [-889.334] (-892.390) (-895.409) -- 0:02:18 55000 -- [-888.566] (-891.443) (-895.063) (-890.400) * (-895.453) [-891.004] (-890.124) (-895.696) -- 0:02:17 Average standard deviation of split frequencies: 0.075761 55500 -- (-890.166) [-887.455] (-896.159) (-893.336) * (-888.879) [-890.014] (-896.408) (-901.164) -- 0:02:16 56000 -- [-895.580] (-893.386) (-894.441) (-902.384) * [-894.715] (-894.048) (-891.904) (-901.040) -- 0:02:14 56500 -- (-895.357) (-894.003) [-891.217] (-891.687) * (-890.913) (-896.103) (-892.820) [-888.702] -- 0:02:13 57000 -- [-889.691] (-894.968) (-899.185) (-888.855) * (-887.850) (-897.075) [-891.451] (-892.642) -- 0:02:12 57500 -- (-895.286) (-894.591) [-895.877] (-895.374) * (-893.521) (-895.173) (-892.513) [-891.231] -- 0:02:11 58000 -- (-893.787) [-890.164] (-894.436) (-891.943) * (-895.662) (-897.968) [-890.126] (-891.178) -- 0:02:09 58500 -- (-888.355) (-890.782) (-892.901) [-894.335] * [-887.911] (-890.965) (-889.177) (-892.575) -- 0:02:08 59000 -- (-888.758) [-895.080] (-895.184) (-895.539) * (-888.566) (-890.029) [-887.379] (-893.628) -- 0:02:07 59500 -- [-888.346] (-891.717) (-897.390) (-889.083) * [-888.117] (-895.593) (-889.114) (-895.379) -- 0:02:06 60000 -- (-893.197) [-891.236] (-892.142) (-890.540) * (-891.987) [-889.662] (-893.754) (-895.751) -- 0:02:05 Average standard deviation of split frequencies: 0.062163 60500 -- (-889.248) (-893.893) [-897.747] (-898.203) * [-889.875] (-894.846) (-892.271) (-892.486) -- 0:02:19 61000 -- (-897.947) (-890.959) [-895.452] (-895.679) * (-892.425) (-898.070) (-896.447) [-892.201] -- 0:02:18 61500 -- [-890.215] (-889.341) (-890.034) (-891.573) * (-892.808) [-890.851] (-893.748) (-893.200) -- 0:02:17 62000 -- (-892.300) (-888.688) [-895.129] (-889.713) * (-895.965) [-890.834] (-895.948) (-893.489) -- 0:02:16 62500 -- (-893.735) (-893.914) [-890.293] (-890.595) * (-893.964) [-891.105] (-892.332) (-889.025) -- 0:02:15 63000 -- [-892.483] (-890.998) (-890.963) (-893.011) * (-896.495) (-894.929) [-892.250] (-892.224) -- 0:02:13 63500 -- (-893.427) [-894.968] (-891.993) (-891.908) * [-897.313] (-898.002) (-893.618) (-891.192) -- 0:02:12 64000 -- (-893.129) [-891.467] (-890.112) (-894.877) * (-903.093) [-896.007] (-895.496) (-889.180) -- 0:02:11 64500 -- (-891.314) [-890.042] (-892.959) (-889.127) * (-902.464) (-897.007) (-893.878) [-888.586] -- 0:02:10 65000 -- (-891.363) (-894.495) (-892.953) [-891.275] * (-901.384) (-898.817) (-897.227) [-898.350] -- 0:02:09 Average standard deviation of split frequencies: 0.049997 65500 -- [-890.246] (-891.414) (-895.926) (-891.269) * (-892.864) (-893.879) (-891.136) [-889.427] -- 0:02:08 66000 -- (-891.531) [-897.377] (-892.630) (-896.931) * (-888.912) [-891.421] (-895.616) (-888.010) -- 0:02:07 66500 -- [-891.040] (-889.370) (-901.030) (-890.861) * (-891.756) (-892.434) (-894.956) [-889.689] -- 0:02:06 67000 -- [-887.762] (-891.197) (-891.775) (-894.224) * (-890.992) (-890.078) (-889.645) [-891.793] -- 0:02:05 67500 -- (-891.374) [-892.416] (-892.204) (-892.493) * (-891.498) (-897.160) [-893.730] (-897.356) -- 0:02:18 68000 -- (-891.149) (-892.572) [-889.672] (-898.473) * (-892.580) [-889.333] (-892.101) (-892.548) -- 0:02:17 68500 -- [-890.270] (-893.915) (-892.583) (-891.470) * (-890.020) (-889.609) (-891.619) [-894.567] -- 0:02:15 69000 -- (-891.098) (-895.007) [-898.345] (-892.929) * [-892.025] (-889.766) (-891.195) (-895.737) -- 0:02:14 69500 -- (-890.583) (-896.610) (-891.511) [-891.686] * (-892.242) (-894.315) [-890.090] (-898.604) -- 0:02:13 70000 -- (-892.842) [-891.256] (-893.192) (-905.774) * (-904.731) (-891.991) (-887.651) [-895.633] -- 0:02:12 Average standard deviation of split frequencies: 0.033354 70500 -- (-891.174) (-891.600) [-891.006] (-894.931) * (-897.505) (-892.247) (-887.871) [-893.438] -- 0:02:11 71000 -- (-892.206) (-893.844) (-890.833) [-887.488] * (-898.324) [-896.128] (-893.358) (-896.641) -- 0:02:10 71500 -- (-892.165) (-894.422) [-888.752] (-895.142) * (-899.044) [-892.906] (-891.497) (-891.470) -- 0:02:09 72000 -- [-890.628] (-892.988) (-892.703) (-893.308) * (-896.128) (-891.579) [-893.949] (-890.345) -- 0:02:08 72500 -- (-897.186) [-888.505] (-893.260) (-896.088) * (-890.307) (-893.806) (-889.261) [-891.606] -- 0:02:07 73000 -- [-892.548] (-891.029) (-898.456) (-895.873) * [-898.361] (-889.679) (-890.527) (-888.067) -- 0:02:06 73500 -- [-893.192] (-894.096) (-892.051) (-893.832) * (-891.937) [-889.909] (-889.471) (-893.534) -- 0:02:06 74000 -- (-891.398) [-893.293] (-891.409) (-895.784) * (-892.734) (-887.840) [-892.967] (-891.692) -- 0:02:05 74500 -- (-891.759) (-889.433) [-890.385] (-897.900) * (-890.931) (-887.179) [-888.498] (-895.255) -- 0:02:16 75000 -- (-894.374) (-888.294) [-894.937] (-894.107) * (-889.623) (-890.138) [-887.928] (-891.399) -- 0:02:15 Average standard deviation of split frequencies: 0.037216 75500 -- (-896.254) [-893.766] (-895.395) (-895.450) * (-891.511) (-890.323) [-891.048] (-892.235) -- 0:02:14 76000 -- (-899.443) [-890.969] (-895.105) (-894.352) * (-893.534) [-889.577] (-889.478) (-895.558) -- 0:02:13 76500 -- [-894.386] (-888.456) (-894.850) (-889.695) * [-889.330] (-893.298) (-890.734) (-891.504) -- 0:02:12 77000 -- [-891.827] (-889.123) (-893.834) (-890.195) * [-893.135] (-895.482) (-890.183) (-889.685) -- 0:02:11 77500 -- [-890.732] (-892.461) (-891.726) (-891.789) * (-892.258) (-897.189) (-891.641) [-892.818] -- 0:02:10 78000 -- (-890.415) [-892.140] (-895.755) (-891.469) * [-891.139] (-893.921) (-895.132) (-893.230) -- 0:02:10 78500 -- (-897.024) (-890.415) (-892.944) [-888.706] * [-891.815] (-892.524) (-896.310) (-898.406) -- 0:02:09 79000 -- (-890.908) (-889.358) (-896.170) [-889.427] * (-887.348) (-896.555) [-890.069] (-893.471) -- 0:02:08 79500 -- (-891.592) [-891.414] (-895.343) (-891.689) * (-890.478) (-892.515) [-893.718] (-890.856) -- 0:02:07 80000 -- (-891.129) (-892.449) (-892.857) [-890.421] * [-890.125] (-895.790) (-896.466) (-896.765) -- 0:02:06 Average standard deviation of split frequencies: 0.040907 80500 -- (-893.268) (-894.308) (-893.974) [-887.581] * (-889.189) [-894.180] (-889.771) (-891.436) -- 0:02:05 81000 -- (-894.550) (-896.778) [-891.691] (-890.253) * (-892.867) (-897.144) (-892.615) [-889.069] -- 0:02:04 81500 -- (-893.158) (-891.457) (-890.983) [-897.114] * [-889.201] (-890.059) (-887.661) (-890.245) -- 0:02:15 82000 -- (-891.483) [-894.023] (-889.619) (-892.303) * [-891.364] (-893.542) (-890.891) (-893.279) -- 0:02:14 82500 -- [-889.234] (-889.782) (-892.160) (-888.648) * [-892.451] (-891.213) (-894.603) (-894.879) -- 0:02:13 83000 -- (-891.619) (-893.507) (-893.007) [-887.735] * (-891.521) [-892.575] (-895.867) (-892.833) -- 0:02:12 83500 -- [-891.884] (-891.520) (-892.133) (-891.466) * [-890.782] (-889.980) (-892.733) (-894.292) -- 0:02:11 84000 -- (-893.100) (-887.569) (-894.957) [-890.310] * (-890.080) (-892.837) [-894.958] (-891.148) -- 0:02:10 84500 -- (-891.797) (-890.343) (-888.782) [-890.626] * (-897.777) [-888.766] (-893.362) (-893.062) -- 0:02:10 85000 -- [-890.348] (-891.810) (-888.030) (-892.742) * [-890.137] (-889.163) (-887.903) (-891.013) -- 0:02:09 Average standard deviation of split frequencies: 0.032889 85500 -- (-892.383) [-887.755] (-894.918) (-893.487) * (-891.329) [-888.703] (-893.088) (-892.094) -- 0:02:08 86000 -- (-891.896) [-892.568] (-893.195) (-894.746) * (-891.282) (-889.819) [-890.684] (-902.139) -- 0:02:07 86500 -- (-889.720) (-892.570) [-898.422] (-893.635) * (-889.141) [-888.505] (-896.196) (-891.388) -- 0:02:06 87000 -- [-889.718] (-891.913) (-894.901) (-896.544) * [-888.661] (-891.355) (-892.437) (-896.338) -- 0:02:05 87500 -- [-891.049] (-892.586) (-894.456) (-890.229) * [-892.334] (-890.112) (-892.174) (-888.306) -- 0:02:05 88000 -- (-887.359) (-894.653) (-896.290) [-893.466] * (-892.544) [-892.096] (-891.878) (-892.832) -- 0:02:04 88500 -- [-891.360] (-892.590) (-893.966) (-892.488) * (-890.778) (-894.052) [-891.734] (-897.853) -- 0:02:03 89000 -- (-891.757) (-890.145) (-898.007) [-889.343] * (-893.051) (-893.736) (-889.287) [-895.958] -- 0:02:13 89500 -- (-893.557) (-887.215) (-892.637) [-893.491] * (-888.639) [-887.844] (-894.652) (-900.424) -- 0:02:12 90000 -- [-896.849] (-894.070) (-897.579) (-891.870) * [-889.413] (-892.249) (-892.800) (-890.902) -- 0:02:11 Average standard deviation of split frequencies: 0.025997 90500 -- (-893.267) [-888.738] (-903.168) (-892.191) * (-894.251) (-889.131) (-895.744) [-893.804] -- 0:02:10 91000 -- (-892.054) [-889.405] (-894.201) (-892.512) * (-891.797) (-890.435) (-898.161) [-892.883] -- 0:02:09 91500 -- [-898.049] (-893.172) (-900.124) (-896.155) * (-888.999) (-896.389) (-893.622) [-896.293] -- 0:02:09 92000 -- [-894.447] (-889.985) (-895.917) (-892.288) * (-895.506) [-887.712] (-891.337) (-895.913) -- 0:02:08 92500 -- (-896.487) (-892.505) [-891.011] (-892.411) * (-888.492) (-892.470) [-895.898] (-896.173) -- 0:02:07 93000 -- (-890.064) (-892.429) (-892.869) [-895.745] * (-892.411) (-894.392) (-891.866) [-892.472] -- 0:02:06 93500 -- (-891.860) [-887.802] (-891.842) (-895.842) * (-893.379) (-898.814) (-890.611) [-888.923] -- 0:02:06 94000 -- [-893.775] (-888.654) (-890.571) (-893.122) * [-889.469] (-890.373) (-894.548) (-889.383) -- 0:02:05 94500 -- (-891.163) (-891.905) (-890.898) [-895.585] * (-891.842) [-888.633] (-895.473) (-890.994) -- 0:02:04 95000 -- (-887.050) (-891.490) [-895.775] (-892.443) * (-895.252) (-888.509) [-888.473] (-890.537) -- 0:02:03 Average standard deviation of split frequencies: 0.034373 95500 -- (-891.338) [-890.629] (-889.905) (-889.561) * (-889.733) [-890.251] (-889.786) (-896.888) -- 0:02:03 96000 -- (-893.870) (-892.425) [-891.318] (-891.491) * (-889.486) (-895.136) [-892.474] (-891.422) -- 0:02:11 96500 -- [-893.500] (-891.308) (-892.193) (-896.189) * [-891.860] (-891.363) (-890.988) (-891.513) -- 0:02:11 97000 -- (-894.501) [-889.247] (-889.608) (-892.786) * (-893.633) [-894.928] (-894.945) (-901.075) -- 0:02:10 97500 -- (-889.846) (-891.362) [-891.198] (-891.824) * (-892.467) (-889.424) [-892.906] (-894.326) -- 0:02:09 98000 -- (-896.247) [-892.953] (-895.330) (-891.915) * (-893.422) (-889.923) (-892.189) [-888.318] -- 0:02:08 98500 -- (-891.259) (-891.194) (-894.099) [-893.289] * (-890.156) (-890.935) [-888.533] (-890.788) -- 0:02:08 99000 -- (-888.280) [-887.974] (-897.850) (-896.326) * (-888.946) (-894.183) (-891.204) [-888.272] -- 0:02:07 99500 -- (-896.806) (-892.401) [-896.384] (-900.865) * (-895.001) (-890.191) (-895.001) [-893.050] -- 0:02:06 100000 -- (-892.754) [-888.108] (-895.677) (-891.952) * (-890.470) [-889.590] (-888.886) (-889.022) -- 0:02:05 Average standard deviation of split frequencies: 0.032780 100500 -- (-890.657) [-891.479] (-894.556) (-898.863) * (-889.342) [-890.301] (-893.083) (-890.732) -- 0:02:05 101000 -- (-894.976) [-894.136] (-891.182) (-898.751) * (-894.194) [-891.240] (-893.675) (-891.184) -- 0:02:04 101500 -- (-890.807) [-896.007] (-888.526) (-895.625) * (-898.213) (-889.094) (-891.030) [-891.565] -- 0:02:03 102000 -- (-894.257) [-892.799] (-891.023) (-890.393) * (-898.658) [-891.703] (-889.372) (-891.915) -- 0:02:03 102500 -- [-889.784] (-890.028) (-888.258) (-888.808) * (-887.861) (-895.615) [-889.382] (-892.600) -- 0:02:02 103000 -- (-890.165) [-890.260] (-895.164) (-888.486) * (-901.761) (-894.676) [-891.175] (-893.475) -- 0:02:10 103500 -- [-888.559] (-888.832) (-890.608) (-888.526) * [-893.834] (-891.718) (-893.668) (-893.637) -- 0:02:09 104000 -- (-891.709) (-891.793) (-890.310) [-890.628] * (-888.756) (-890.798) (-898.263) [-888.220] -- 0:02:09 104500 -- (-890.623) [-887.903] (-894.139) (-892.866) * (-893.487) (-892.401) (-891.913) [-892.843] -- 0:02:08 105000 -- (-890.666) [-891.528] (-895.168) (-892.866) * [-889.878] (-894.599) (-890.609) (-893.883) -- 0:02:07 Average standard deviation of split frequencies: 0.031130 105500 -- (-888.768) [-890.080] (-901.461) (-888.324) * (-889.879) (-892.548) [-894.650] (-895.394) -- 0:02:07 106000 -- (-895.968) [-888.359] (-903.750) (-895.034) * (-892.118) (-890.503) (-896.453) [-890.638] -- 0:02:06 106500 -- (-893.046) (-890.654) (-891.174) [-894.567] * [-890.623] (-892.215) (-898.213) (-894.242) -- 0:02:05 107000 -- [-889.247] (-890.100) (-894.124) (-890.900) * [-888.432] (-893.105) (-890.452) (-895.041) -- 0:02:05 107500 -- (-890.583) (-888.651) [-891.389] (-894.065) * (-906.601) (-889.441) (-890.768) [-894.431] -- 0:02:04 108000 -- (-891.773) [-893.355] (-893.184) (-890.204) * (-894.682) (-895.523) (-894.437) [-889.955] -- 0:02:03 108500 -- (-890.720) [-892.300] (-896.955) (-893.720) * (-896.829) (-893.664) [-892.226] (-893.916) -- 0:02:03 109000 -- (-892.702) (-894.635) [-890.256] (-892.169) * [-893.362] (-887.624) (-891.102) (-892.273) -- 0:02:02 109500 -- (-891.460) [-891.831] (-895.879) (-893.127) * [-892.521] (-888.700) (-894.019) (-896.420) -- 0:02:01 110000 -- (-891.799) (-891.047) [-895.163] (-903.159) * [-896.051] (-891.122) (-891.587) (-896.948) -- 0:02:09 Average standard deviation of split frequencies: 0.029818 110500 -- (-894.347) [-892.920] (-894.215) (-899.341) * (-896.890) (-893.083) (-889.768) [-891.192] -- 0:02:08 111000 -- (-891.287) (-891.524) (-897.492) [-890.944] * (-895.425) [-889.357] (-899.449) (-886.726) -- 0:02:08 111500 -- [-889.846] (-890.419) (-892.249) (-891.435) * (-891.772) [-889.387] (-896.745) (-891.596) -- 0:02:07 112000 -- [-896.472] (-889.389) (-890.365) (-894.166) * (-890.312) [-889.807] (-898.890) (-890.773) -- 0:02:06 112500 -- (-903.425) [-891.940] (-894.332) (-892.699) * [-889.131] (-890.705) (-892.783) (-894.515) -- 0:02:06 113000 -- [-893.462] (-892.560) (-896.313) (-891.936) * (-897.092) (-889.027) (-894.123) [-889.114] -- 0:02:05 113500 -- [-888.204] (-891.929) (-894.636) (-890.886) * (-890.809) (-895.722) (-889.976) [-889.358] -- 0:02:04 114000 -- (-889.247) [-890.024] (-891.893) (-889.813) * [-893.762] (-894.663) (-888.246) (-888.825) -- 0:02:04 114500 -- (-893.865) (-891.347) (-896.892) [-894.724] * (-897.965) (-894.640) [-887.220] (-892.250) -- 0:02:03 115000 -- (-891.752) [-889.167] (-893.045) (-892.988) * [-893.992] (-893.572) (-889.177) (-892.611) -- 0:02:03 Average standard deviation of split frequencies: 0.024383 115500 -- (-897.851) [-890.090] (-895.993) (-888.799) * (-888.966) (-896.051) (-892.208) [-889.927] -- 0:02:02 116000 -- (-890.859) (-892.060) [-893.724] (-891.844) * [-891.996] (-888.413) (-890.144) (-888.660) -- 0:02:01 116500 -- (-889.330) (-893.374) [-893.742] (-893.874) * [-889.619] (-891.607) (-890.408) (-891.949) -- 0:02:01 117000 -- (-892.822) (-892.341) (-894.991) [-895.042] * [-891.694] (-898.095) (-895.126) (-892.947) -- 0:02:08 117500 -- (-892.755) (-890.010) [-892.896] (-901.899) * (-893.797) [-892.510] (-895.647) (-893.239) -- 0:02:07 118000 -- (-894.146) [-891.486] (-892.150) (-891.769) * [-892.117] (-893.587) (-893.449) (-895.492) -- 0:02:07 118500 -- (-896.683) [-889.542] (-890.831) (-892.837) * [-892.207] (-892.010) (-891.362) (-895.246) -- 0:02:06 119000 -- (-894.114) [-893.635] (-890.217) (-895.110) * (-894.367) (-890.000) (-888.740) [-894.493] -- 0:02:05 119500 -- (-890.742) (-889.568) [-895.025] (-894.175) * (-891.042) [-895.010] (-889.435) (-895.456) -- 0:02:05 120000 -- (-893.459) [-888.812] (-896.942) (-898.559) * (-891.233) (-894.110) (-889.105) [-893.761] -- 0:02:04 Average standard deviation of split frequencies: 0.023440 120500 -- [-894.676] (-890.779) (-894.053) (-890.591) * (-891.545) (-890.176) [-887.992] (-893.327) -- 0:02:04 121000 -- (-892.518) (-890.909) [-890.445] (-886.533) * (-893.705) [-887.317] (-895.859) (-894.096) -- 0:02:03 121500 -- (-891.033) (-895.226) (-893.138) [-888.556] * (-895.186) (-891.280) [-888.982] (-887.595) -- 0:02:02 122000 -- (-892.083) [-890.160] (-890.216) (-892.528) * (-889.345) [-892.893] (-893.788) (-891.267) -- 0:02:02 122500 -- (-897.591) [-888.954] (-890.805) (-892.533) * [-889.622] (-896.640) (-892.403) (-891.874) -- 0:02:01 123000 -- (-895.934) (-887.626) (-888.432) [-890.152] * [-889.769] (-898.768) (-894.472) (-895.347) -- 0:02:01 123500 -- [-890.894] (-889.119) (-890.328) (-897.225) * [-890.291] (-896.279) (-892.659) (-890.320) -- 0:02:00 124000 -- (-892.330) (-890.394) [-890.689] (-890.438) * [-892.337] (-889.810) (-898.904) (-892.794) -- 0:02:07 124500 -- (-894.228) (-892.906) [-890.026] (-890.765) * (-892.372) (-896.840) (-893.628) [-895.014] -- 0:02:06 125000 -- [-892.599] (-892.957) (-895.968) (-890.345) * [-897.744] (-893.051) (-893.936) (-891.075) -- 0:02:06 Average standard deviation of split frequencies: 0.026189 125500 -- [-892.566] (-887.000) (-897.664) (-891.565) * (-889.952) (-896.407) [-890.940] (-891.966) -- 0:02:05 126000 -- (-894.786) (-891.907) [-894.605] (-895.285) * (-889.143) [-893.337] (-897.246) (-893.155) -- 0:02:04 126500 -- (-893.084) [-891.886] (-896.021) (-892.669) * [-890.338] (-892.860) (-900.812) (-890.928) -- 0:02:04 127000 -- (-891.565) (-897.207) [-890.177] (-889.857) * (-892.259) [-889.345] (-895.642) (-890.632) -- 0:02:03 127500 -- (-892.784) (-896.101) [-889.990] (-894.999) * (-890.293) (-893.679) (-894.689) [-892.292] -- 0:02:03 128000 -- [-892.109] (-896.367) (-896.740) (-893.340) * [-890.359] (-892.118) (-897.202) (-894.651) -- 0:02:02 128500 -- (-890.622) [-892.322] (-888.679) (-889.594) * (-894.626) [-893.141] (-895.031) (-888.797) -- 0:02:02 129000 -- (-892.546) [-888.395] (-892.851) (-893.669) * (-891.283) [-888.167] (-889.690) (-890.355) -- 0:02:01 129500 -- [-890.219] (-890.777) (-892.728) (-889.851) * (-892.281) (-892.481) [-892.578] (-893.305) -- 0:02:00 130000 -- (-890.401) (-891.199) [-892.122] (-896.759) * [-890.698] (-890.245) (-888.348) (-890.010) -- 0:02:00 Average standard deviation of split frequencies: 0.025254 130500 -- [-890.994] (-889.710) (-894.257) (-893.964) * (-892.789) (-892.172) [-889.962] (-892.821) -- 0:01:59 131000 -- (-888.064) [-891.311] (-892.377) (-899.629) * (-896.133) (-891.641) [-895.196] (-891.763) -- 0:02:06 131500 -- (-891.330) (-890.358) [-893.221] (-894.782) * (-894.439) (-891.879) (-890.630) [-890.531] -- 0:02:05 132000 -- [-892.438] (-886.705) (-893.560) (-892.542) * (-895.171) (-897.835) [-892.998] (-887.653) -- 0:02:04 132500 -- (-895.873) (-890.468) [-888.775] (-894.817) * [-895.875] (-888.776) (-899.165) (-890.824) -- 0:02:04 133000 -- (-891.070) [-888.181] (-895.296) (-897.308) * (-894.116) (-892.748) [-892.331] (-892.792) -- 0:02:03 133500 -- [-890.929] (-887.609) (-893.371) (-890.773) * (-895.578) [-901.038] (-898.408) (-892.289) -- 0:02:03 134000 -- [-890.114] (-891.515) (-893.193) (-887.804) * (-896.963) [-890.150] (-898.964) (-892.691) -- 0:02:02 134500 -- (-888.096) (-888.990) (-892.976) [-888.714] * (-890.726) (-894.136) (-897.249) [-891.675] -- 0:02:02 135000 -- (-890.001) (-890.425) (-890.502) [-891.055] * (-891.595) [-890.494] (-894.691) (-890.059) -- 0:02:01 Average standard deviation of split frequencies: 0.020797 135500 -- (-893.999) [-887.983] (-892.340) (-888.335) * (-893.964) [-893.724] (-899.756) (-890.169) -- 0:02:01 136000 -- (-889.583) (-892.626) [-889.979] (-898.428) * (-893.102) [-889.461] (-897.356) (-888.249) -- 0:02:00 136500 -- [-891.724] (-887.594) (-895.675) (-893.083) * (-889.232) (-892.041) (-895.003) [-892.752] -- 0:02:00 137000 -- (-888.210) [-889.381] (-893.894) (-896.552) * (-888.922) (-892.139) (-902.416) [-892.830] -- 0:01:59 137500 -- (-893.690) (-891.522) [-894.473] (-890.566) * (-893.364) (-893.862) (-898.711) [-890.607] -- 0:01:59 138000 -- (-901.031) (-891.519) [-889.642] (-888.873) * (-891.241) (-895.615) (-896.041) [-894.884] -- 0:02:04 138500 -- (-894.478) [-893.349] (-889.529) (-892.568) * [-897.187] (-893.269) (-894.094) (-892.718) -- 0:02:04 139000 -- (-893.235) (-893.207) [-891.536] (-892.337) * [-892.896] (-888.070) (-897.147) (-893.249) -- 0:02:03 139500 -- (-892.282) [-894.538] (-890.542) (-890.543) * (-890.366) [-889.259] (-900.162) (-892.725) -- 0:02:03 140000 -- (-889.562) (-891.236) [-889.643] (-891.964) * [-890.918] (-890.004) (-900.228) (-892.318) -- 0:02:02 Average standard deviation of split frequencies: 0.020107 140500 -- [-888.514] (-898.224) (-891.429) (-893.147) * (-894.993) [-895.037] (-903.772) (-897.571) -- 0:02:02 141000 -- [-891.942] (-894.379) (-892.197) (-888.645) * [-892.779] (-892.017) (-893.175) (-889.885) -- 0:02:01 141500 -- (-890.821) (-892.041) (-897.095) [-895.847] * [-894.756] (-891.404) (-894.693) (-891.452) -- 0:02:01 142000 -- (-890.536) (-894.516) [-892.828] (-889.920) * [-888.516] (-892.532) (-903.245) (-892.622) -- 0:02:00 142500 -- (-895.451) [-894.427] (-895.466) (-889.476) * (-892.857) (-893.119) (-900.891) [-889.203] -- 0:02:00 143000 -- (-896.710) [-892.495] (-893.696) (-894.856) * (-890.913) (-890.570) (-893.441) [-889.686] -- 0:01:59 143500 -- (-897.289) [-893.050] (-890.550) (-887.528) * [-894.147] (-891.933) (-893.965) (-890.665) -- 0:01:59 144000 -- (-908.747) (-896.174) (-886.713) [-890.376] * [-890.815] (-892.790) (-896.018) (-893.523) -- 0:01:58 144500 -- (-897.848) (-892.833) [-891.295] (-894.903) * (-893.110) (-891.755) [-893.567] (-893.124) -- 0:01:58 145000 -- (-892.408) (-895.331) (-892.180) [-888.739] * (-889.338) (-899.513) (-891.900) [-895.334] -- 0:02:03 Average standard deviation of split frequencies: 0.025830 145500 -- (-890.269) (-888.473) (-889.629) [-888.532] * (-890.402) (-891.804) (-896.998) [-892.255] -- 0:02:03 146000 -- (-894.293) (-891.430) (-889.746) [-892.522] * (-893.032) (-895.977) (-894.745) [-892.534] -- 0:02:02 146500 -- (-896.124) [-891.875] (-894.207) (-891.469) * [-889.392] (-892.942) (-892.165) (-892.706) -- 0:02:02 147000 -- (-898.275) (-889.496) (-889.034) [-890.435] * (-890.405) (-890.404) [-890.337] (-891.265) -- 0:02:01 147500 -- (-889.043) [-891.892] (-891.285) (-895.165) * (-889.093) (-894.764) [-886.817] (-891.536) -- 0:02:01 148000 -- (-892.760) (-891.623) [-887.566] (-891.092) * (-892.651) (-895.005) [-892.890] (-895.782) -- 0:02:00 148500 -- [-899.330] (-893.677) (-894.714) (-895.457) * [-892.483] (-897.303) (-893.186) (-889.800) -- 0:02:00 149000 -- (-890.903) [-889.821] (-895.776) (-892.705) * (-891.992) (-895.804) [-891.120] (-892.370) -- 0:01:59 149500 -- (-895.328) (-891.961) [-892.380] (-894.183) * (-892.642) [-897.604] (-889.450) (-890.484) -- 0:01:59 150000 -- (-893.854) (-896.855) [-890.098] (-892.376) * (-890.535) [-896.974] (-893.068) (-894.113) -- 0:01:58 Average standard deviation of split frequencies: 0.028159 150500 -- (-895.284) (-892.986) (-891.215) [-894.510] * (-891.817) (-900.524) (-895.738) [-891.179] -- 0:01:58 151000 -- (-894.872) (-895.048) [-890.205] (-889.232) * (-888.618) (-893.202) (-893.702) [-893.330] -- 0:01:58 151500 -- (-892.261) (-892.468) (-891.184) [-895.969] * (-891.206) (-893.873) (-894.234) [-889.754] -- 0:01:57 152000 -- (-889.449) (-892.221) (-888.916) [-895.363] * (-895.398) [-891.840] (-896.308) (-892.948) -- 0:01:57 152500 -- [-891.355] (-889.702) (-889.542) (-890.365) * (-893.470) (-894.642) (-895.810) [-892.215] -- 0:02:02 153000 -- (-892.758) (-893.778) [-889.582] (-891.410) * (-892.187) (-892.571) (-892.152) [-888.676] -- 0:02:01 153500 -- (-896.276) (-890.164) (-887.636) [-889.055] * (-890.910) (-896.103) [-891.281] (-892.948) -- 0:02:01 154000 -- (-891.991) (-902.641) (-889.567) [-891.009] * (-894.642) (-891.951) (-895.017) [-893.594] -- 0:02:00 154500 -- [-892.837] (-896.002) (-891.579) (-896.016) * (-896.914) [-892.706] (-895.876) (-895.226) -- 0:02:00 155000 -- (-893.400) (-895.781) (-893.600) [-896.237] * (-892.627) (-891.037) [-892.314] (-890.446) -- 0:01:59 Average standard deviation of split frequencies: 0.024175 155500 -- (-889.101) [-893.545] (-892.154) (-898.088) * [-892.450] (-887.915) (-893.570) (-891.984) -- 0:01:59 156000 -- (-890.691) (-888.664) (-894.189) [-888.880] * (-888.937) (-893.972) [-893.109] (-889.339) -- 0:01:59 156500 -- [-893.550] (-893.395) (-890.917) (-894.949) * (-888.585) [-890.454] (-891.897) (-892.557) -- 0:01:58 157000 -- (-891.345) (-895.154) (-889.738) [-891.697] * (-891.063) [-889.678] (-893.220) (-893.375) -- 0:01:58 157500 -- (-892.200) (-893.167) (-888.698) [-888.587] * (-896.022) (-889.627) (-890.123) [-891.228] -- 0:01:57 158000 -- [-891.362] (-891.815) (-889.399) (-895.116) * (-897.570) (-888.420) (-895.456) [-891.708] -- 0:01:57 158500 -- [-891.778] (-890.305) (-892.291) (-893.342) * (-906.554) [-891.537] (-892.240) (-893.313) -- 0:01:56 159000 -- (-893.179) (-889.593) [-891.471] (-890.976) * (-898.278) (-892.427) [-890.820] (-893.353) -- 0:01:56 159500 -- [-890.032] (-892.224) (-891.832) (-892.379) * [-889.492] (-891.474) (-891.425) (-890.307) -- 0:02:01 160000 -- [-896.571] (-893.716) (-892.812) (-891.457) * (-894.284) (-890.998) [-891.209] (-897.722) -- 0:02:00 Average standard deviation of split frequencies: 0.020538 160500 -- (-891.798) (-894.235) (-889.524) [-889.439] * (-891.661) (-893.189) (-889.718) [-894.026] -- 0:02:00 161000 -- (-888.562) [-892.212] (-888.531) (-890.215) * (-890.696) (-892.029) (-890.089) [-897.411] -- 0:01:59 161500 -- (-896.069) (-890.429) [-892.377] (-889.913) * (-888.398) (-892.716) (-889.551) [-890.417] -- 0:01:59 162000 -- (-902.683) (-891.558) [-889.188] (-892.378) * (-891.023) [-893.941] (-899.119) (-891.593) -- 0:01:58 162500 -- (-899.011) (-900.862) [-890.562] (-896.116) * (-890.682) [-897.017] (-890.548) (-890.065) -- 0:01:58 163000 -- [-896.506] (-892.740) (-889.475) (-891.156) * (-897.440) [-893.876] (-886.639) (-894.219) -- 0:01:58 163500 -- (-894.337) (-888.453) [-896.551] (-888.872) * (-893.430) (-891.331) (-890.901) [-890.595] -- 0:01:57 164000 -- (-891.546) (-889.412) (-894.482) [-889.192] * (-892.624) (-899.629) (-889.872) [-891.114] -- 0:01:57 164500 -- (-890.937) (-892.126) [-889.920] (-891.877) * (-892.714) (-894.753) [-888.900] (-891.859) -- 0:01:56 165000 -- (-895.306) [-890.168] (-890.459) (-890.048) * (-893.359) [-890.466] (-898.318) (-889.354) -- 0:01:56 Average standard deviation of split frequencies: 0.019879 165500 -- (-898.349) (-891.607) (-889.957) [-889.088] * (-891.220) (-892.595) (-894.088) [-889.790] -- 0:01:55 166000 -- (-894.938) [-891.564] (-892.095) (-890.999) * (-891.594) [-888.742] (-895.568) (-893.708) -- 0:01:55 166500 -- (-894.576) [-888.795] (-888.140) (-894.911) * (-892.994) [-891.144] (-890.174) (-893.553) -- 0:02:00 167000 -- (-896.924) (-889.118) [-892.440] (-894.493) * (-894.079) (-896.084) (-890.338) [-888.121] -- 0:01:59 167500 -- (-895.763) [-892.820] (-889.351) (-892.473) * (-893.729) [-892.199] (-892.366) (-896.445) -- 0:01:59 168000 -- (-896.411) (-895.654) [-894.176] (-888.910) * (-888.593) (-889.127) [-887.690] (-893.202) -- 0:01:58 168500 -- (-892.965) (-892.108) [-894.630] (-894.006) * (-893.264) [-893.510] (-891.727) (-894.855) -- 0:01:58 169000 -- [-893.399] (-890.004) (-890.179) (-896.149) * (-893.584) (-888.682) (-888.908) [-894.157] -- 0:01:58 169500 -- (-891.543) (-894.735) [-892.430] (-889.578) * (-892.336) [-893.935] (-891.400) (-892.072) -- 0:01:57 170000 -- (-890.805) [-894.396] (-891.772) (-890.614) * [-890.915] (-896.370) (-890.777) (-889.817) -- 0:01:57 Average standard deviation of split frequencies: 0.016573 170500 -- (-894.795) (-894.258) [-895.970] (-894.343) * (-891.955) (-897.694) [-895.239] (-891.967) -- 0:01:56 171000 -- [-892.115] (-889.638) (-890.116) (-889.096) * (-889.324) (-891.880) (-891.760) [-890.758] -- 0:01:56 171500 -- [-892.243] (-895.579) (-890.399) (-889.317) * (-889.331) (-892.654) [-888.377] (-893.931) -- 0:01:55 172000 -- (-892.412) [-893.412] (-891.735) (-890.541) * (-890.183) [-891.445] (-890.101) (-890.017) -- 0:01:55 172500 -- (-895.421) (-896.658) (-895.476) [-889.148] * (-892.034) (-891.839) [-890.727] (-894.285) -- 0:01:55 173000 -- (-898.533) (-891.665) (-891.729) [-891.275] * [-893.504] (-892.254) (-888.265) (-892.113) -- 0:01:54 173500 -- [-891.434] (-894.906) (-896.509) (-892.172) * (-891.656) (-891.890) (-889.975) [-892.000] -- 0:01:59 174000 -- (-893.400) (-899.010) (-891.898) [-893.102] * [-888.109] (-889.678) (-889.721) (-889.237) -- 0:01:58 174500 -- [-894.324] (-895.273) (-894.886) (-898.367) * (-891.992) [-891.498] (-887.944) (-887.370) -- 0:01:58 175000 -- (-891.894) [-896.241] (-896.178) (-898.818) * (-896.061) (-895.687) (-894.700) [-890.447] -- 0:01:57 Average standard deviation of split frequencies: 0.018749 175500 -- (-890.592) [-893.956] (-890.257) (-892.210) * (-890.723) (-898.017) (-889.054) [-890.644] -- 0:01:57 176000 -- [-891.907] (-892.589) (-890.653) (-891.607) * [-888.840] (-894.491) (-888.929) (-890.127) -- 0:01:57 176500 -- (-889.143) [-897.266] (-898.043) (-893.104) * (-894.772) (-897.244) [-889.593] (-889.622) -- 0:01:56 177000 -- (-890.287) (-894.444) (-894.773) [-897.431] * (-889.897) (-899.314) [-890.713] (-892.826) -- 0:01:56 177500 -- (-892.027) (-894.414) (-892.890) [-892.509] * (-889.863) (-895.180) [-893.256] (-894.471) -- 0:01:55 178000 -- [-889.827] (-892.549) (-894.470) (-891.636) * (-889.037) (-890.405) (-891.946) [-890.683] -- 0:01:55 178500 -- (-890.140) (-892.636) (-891.810) [-890.279] * (-895.490) (-889.079) (-890.740) [-891.055] -- 0:01:55 179000 -- (-892.795) (-891.949) (-890.148) [-892.006] * (-893.231) (-893.886) (-896.357) [-897.587] -- 0:01:54 179500 -- (-897.294) (-893.512) (-896.898) [-889.858] * (-895.044) (-892.530) (-897.196) [-901.085] -- 0:01:54 180000 -- (-891.836) (-892.652) [-894.027] (-892.206) * (-892.892) [-896.152] (-897.941) (-887.918) -- 0:01:53 Average standard deviation of split frequencies: 0.015656 180500 -- [-888.389] (-898.390) (-894.925) (-893.494) * (-893.121) (-891.418) (-894.268) [-890.200] -- 0:01:58 181000 -- (-887.757) (-893.631) (-895.246) [-893.592] * (-894.164) [-891.571] (-889.450) (-888.715) -- 0:01:57 181500 -- [-888.280] (-894.369) (-895.528) (-891.090) * (-893.567) [-891.405] (-898.887) (-889.991) -- 0:01:57 182000 -- (-893.381) (-891.179) (-899.642) [-891.910] * [-894.855] (-891.800) (-892.369) (-897.833) -- 0:01:56 182500 -- [-891.129] (-892.824) (-896.110) (-889.803) * (-892.403) (-893.741) (-890.967) [-891.436] -- 0:01:56 183000 -- (-891.451) [-893.604] (-902.476) (-891.338) * (-901.528) (-893.908) [-893.804] (-889.361) -- 0:01:56 183500 -- (-889.742) (-892.625) [-892.904] (-890.793) * (-902.696) [-892.279] (-893.517) (-892.820) -- 0:01:55 184000 -- (-888.994) (-896.914) [-892.087] (-892.932) * (-895.704) (-888.830) (-892.968) [-890.652] -- 0:01:55 184500 -- (-894.679) (-896.059) (-893.184) [-892.016] * (-895.500) (-893.346) [-891.355] (-892.308) -- 0:01:54 185000 -- (-891.256) (-897.962) [-895.162] (-892.382) * [-894.464] (-890.317) (-889.844) (-891.890) -- 0:01:54 Average standard deviation of split frequencies: 0.015207 185500 -- (-887.759) [-891.010] (-889.262) (-891.422) * (-890.489) (-893.400) [-889.344] (-891.264) -- 0:01:54 186000 -- (-887.638) [-895.016] (-900.235) (-893.286) * (-892.352) (-891.174) (-891.729) [-890.595] -- 0:01:53 186500 -- [-890.427] (-891.856) (-895.262) (-896.211) * (-895.395) [-893.506] (-892.431) (-896.235) -- 0:01:53 187000 -- (-889.042) (-893.530) (-901.189) [-890.710] * (-890.188) (-898.802) (-891.466) [-893.835] -- 0:01:53 187500 -- (-894.476) [-890.219] (-893.052) (-894.421) * [-897.502] (-888.531) (-887.738) (-890.275) -- 0:01:57 188000 -- [-894.315] (-898.173) (-896.385) (-895.898) * (-898.216) (-893.213) [-889.122] (-889.561) -- 0:01:56 188500 -- [-890.583] (-896.965) (-890.332) (-894.151) * [-894.888] (-890.158) (-890.499) (-892.148) -- 0:01:56 189000 -- (-889.457) [-890.150] (-890.499) (-897.838) * (-895.561) [-888.971] (-889.382) (-893.403) -- 0:01:55 189500 -- (-890.324) (-888.288) (-892.013) [-898.894] * [-892.859] (-899.440) (-901.051) (-888.037) -- 0:01:55 190000 -- (-889.754) (-893.711) [-889.296] (-891.866) * (-887.937) (-893.929) (-897.111) [-890.509] -- 0:01:55 Average standard deviation of split frequencies: 0.012362 190500 -- (-887.999) (-891.375) [-894.195] (-892.370) * (-890.592) (-895.413) (-893.351) [-886.814] -- 0:01:54 191000 -- (-891.886) (-889.973) [-893.202] (-891.331) * (-900.320) (-892.675) (-894.197) [-890.834] -- 0:01:54 191500 -- (-892.525) (-893.895) (-894.422) [-890.365] * (-894.998) (-890.901) [-891.950] (-889.437) -- 0:01:53 192000 -- (-892.118) [-888.297] (-889.142) (-894.711) * (-892.426) [-888.479] (-890.666) (-893.023) -- 0:01:53 192500 -- [-896.513] (-890.999) (-889.725) (-894.632) * (-891.255) [-886.542] (-891.820) (-900.006) -- 0:01:53 193000 -- (-891.410) (-895.371) [-892.199] (-895.128) * (-894.731) [-889.459] (-891.872) (-897.747) -- 0:01:52 193500 -- (-890.705) (-895.778) [-888.253] (-900.143) * (-893.769) [-888.066] (-894.157) (-895.476) -- 0:01:52 194000 -- (-889.754) (-897.522) [-890.634] (-893.280) * (-894.627) (-889.888) [-891.630] (-893.525) -- 0:01:52 194500 -- [-891.890] (-891.660) (-894.249) (-900.190) * (-891.324) (-888.859) [-891.316] (-896.342) -- 0:01:51 195000 -- (-886.724) (-893.890) (-889.275) [-890.679] * [-894.908] (-890.938) (-891.564) (-894.546) -- 0:01:55 Average standard deviation of split frequencies: 0.014431 195500 -- (-892.781) [-891.209] (-891.910) (-889.793) * [-891.767] (-895.099) (-894.987) (-893.609) -- 0:01:55 196000 -- [-890.863] (-892.225) (-895.581) (-890.443) * (-890.826) (-889.844) [-890.840] (-890.998) -- 0:01:54 196500 -- (-896.974) (-890.490) (-891.252) [-887.620] * (-890.436) (-893.181) [-892.104] (-890.849) -- 0:01:54 197000 -- [-890.576] (-896.717) (-891.532) (-888.868) * (-893.173) [-890.512] (-890.022) (-887.074) -- 0:01:54 197500 -- (-890.393) [-893.850] (-891.394) (-891.995) * (-888.072) [-890.365] (-890.485) (-893.486) -- 0:01:53 198000 -- (-894.049) (-892.146) (-892.990) [-899.719] * [-892.160] (-889.474) (-890.868) (-895.131) -- 0:01:53 198500 -- (-892.318) (-896.121) (-894.672) [-892.282] * (-895.420) (-896.565) (-892.174) [-888.935] -- 0:01:53 199000 -- (-892.279) [-889.195] (-893.783) (-897.264) * (-890.534) (-891.916) [-888.349] (-896.614) -- 0:01:52 199500 -- (-896.625) [-887.587] (-896.817) (-889.993) * [-890.089] (-894.399) (-891.168) (-901.147) -- 0:01:52 200000 -- (-892.627) [-893.540] (-889.453) (-886.867) * (-896.179) (-893.588) (-889.661) [-894.943] -- 0:01:51 Average standard deviation of split frequencies: 0.014095 200500 -- (-894.229) [-891.989] (-895.418) (-892.755) * [-887.451] (-890.003) (-889.842) (-894.237) -- 0:01:51 201000 -- (-901.576) (-891.508) [-894.074] (-896.228) * (-888.507) [-888.433] (-891.950) (-892.790) -- 0:01:51 201500 -- [-890.284] (-894.651) (-895.485) (-894.751) * (-893.657) (-890.348) [-893.776] (-889.681) -- 0:01:50 202000 -- (-888.123) (-895.309) [-890.488] (-890.164) * [-896.099] (-889.003) (-888.585) (-895.577) -- 0:01:54 202500 -- (-889.230) [-891.280] (-896.388) (-891.501) * (-891.819) [-889.848] (-891.677) (-887.008) -- 0:01:54 203000 -- [-889.186] (-896.965) (-894.356) (-890.034) * (-894.254) (-890.466) (-895.190) [-890.500] -- 0:01:53 203500 -- (-893.429) [-892.526] (-891.332) (-892.080) * (-892.876) (-897.344) [-891.623] (-893.898) -- 0:01:53 204000 -- (-893.001) (-894.827) [-890.674] (-891.571) * (-893.571) [-890.495] (-891.946) (-895.398) -- 0:01:53 204500 -- (-895.946) (-894.674) (-889.366) [-890.819] * [-895.224] (-890.035) (-893.104) (-894.674) -- 0:01:52 205000 -- (-894.624) (-897.132) [-890.317] (-894.031) * (-894.626) (-891.976) [-890.231] (-892.751) -- 0:01:52 Average standard deviation of split frequencies: 0.011442 205500 -- [-890.102] (-894.978) (-888.278) (-894.188) * [-890.172] (-893.245) (-889.870) (-895.314) -- 0:01:52 206000 -- [-892.944] (-889.357) (-892.111) (-890.431) * (-887.722) (-897.779) (-891.266) [-894.542] -- 0:01:51 206500 -- (-891.142) [-890.224] (-897.947) (-890.635) * (-891.247) (-894.979) [-898.391] (-894.464) -- 0:01:51 207000 -- (-890.838) [-892.331] (-897.735) (-889.575) * (-897.971) (-899.623) [-892.353] (-898.787) -- 0:01:51 207500 -- (-894.313) [-888.814] (-893.104) (-889.824) * [-893.574] (-897.085) (-893.582) (-891.150) -- 0:01:50 208000 -- [-893.757] (-892.406) (-892.070) (-890.028) * [-890.072] (-894.547) (-892.799) (-893.443) -- 0:01:50 208500 -- (-895.419) (-893.674) [-892.213] (-891.210) * [-889.443] (-894.303) (-890.525) (-889.504) -- 0:01:50 209000 -- [-900.274] (-892.092) (-895.869) (-893.877) * (-895.082) (-889.911) [-891.959] (-899.183) -- 0:01:53 209500 -- [-896.578] (-889.227) (-894.162) (-895.617) * [-891.964] (-890.029) (-894.101) (-893.095) -- 0:01:53 210000 -- (-893.546) (-886.992) [-891.824] (-894.517) * (-893.650) (-892.096) (-890.366) [-894.234] -- 0:01:52 Average standard deviation of split frequencies: 0.008951 210500 -- (-897.419) (-894.934) (-894.687) [-890.135] * [-888.859] (-895.509) (-897.305) (-889.909) -- 0:01:52 211000 -- [-893.162] (-890.963) (-891.287) (-891.788) * [-891.145] (-891.328) (-897.268) (-894.328) -- 0:01:52 211500 -- (-889.714) [-891.411] (-891.010) (-894.444) * (-888.726) [-888.746] (-901.629) (-896.363) -- 0:01:51 212000 -- [-894.008] (-899.496) (-898.915) (-888.885) * (-890.870) (-891.299) [-893.937] (-891.750) -- 0:01:51 212500 -- [-890.978] (-894.047) (-892.639) (-888.711) * (-892.691) [-891.262] (-896.588) (-893.931) -- 0:01:51 213000 -- (-893.670) (-895.187) [-889.075] (-888.453) * [-889.226] (-890.352) (-893.066) (-894.652) -- 0:01:50 213500 -- [-891.665] (-891.395) (-887.524) (-890.889) * [-891.807] (-888.089) (-898.210) (-893.377) -- 0:01:50 214000 -- (-890.271) (-893.935) [-887.165] (-889.883) * (-894.974) (-892.058) (-897.135) [-892.406] -- 0:01:50 214500 -- [-891.443] (-896.826) (-894.139) (-897.217) * [-890.225] (-890.448) (-894.531) (-889.068) -- 0:01:49 215000 -- (-896.120) (-893.159) [-894.145] (-897.760) * (-889.999) (-891.730) (-898.487) [-889.706] -- 0:01:49 Average standard deviation of split frequencies: 0.008730 215500 -- (-894.953) (-897.774) (-888.762) [-893.954] * [-889.644] (-893.833) (-900.752) (-894.529) -- 0:01:49 216000 -- [-890.895] (-893.782) (-893.342) (-890.574) * [-889.622] (-889.074) (-895.208) (-895.162) -- 0:01:52 216500 -- (-895.798) (-890.538) [-890.005] (-891.427) * (-893.330) (-895.406) (-899.613) [-891.054] -- 0:01:52 217000 -- (-892.248) [-890.950] (-890.207) (-890.737) * (-888.453) [-889.317] (-897.744) (-894.597) -- 0:01:51 217500 -- (-894.588) (-890.356) (-894.739) [-890.097] * (-890.286) (-890.846) (-890.618) [-889.939] -- 0:01:51 218000 -- (-898.622) (-894.865) [-890.425] (-889.160) * (-889.252) [-894.976] (-891.671) (-891.808) -- 0:01:51 218500 -- (-891.272) (-889.755) [-890.679] (-890.214) * (-894.654) [-890.773] (-898.866) (-891.292) -- 0:01:50 219000 -- (-892.939) [-891.167] (-890.751) (-889.906) * (-890.321) (-892.739) [-896.370] (-896.176) -- 0:01:50 219500 -- (-895.057) (-890.702) (-889.891) [-891.810] * (-889.873) (-890.372) (-893.086) [-891.593] -- 0:01:50 220000 -- (-891.070) (-896.231) [-890.281] (-889.388) * (-899.419) (-891.209) (-893.631) [-889.547] -- 0:01:49 Average standard deviation of split frequencies: 0.008545 220500 -- (-894.245) (-891.897) (-890.422) [-890.174] * (-892.571) [-889.074] (-891.557) (-890.695) -- 0:01:49 221000 -- [-892.600] (-896.376) (-891.617) (-893.618) * (-893.359) [-888.446] (-893.976) (-892.296) -- 0:01:49 221500 -- (-891.404) [-891.041] (-887.757) (-896.982) * (-891.896) (-894.069) (-895.311) [-891.017] -- 0:01:48 222000 -- (-896.765) (-888.880) [-891.750] (-899.990) * (-888.113) [-889.602] (-898.704) (-896.132) -- 0:01:48 222500 -- (-895.985) (-893.427) [-889.989] (-894.170) * (-888.094) (-893.223) [-890.391] (-890.912) -- 0:01:48 223000 -- (-896.566) (-890.433) (-892.259) [-893.631] * (-893.026) (-891.825) (-891.851) [-893.173] -- 0:01:51 223500 -- (-889.852) (-893.452) [-890.067] (-892.135) * (-891.257) (-899.475) [-901.911] (-893.277) -- 0:01:51 224000 -- (-888.625) [-893.059] (-897.132) (-889.086) * (-891.384) (-893.322) [-889.687] (-892.519) -- 0:01:50 224500 -- (-898.443) (-889.545) [-895.910] (-890.715) * (-891.463) (-890.780) [-888.907] (-889.747) -- 0:01:50 225000 -- (-892.132) (-891.707) (-891.024) [-889.935] * (-887.591) [-891.236] (-887.822) (-891.757) -- 0:01:50 Average standard deviation of split frequencies: 0.006258 225500 -- (-898.232) (-893.268) (-891.357) [-890.122] * (-893.421) [-889.360] (-887.744) (-897.423) -- 0:01:49 226000 -- (-893.044) (-888.266) [-895.857] (-889.992) * (-894.161) [-894.958] (-891.290) (-905.052) -- 0:01:49 226500 -- [-888.634] (-892.081) (-893.963) (-891.235) * [-894.221] (-894.915) (-895.793) (-894.910) -- 0:01:49 227000 -- (-890.249) (-891.379) (-893.945) [-892.681] * (-892.688) [-895.644] (-890.353) (-900.345) -- 0:01:48 227500 -- (-896.123) [-895.396] (-889.239) (-892.659) * (-894.033) (-891.633) [-890.952] (-898.508) -- 0:01:48 228000 -- (-890.350) (-891.869) [-892.095] (-895.871) * [-888.876] (-889.598) (-903.470) (-909.310) -- 0:01:48 228500 -- (-891.495) (-896.777) [-888.476] (-898.325) * [-889.623] (-892.138) (-896.022) (-897.857) -- 0:01:48 229000 -- (-891.210) [-896.157] (-891.957) (-894.585) * [-888.774] (-891.994) (-895.056) (-894.108) -- 0:01:47 229500 -- (-890.420) [-894.908] (-896.336) (-891.907) * (-886.871) (-889.058) (-897.673) [-895.938] -- 0:01:47 230000 -- (-898.409) [-894.779] (-892.111) (-891.198) * [-890.221] (-890.793) (-893.793) (-893.439) -- 0:01:50 Average standard deviation of split frequencies: 0.008175 230500 -- [-896.212] (-895.310) (-897.321) (-892.789) * (-889.962) (-891.213) [-895.702] (-893.748) -- 0:01:50 231000 -- [-893.582] (-895.799) (-895.107) (-893.000) * [-888.441] (-891.144) (-890.535) (-893.044) -- 0:01:49 231500 -- (-892.942) (-891.136) (-895.924) [-892.063] * [-895.487] (-891.088) (-888.252) (-895.641) -- 0:01:49 232000 -- (-894.326) [-887.160] (-900.423) (-891.560) * [-888.560] (-899.105) (-888.387) (-894.281) -- 0:01:49 232500 -- (-897.359) (-891.212) (-895.203) [-894.794] * (-894.598) (-900.831) (-892.768) [-896.433] -- 0:01:48 233000 -- [-888.948] (-893.922) (-900.419) (-894.141) * (-892.185) (-892.686) (-889.074) [-891.950] -- 0:01:48 233500 -- [-896.128] (-892.574) (-895.701) (-890.404) * (-887.756) (-895.799) [-889.070] (-893.535) -- 0:01:48 234000 -- (-886.628) [-890.415] (-895.645) (-891.335) * (-893.057) (-896.415) [-892.361] (-890.388) -- 0:01:48 234500 -- [-889.356] (-895.476) (-896.540) (-895.529) * [-892.183] (-894.623) (-889.736) (-891.119) -- 0:01:47 235000 -- [-892.318] (-890.026) (-893.079) (-892.299) * (-891.931) (-888.257) (-892.114) [-892.958] -- 0:01:47 Average standard deviation of split frequencies: 0.005992 235500 -- (-898.629) [-895.632] (-894.969) (-891.788) * (-893.462) (-891.610) [-892.814] (-889.120) -- 0:01:47 236000 -- [-889.634] (-890.238) (-889.101) (-890.161) * (-895.088) [-889.381] (-891.139) (-890.164) -- 0:01:46 236500 -- (-893.578) [-889.386] (-889.195) (-887.352) * [-892.341] (-891.539) (-891.739) (-892.355) -- 0:01:46 237000 -- (-889.157) (-890.089) [-890.570] (-894.893) * (-891.165) (-889.336) (-892.026) [-887.717] -- 0:01:46 237500 -- [-893.112] (-889.217) (-892.636) (-890.153) * (-887.783) [-894.579] (-891.892) (-891.769) -- 0:01:49 238000 -- (-892.992) (-889.342) [-888.714] (-901.889) * [-890.208] (-892.608) (-889.736) (-890.184) -- 0:01:48 238500 -- (-889.206) (-888.237) [-892.122] (-893.631) * [-888.500] (-892.947) (-888.962) (-896.997) -- 0:01:48 239000 -- (-891.631) (-889.378) [-886.700] (-889.287) * (-891.455) [-894.394] (-888.691) (-890.420) -- 0:01:48 239500 -- (-893.488) (-888.907) [-889.444] (-893.005) * [-891.404] (-890.401) (-890.760) (-892.956) -- 0:01:47 240000 -- (-893.696) (-894.793) (-891.645) [-893.327] * (-888.823) [-890.115] (-889.615) (-897.883) -- 0:01:47 Average standard deviation of split frequencies: 0.007835 240500 -- (-897.929) (-893.478) (-890.145) [-896.801] * (-890.919) [-891.226] (-890.690) (-892.965) -- 0:01:47 241000 -- (-896.446) (-892.474) [-889.428] (-890.124) * (-888.602) (-892.862) [-891.955] (-888.067) -- 0:01:47 241500 -- (-897.408) (-888.442) [-888.687] (-892.627) * [-891.292] (-893.501) (-892.108) (-888.154) -- 0:01:46 242000 -- [-898.087] (-890.506) (-893.857) (-898.350) * (-892.214) (-896.525) (-891.022) [-890.457] -- 0:01:46 242500 -- [-891.007] (-890.239) (-891.257) (-897.801) * (-890.007) (-888.531) [-887.565] (-888.337) -- 0:01:46 243000 -- [-891.214] (-888.908) (-889.457) (-893.086) * (-889.783) [-890.529] (-890.544) (-889.941) -- 0:01:45 243500 -- (-893.817) [-892.408] (-892.670) (-891.162) * [-894.541] (-888.776) (-891.831) (-894.865) -- 0:01:45 244000 -- (-890.694) [-890.084] (-898.017) (-893.199) * (-891.059) (-891.977) [-888.825] (-893.360) -- 0:01:45 244500 -- (-888.059) (-892.637) (-891.691) [-891.208] * [-890.465] (-896.768) (-888.835) (-892.243) -- 0:01:48 245000 -- (-891.170) (-890.784) (-891.641) [-893.536] * (-888.861) [-892.873] (-891.497) (-896.860) -- 0:01:47 Average standard deviation of split frequencies: 0.007665 245500 -- (-889.937) (-895.256) [-890.180] (-895.012) * (-892.210) (-893.952) [-894.916] (-893.895) -- 0:01:47 246000 -- (-892.759) [-890.254] (-891.283) (-893.142) * (-894.165) (-895.602) (-892.525) [-889.733] -- 0:01:47 246500 -- (-891.276) [-890.052] (-898.595) (-892.252) * [-891.474] (-889.663) (-891.724) (-888.765) -- 0:01:46 247000 -- [-896.877] (-895.760) (-889.166) (-896.222) * (-890.622) [-892.293] (-893.872) (-893.463) -- 0:01:46 247500 -- (-894.247) (-896.072) [-891.582] (-893.578) * (-888.634) [-894.145] (-894.560) (-898.282) -- 0:01:46 248000 -- (-889.920) (-888.195) [-891.872] (-891.071) * (-889.353) (-894.376) [-892.835] (-900.064) -- 0:01:46 248500 -- (-893.400) (-891.769) (-890.684) [-892.029] * (-889.187) [-890.536] (-889.557) (-891.009) -- 0:01:45 249000 -- (-890.942) [-890.612] (-894.690) (-890.200) * [-890.944] (-889.796) (-892.424) (-891.811) -- 0:01:45 249500 -- (-897.514) (-890.870) (-890.621) [-886.462] * (-890.205) (-894.418) (-894.743) [-889.250] -- 0:01:45 250000 -- (-890.840) (-888.427) (-895.868) [-889.188] * (-890.300) (-901.007) (-897.926) [-890.028] -- 0:01:44 Average standard deviation of split frequencies: 0.005642 250500 -- (-893.177) (-886.798) (-891.923) [-892.608] * [-891.063] (-896.138) (-894.332) (-893.774) -- 0:01:44 251000 -- (-886.860) (-896.270) [-888.751] (-891.252) * (-897.374) [-891.100] (-894.618) (-890.902) -- 0:01:44 251500 -- (-892.601) [-890.157] (-892.032) (-896.230) * [-889.224] (-893.853) (-892.669) (-893.418) -- 0:01:47 252000 -- (-889.803) (-889.358) [-887.093] (-893.802) * [-889.633] (-895.029) (-891.787) (-890.104) -- 0:01:46 252500 -- (-889.244) (-892.758) (-891.373) [-892.958] * [-891.113] (-896.790) (-893.504) (-890.111) -- 0:01:46 253000 -- [-897.438] (-898.812) (-896.074) (-890.136) * (-889.765) (-895.866) (-889.855) [-888.612] -- 0:01:46 253500 -- (-896.213) (-898.298) [-896.462] (-892.591) * (-891.077) (-894.127) [-889.518] (-894.238) -- 0:01:46 254000 -- [-889.802] (-891.506) (-892.185) (-895.058) * (-887.647) (-893.661) (-887.001) [-890.641] -- 0:01:45 254500 -- (-891.232) (-890.659) [-888.853] (-892.954) * (-893.776) (-901.864) (-898.238) [-893.786] -- 0:01:45 255000 -- (-897.351) (-892.707) [-888.899] (-892.441) * [-888.801] (-899.622) (-894.193) (-893.809) -- 0:01:45 Average standard deviation of split frequencies: 0.009207 255500 -- (-888.456) (-889.237) [-887.689] (-892.066) * (-892.371) (-892.755) [-891.919] (-899.926) -- 0:01:44 256000 -- (-890.612) (-893.804) (-891.749) [-888.987] * (-894.715) (-891.842) [-891.158] (-892.820) -- 0:01:44 256500 -- (-895.030) (-891.417) (-890.874) [-895.097] * (-894.815) [-893.164] (-893.300) (-889.034) -- 0:01:44 257000 -- (-890.206) (-887.738) [-891.846] (-898.772) * (-887.733) [-903.768] (-890.715) (-896.163) -- 0:01:44 257500 -- [-891.674] (-887.303) (-892.761) (-899.601) * (-891.661) (-895.619) [-896.756] (-896.379) -- 0:01:43 258000 -- (-889.696) (-890.758) [-888.806] (-897.180) * (-892.947) (-895.727) (-890.500) [-888.210] -- 0:01:43 258500 -- [-891.885] (-894.120) (-890.067) (-893.127) * (-890.213) [-894.290] (-888.019) (-895.974) -- 0:01:46 259000 -- (-893.846) (-897.505) [-891.700] (-894.424) * (-893.140) (-896.198) [-888.629] (-897.121) -- 0:01:45 259500 -- (-892.302) [-890.092] (-893.672) (-890.184) * (-893.378) (-893.957) [-891.618] (-892.719) -- 0:01:45 260000 -- (-895.152) (-889.799) (-894.424) [-891.457] * (-886.763) (-888.734) [-891.974] (-890.757) -- 0:01:45 Average standard deviation of split frequencies: 0.007234 260500 -- (-891.709) [-888.235] (-893.315) (-889.955) * [-892.960] (-888.588) (-892.612) (-892.831) -- 0:01:45 261000 -- [-894.436] (-890.894) (-895.372) (-895.564) * (-890.759) (-889.517) [-888.321] (-892.629) -- 0:01:44 261500 -- (-891.793) (-889.981) [-892.683] (-893.229) * (-895.007) (-895.193) (-889.034) [-901.452] -- 0:01:44 262000 -- [-901.004] (-887.205) (-894.536) (-895.241) * (-894.731) (-893.082) [-890.695] (-892.292) -- 0:01:44 262500 -- (-900.705) (-899.372) [-890.774] (-893.869) * (-887.324) [-895.873] (-896.144) (-893.442) -- 0:01:43 263000 -- [-892.975] (-889.585) (-890.910) (-890.785) * [-893.212] (-893.477) (-891.460) (-891.142) -- 0:01:43 263500 -- [-890.273] (-890.584) (-887.979) (-899.051) * (-891.625) (-891.005) [-891.814] (-893.078) -- 0:01:43 264000 -- (-889.444) [-890.561] (-891.100) (-894.343) * (-887.826) (-894.414) (-890.792) [-888.410] -- 0:01:43 264500 -- [-890.594] (-888.528) (-892.550) (-890.278) * [-888.864] (-889.331) (-895.930) (-892.776) -- 0:01:42 265000 -- (-894.087) (-892.491) [-891.718] (-890.993) * (-891.442) [-891.557] (-895.772) (-893.249) -- 0:01:42 Average standard deviation of split frequencies: 0.007089 265500 -- (-894.705) (-890.556) (-889.859) [-891.044] * (-895.392) [-891.005] (-892.407) (-892.315) -- 0:01:45 266000 -- [-894.509] (-886.900) (-889.605) (-892.915) * (-893.448) (-901.866) [-893.075] (-896.235) -- 0:01:44 266500 -- (-889.925) (-892.418) (-890.730) [-889.948] * (-889.425) (-892.078) (-894.193) [-893.553] -- 0:01:44 267000 -- (-899.322) (-891.855) [-889.830] (-889.246) * (-890.311) (-895.216) [-891.593] (-899.080) -- 0:01:44 267500 -- (-894.707) (-895.783) (-887.404) [-888.692] * [-889.106] (-893.712) (-899.812) (-890.891) -- 0:01:44 268000 -- (-892.798) [-899.641] (-889.429) (-889.725) * (-888.540) (-894.109) (-889.597) [-892.171] -- 0:01:43 268500 -- (-894.145) (-894.015) [-891.773] (-891.698) * (-897.685) (-895.095) (-889.439) [-891.803] -- 0:01:43 269000 -- (-887.097) [-889.600] (-890.736) (-888.085) * (-895.495) (-895.139) (-889.507) [-895.872] -- 0:01:43 269500 -- [-893.536] (-895.408) (-894.844) (-890.566) * (-895.437) (-900.628) (-890.132) [-893.875] -- 0:01:43 270000 -- (-893.553) (-888.786) (-892.435) [-896.126] * [-891.494] (-896.344) (-892.601) (-897.223) -- 0:01:42 Average standard deviation of split frequencies: 0.006967 270500 -- (-894.331) (-892.133) (-891.818) [-888.359] * [-891.489] (-895.313) (-892.868) (-895.835) -- 0:01:42 271000 -- (-892.450) [-891.070] (-895.344) (-895.499) * (-890.972) (-897.634) (-893.021) [-894.654] -- 0:01:42 271500 -- (-895.021) (-895.475) (-891.562) [-889.912] * [-889.361] (-895.713) (-893.623) (-896.690) -- 0:01:41 272000 -- [-896.551] (-888.647) (-889.788) (-893.230) * [-886.658] (-890.114) (-891.935) (-896.369) -- 0:01:41 272500 -- (-889.514) (-891.053) (-893.306) [-891.600] * [-892.903] (-892.954) (-893.345) (-892.766) -- 0:01:44 273000 -- (-895.539) [-888.334] (-890.673) (-892.589) * (-893.510) (-890.134) [-890.926] (-894.798) -- 0:01:43 273500 -- (-888.891) (-892.959) (-892.766) [-891.478] * (-894.327) (-891.006) (-893.808) [-887.129] -- 0:01:43 274000 -- (-890.428) [-892.869] (-889.343) (-889.716) * (-890.419) [-893.116] (-893.962) (-897.145) -- 0:01:43 274500 -- [-890.028] (-891.888) (-895.089) (-890.578) * (-903.837) (-893.356) (-890.153) [-894.487] -- 0:01:43 275000 -- (-891.591) [-893.198] (-892.316) (-899.320) * (-899.220) [-892.399] (-892.606) (-889.444) -- 0:01:42 Average standard deviation of split frequencies: 0.008540 275500 -- (-890.928) [-892.139] (-891.733) (-895.180) * (-892.954) (-895.392) (-893.508) [-890.479] -- 0:01:42 276000 -- [-890.559] (-895.218) (-891.773) (-891.394) * (-892.834) (-892.176) (-893.940) [-893.024] -- 0:01:42 276500 -- (-891.434) [-896.388] (-889.828) (-890.711) * (-889.682) (-895.517) (-893.133) [-895.890] -- 0:01:42 277000 -- [-893.769] (-891.947) (-893.983) (-892.306) * [-887.280] (-895.508) (-888.751) (-892.833) -- 0:01:41 277500 -- (-891.806) (-895.878) (-894.853) [-892.661] * (-891.649) (-887.757) [-888.195] (-893.947) -- 0:01:41 278000 -- [-892.558] (-891.757) (-891.581) (-895.610) * (-886.805) (-889.649) [-894.575] (-891.950) -- 0:01:41 278500 -- (-888.949) (-893.965) [-890.038] (-891.639) * (-889.009) (-895.350) (-897.908) [-892.617] -- 0:01:41 279000 -- [-891.077] (-888.679) (-891.550) (-892.030) * (-900.058) [-893.903] (-896.283) (-889.596) -- 0:01:40 279500 -- (-892.183) [-888.973] (-891.168) (-892.738) * (-892.722) (-893.117) [-894.984] (-889.304) -- 0:01:43 280000 -- (-897.363) (-887.577) (-889.021) [-888.053] * (-890.479) (-890.748) [-896.916] (-891.746) -- 0:01:42 Average standard deviation of split frequencies: 0.006718 280500 -- [-893.057] (-890.842) (-892.688) (-887.846) * (-890.778) [-894.567] (-893.514) (-889.578) -- 0:01:42 281000 -- (-895.335) (-892.746) [-891.165] (-891.264) * [-892.156] (-894.114) (-889.344) (-893.072) -- 0:01:42 281500 -- (-892.070) (-895.277) (-889.870) [-891.885] * [-889.135] (-891.089) (-891.221) (-893.555) -- 0:01:42 282000 -- [-889.958] (-894.436) (-890.494) (-887.620) * (-891.812) [-888.277] (-889.887) (-898.327) -- 0:01:41 282500 -- [-896.630] (-892.462) (-890.768) (-892.479) * [-888.445] (-891.285) (-889.127) (-895.908) -- 0:01:41 283000 -- (-896.677) (-891.589) (-895.408) [-896.557] * (-891.726) (-890.318) [-892.527] (-894.057) -- 0:01:41 283500 -- [-890.630] (-894.355) (-894.693) (-890.962) * [-891.883] (-898.289) (-894.420) (-897.653) -- 0:01:41 284000 -- [-891.506] (-890.773) (-894.774) (-888.890) * [-889.994] (-894.251) (-896.598) (-890.827) -- 0:01:40 284500 -- (-891.218) [-892.380] (-892.681) (-889.972) * [-893.220] (-892.694) (-890.772) (-891.193) -- 0:01:40 285000 -- (-890.500) (-889.350) [-892.160] (-896.074) * (-889.642) (-892.510) (-892.317) [-890.992] -- 0:01:40 Average standard deviation of split frequencies: 0.008241 285500 -- (-893.538) [-891.842] (-894.989) (-890.787) * (-893.096) [-892.005] (-889.812) (-889.004) -- 0:01:40 286000 -- (-889.135) (-887.530) [-894.020] (-893.434) * (-892.230) (-890.406) (-894.366) [-891.820] -- 0:01:39 286500 -- (-895.754) (-896.188) [-888.164] (-889.342) * (-894.885) (-891.188) [-889.970] (-886.976) -- 0:01:42 287000 -- [-894.506] (-893.289) (-888.357) (-888.569) * (-892.641) (-892.659) (-894.105) [-890.628] -- 0:01:41 287500 -- (-902.592) (-894.522) (-895.848) [-890.467] * (-889.552) [-890.667] (-896.563) (-892.067) -- 0:01:41 288000 -- (-892.356) (-894.564) (-898.756) [-893.312] * [-893.914] (-890.655) (-898.465) (-895.753) -- 0:01:41 288500 -- [-890.255] (-896.838) (-894.950) (-900.408) * (-891.633) (-891.650) [-892.219] (-896.177) -- 0:01:41 289000 -- (-889.461) (-892.870) [-894.963] (-889.114) * (-889.500) (-888.863) [-895.979] (-894.048) -- 0:01:40 289500 -- [-891.300] (-887.179) (-892.519) (-894.652) * (-891.656) (-895.083) [-891.390] (-894.602) -- 0:01:40 290000 -- (-887.621) (-893.550) [-891.446] (-889.974) * (-892.865) (-889.515) [-896.559] (-895.625) -- 0:01:40 Average standard deviation of split frequencies: 0.006487 290500 -- (-893.716) (-892.103) [-890.281] (-888.759) * [-889.096] (-889.126) (-897.262) (-892.651) -- 0:01:40 291000 -- (-890.871) [-890.767] (-891.590) (-896.992) * [-890.471] (-890.533) (-896.952) (-896.090) -- 0:01:39 291500 -- [-886.797] (-897.483) (-898.817) (-899.088) * [-888.895] (-894.934) (-889.797) (-894.046) -- 0:01:39 292000 -- (-891.083) (-889.110) (-892.876) [-888.545] * (-897.591) [-890.967] (-891.894) (-895.153) -- 0:01:39 292500 -- (-891.827) [-892.440] (-892.467) (-890.881) * (-893.113) (-891.350) [-896.474] (-890.869) -- 0:01:39 293000 -- (-893.704) (-892.936) (-894.098) [-893.934] * [-892.718] (-894.244) (-892.707) (-891.835) -- 0:01:38 293500 -- (-893.253) (-892.440) [-892.417] (-899.663) * (-890.286) [-889.571] (-895.461) (-897.924) -- 0:01:41 294000 -- (-891.706) (-892.233) [-889.256] (-894.942) * [-891.916] (-889.719) (-894.798) (-897.062) -- 0:01:40 294500 -- (-888.079) [-892.434] (-890.862) (-895.485) * (-890.740) (-889.631) (-896.843) [-893.085] -- 0:01:40 295000 -- (-890.449) [-890.565] (-893.277) (-891.798) * (-891.727) (-900.820) (-890.852) [-888.811] -- 0:01:40 Average standard deviation of split frequencies: 0.007963 295500 -- (-890.127) (-897.202) [-894.701] (-890.086) * (-891.488) (-894.063) [-892.478] (-892.143) -- 0:01:40 296000 -- (-893.581) (-895.102) (-892.430) [-890.367] * (-890.183) [-893.017] (-892.217) (-893.885) -- 0:01:39 296500 -- (-893.966) (-894.361) [-888.889] (-888.946) * (-893.998) [-897.036] (-891.855) (-889.456) -- 0:01:39 297000 -- [-889.719] (-893.670) (-892.661) (-892.440) * [-889.576] (-890.858) (-891.880) (-894.573) -- 0:01:39 297500 -- (-892.223) (-890.976) [-889.967] (-893.578) * [-892.181] (-890.720) (-891.268) (-892.477) -- 0:01:39 298000 -- (-893.951) (-890.435) [-895.670] (-892.831) * [-889.488] (-894.118) (-894.830) (-893.313) -- 0:01:38 298500 -- (-890.500) (-888.104) [-888.682] (-890.806) * (-893.446) (-893.969) [-892.419] (-896.515) -- 0:01:38 299000 -- (-895.471) (-889.983) [-890.587] (-888.825) * [-892.341] (-897.481) (-892.596) (-896.607) -- 0:01:38 299500 -- (-889.647) (-893.342) (-887.692) [-891.129] * (-897.638) [-892.332] (-891.442) (-898.192) -- 0:01:38 300000 -- [-895.421] (-890.014) (-887.127) (-897.203) * (-891.392) [-890.850] (-896.713) (-890.424) -- 0:01:37 Average standard deviation of split frequencies: 0.004704 300500 -- [-888.793] (-892.679) (-891.787) (-897.263) * (-892.686) (-889.901) [-893.976] (-891.110) -- 0:01:40 301000 -- [-892.102] (-890.150) (-897.731) (-894.917) * (-895.446) [-892.054] (-894.768) (-893.331) -- 0:01:39 301500 -- (-892.822) (-895.191) (-890.367) [-890.176] * (-898.139) [-891.244] (-897.090) (-892.429) -- 0:01:39 302000 -- (-891.111) (-889.838) [-889.348] (-892.434) * (-896.224) (-893.048) (-890.607) [-890.981] -- 0:01:39 302500 -- [-891.243] (-890.572) (-889.943) (-893.238) * (-888.135) (-893.848) [-890.753] (-891.043) -- 0:01:39 303000 -- (-896.551) [-891.622] (-898.338) (-897.171) * (-897.858) [-893.054] (-892.158) (-888.557) -- 0:01:38 303500 -- (-892.389) (-899.617) (-889.072) [-892.426] * (-893.512) (-890.475) (-896.535) [-890.801] -- 0:01:38 304000 -- [-893.110] (-892.332) (-894.881) (-892.823) * (-895.452) [-889.173] (-893.695) (-889.097) -- 0:01:38 304500 -- (-892.072) (-897.550) (-896.366) [-891.445] * [-890.338] (-890.873) (-895.188) (-893.854) -- 0:01:38 305000 -- (-892.362) [-892.257] (-897.430) (-893.728) * (-892.498) (-890.848) [-892.818] (-891.640) -- 0:01:37 Average standard deviation of split frequencies: 0.004622 305500 -- (-890.429) [-888.116] (-895.669) (-892.001) * (-891.526) (-891.220) (-889.249) [-898.289] -- 0:01:37 306000 -- [-890.973] (-892.908) (-893.520) (-898.247) * (-892.504) [-891.852] (-896.589) (-889.782) -- 0:01:37 306500 -- (-891.065) [-890.899] (-896.750) (-894.097) * (-893.704) (-893.667) (-895.912) [-891.517] -- 0:01:37 307000 -- (-893.218) (-892.662) (-892.086) [-892.528] * (-890.712) [-889.707] (-894.398) (-891.234) -- 0:01:37 307500 -- (-891.193) [-890.623] (-891.351) (-891.106) * (-891.193) (-892.002) (-895.229) [-888.315] -- 0:01:39 308000 -- (-893.156) [-890.203] (-897.872) (-893.110) * [-891.685] (-896.982) (-891.268) (-891.180) -- 0:01:38 308500 -- (-892.381) (-889.577) [-891.533] (-897.408) * (-894.857) (-892.231) [-893.094] (-890.224) -- 0:01:38 309000 -- (-893.880) [-891.169] (-892.090) (-891.711) * (-889.225) (-889.463) (-893.637) [-891.946] -- 0:01:38 309500 -- (-894.607) [-892.549] (-892.171) (-899.746) * (-889.774) [-893.113] (-887.618) (-896.828) -- 0:01:38 310000 -- (-892.649) [-890.814] (-893.633) (-906.479) * (-890.854) (-891.677) (-889.505) [-893.767] -- 0:01:37 Average standard deviation of split frequencies: 0.001517 310500 -- (-886.636) (-890.726) [-892.926] (-898.850) * (-889.155) (-890.239) [-890.482] (-894.673) -- 0:01:37 311000 -- (-890.774) [-892.292] (-893.067) (-891.630) * (-891.257) (-895.938) [-890.824] (-888.938) -- 0:01:37 311500 -- (-896.512) (-891.208) [-893.303] (-894.387) * (-894.303) (-899.115) (-894.016) [-894.619] -- 0:01:37 312000 -- [-890.660] (-892.112) (-888.228) (-893.685) * [-887.961] (-892.123) (-891.150) (-892.606) -- 0:01:37 312500 -- (-893.175) [-889.091] (-892.137) (-890.403) * (-890.485) (-890.123) (-889.878) [-890.874] -- 0:01:36 313000 -- (-889.343) (-893.044) (-891.339) [-891.760] * [-892.764] (-890.057) (-889.844) (-893.060) -- 0:01:36 313500 -- (-890.856) (-889.394) (-889.764) [-889.858] * (-895.171) [-890.931] (-894.994) (-890.712) -- 0:01:36 314000 -- [-888.184] (-893.793) (-889.310) (-893.702) * (-900.407) [-892.606] (-887.507) (-892.352) -- 0:01:36 314500 -- (-890.630) (-889.086) [-890.009] (-893.846) * (-901.472) (-888.279) (-893.376) [-890.463] -- 0:01:38 315000 -- (-900.303) [-893.951] (-894.316) (-890.882) * (-895.489) (-891.181) (-893.706) [-891.030] -- 0:01:37 Average standard deviation of split frequencies: 0.001492 315500 -- (-893.337) [-895.174] (-889.379) (-889.779) * (-895.762) [-891.657] (-896.394) (-892.053) -- 0:01:37 316000 -- [-890.815] (-894.544) (-892.455) (-893.451) * (-889.370) (-891.316) (-890.003) [-891.887] -- 0:01:37 316500 -- (-888.680) (-890.318) [-895.644] (-893.693) * (-892.081) [-888.941] (-890.268) (-892.973) -- 0:01:37 317000 -- (-888.734) [-893.005] (-891.151) (-892.746) * (-894.176) [-892.348] (-890.522) (-887.799) -- 0:01:36 317500 -- (-891.187) [-893.444] (-894.944) (-889.607) * (-891.348) (-891.852) [-892.597] (-892.751) -- 0:01:36 318000 -- (-891.670) (-897.007) [-892.624] (-893.264) * (-889.071) (-894.383) [-891.532] (-892.766) -- 0:01:36 318500 -- (-891.271) (-893.325) (-889.229) [-889.910] * (-891.297) [-890.983] (-890.416) (-890.885) -- 0:01:36 319000 -- (-893.670) [-894.576] (-889.831) (-891.619) * [-893.080] (-891.596) (-894.119) (-891.089) -- 0:01:36 319500 -- [-894.577] (-890.486) (-888.194) (-895.100) * (-890.892) [-889.651] (-895.161) (-893.356) -- 0:01:35 320000 -- (-899.090) [-895.217] (-887.342) (-891.949) * (-893.528) [-892.305] (-890.853) (-894.944) -- 0:01:35 Average standard deviation of split frequencies: 0.001470 320500 -- (-891.350) (-890.022) (-889.640) [-897.259] * (-897.924) (-891.956) [-890.060] (-890.328) -- 0:01:35 321000 -- [-892.149] (-888.259) (-891.367) (-891.902) * (-895.023) (-892.256) [-888.161] (-893.231) -- 0:01:35 321500 -- (-896.259) (-893.562) (-889.408) [-889.630] * (-895.230) (-886.994) [-891.663] (-890.576) -- 0:01:37 322000 -- [-889.206] (-894.171) (-888.636) (-890.373) * (-889.877) [-894.169] (-888.929) (-890.969) -- 0:01:36 322500 -- (-890.510) (-895.729) [-891.245] (-889.677) * (-888.324) (-894.725) [-888.239] (-890.561) -- 0:01:36 323000 -- [-893.655] (-897.385) (-889.331) (-892.952) * (-896.538) [-893.482] (-890.422) (-892.729) -- 0:01:36 323500 -- (-891.130) [-891.002] (-888.410) (-887.586) * (-891.397) [-891.644] (-895.794) (-894.144) -- 0:01:36 324000 -- (-894.841) (-893.349) [-891.956] (-892.058) * (-893.081) (-893.668) [-892.258] (-887.633) -- 0:01:35 324500 -- (-892.662) (-889.398) (-890.150) [-888.167] * (-907.349) (-897.447) [-893.923] (-890.369) -- 0:01:35 325000 -- (-894.642) (-891.868) [-891.907] (-894.743) * (-893.610) (-896.829) (-891.490) [-888.932] -- 0:01:35 Average standard deviation of split frequencies: 0.002892 325500 -- (-896.774) [-890.483] (-889.332) (-894.532) * (-893.801) [-893.827] (-894.404) (-895.134) -- 0:01:35 326000 -- (-892.684) [-893.510] (-888.695) (-892.523) * (-898.127) (-894.832) (-888.869) [-888.773] -- 0:01:35 326500 -- (-889.806) (-891.032) (-891.236) [-889.635] * (-891.979) (-895.198) (-887.325) [-895.840] -- 0:01:34 327000 -- (-890.762) [-888.750] (-891.224) (-891.333) * (-893.642) [-889.114] (-892.051) (-893.833) -- 0:01:34 327500 -- (-889.138) (-895.508) [-889.552] (-890.878) * (-894.273) (-892.016) [-888.899] (-893.039) -- 0:01:34 328000 -- (-891.067) [-890.376] (-891.399) (-894.127) * (-889.734) [-889.729] (-892.400) (-892.219) -- 0:01:34 328500 -- (-892.142) (-892.681) [-890.793] (-892.572) * [-888.034] (-892.237) (-890.363) (-891.490) -- 0:01:36 329000 -- [-892.834] (-890.661) (-895.400) (-891.018) * (-892.902) (-889.808) (-894.566) [-887.511] -- 0:01:35 329500 -- (-893.041) (-893.611) [-890.831] (-891.089) * [-892.901] (-888.745) (-892.794) (-891.841) -- 0:01:35 330000 -- (-896.169) (-892.480) [-896.535] (-894.223) * (-893.902) (-895.529) (-894.927) [-894.172] -- 0:01:35 Average standard deviation of split frequencies: 0.004277 330500 -- (-891.955) (-897.685) [-893.866] (-892.616) * (-890.419) (-891.397) (-894.443) [-899.015] -- 0:01:35 331000 -- (-890.478) (-891.218) [-894.296] (-894.636) * (-894.129) (-893.601) (-892.536) [-896.032] -- 0:01:34 331500 -- (-891.173) [-891.403] (-895.430) (-893.593) * (-895.551) (-895.187) [-890.993] (-893.646) -- 0:01:34 332000 -- (-892.016) [-894.652] (-894.727) (-893.783) * (-899.013) (-893.319) [-894.010] (-893.692) -- 0:01:34 332500 -- (-892.266) (-891.913) [-893.273] (-890.669) * (-897.511) (-889.646) (-892.284) [-897.605] -- 0:01:34 333000 -- (-892.596) (-891.028) (-899.126) [-895.480] * (-893.748) [-897.839] (-893.365) (-892.445) -- 0:01:34 333500 -- (-891.615) (-893.059) [-893.888] (-889.705) * (-894.356) (-895.061) [-893.485] (-893.743) -- 0:01:33 334000 -- [-890.031] (-904.044) (-900.914) (-895.461) * (-890.925) [-890.057] (-892.848) (-891.055) -- 0:01:33 334500 -- [-892.231] (-889.287) (-892.840) (-896.740) * (-896.782) (-899.015) [-891.738] (-890.089) -- 0:01:33 335000 -- [-890.928] (-892.272) (-890.108) (-894.857) * (-891.947) (-889.793) (-890.053) [-887.570] -- 0:01:33 Average standard deviation of split frequencies: 0.004209 335500 -- (-888.635) [-890.194] (-891.285) (-892.119) * [-893.390] (-892.554) (-891.646) (-892.050) -- 0:01:35 336000 -- (-893.659) [-890.578] (-898.074) (-891.398) * (-892.137) (-895.016) (-888.935) [-890.817] -- 0:01:34 336500 -- (-891.917) [-888.599] (-889.363) (-896.179) * (-892.001) [-890.156] (-894.300) (-891.607) -- 0:01:34 337000 -- (-892.263) [-890.488] (-891.181) (-891.246) * (-897.038) [-889.712] (-898.255) (-890.971) -- 0:01:34 337500 -- (-893.684) [-888.313] (-894.035) (-895.151) * [-888.343] (-892.294) (-892.772) (-890.602) -- 0:01:34 338000 -- (-893.201) [-889.337] (-891.567) (-889.273) * (-895.866) (-893.033) [-889.796] (-888.124) -- 0:01:34 338500 -- [-893.226] (-889.264) (-894.363) (-888.829) * [-890.464] (-889.213) (-888.471) (-890.243) -- 0:01:33 339000 -- (-891.652) [-891.682] (-891.246) (-892.109) * (-894.995) (-892.323) (-889.750) [-888.186] -- 0:01:33 339500 -- (-899.829) (-889.867) [-889.710] (-889.345) * (-892.175) (-891.157) (-892.524) [-890.026] -- 0:01:33 340000 -- (-896.051) (-891.571) (-897.034) [-886.676] * (-891.861) (-893.272) [-896.128] (-891.580) -- 0:01:33 Average standard deviation of split frequencies: 0.008303 340500 -- (-890.891) [-889.452] (-889.364) (-892.439) * (-891.924) (-890.240) [-892.110] (-891.723) -- 0:01:32 341000 -- (-892.784) [-888.280] (-890.564) (-891.818) * [-893.156] (-893.030) (-891.933) (-890.488) -- 0:01:32 341500 -- (-895.233) (-888.575) (-891.346) [-893.092] * (-896.813) [-888.481] (-885.318) (-890.781) -- 0:01:32 342000 -- (-892.129) [-891.845] (-897.414) (-889.860) * (-898.688) (-892.054) (-891.278) [-893.523] -- 0:01:32 342500 -- (-892.033) (-897.764) (-890.331) [-891.782] * (-893.955) [-894.963] (-893.780) (-894.192) -- 0:01:32 343000 -- (-902.260) (-890.642) [-892.011] (-888.202) * [-891.804] (-888.550) (-892.672) (-890.576) -- 0:01:33 343500 -- (-894.711) [-889.587] (-894.102) (-895.756) * (-894.259) (-894.071) [-894.146] (-894.008) -- 0:01:33 344000 -- (-890.069) (-895.237) (-894.202) [-894.949] * (-895.222) (-897.093) (-900.183) [-891.063] -- 0:01:33 344500 -- (-891.270) [-889.545] (-896.486) (-896.986) * (-896.250) (-899.789) [-892.991] (-890.595) -- 0:01:33 345000 -- [-892.362] (-896.709) (-891.262) (-894.506) * (-890.150) (-900.635) (-894.173) [-894.096] -- 0:01:33 Average standard deviation of split frequencies: 0.008175 345500 -- (-891.470) (-895.770) [-895.771] (-894.591) * (-894.715) (-900.153) [-897.932] (-895.624) -- 0:01:32 346000 -- (-894.189) (-900.251) (-895.664) [-891.594] * (-890.060) (-901.997) (-893.668) [-889.978] -- 0:01:32 346500 -- (-891.615) (-893.255) [-892.416] (-894.190) * (-890.539) [-894.238] (-893.462) (-892.882) -- 0:01:32 347000 -- [-900.437] (-893.905) (-896.053) (-890.613) * (-890.061) (-894.417) [-893.670] (-896.877) -- 0:01:32 347500 -- (-893.158) [-890.572] (-891.599) (-891.758) * (-899.400) (-896.742) [-900.281] (-894.114) -- 0:01:32 348000 -- (-894.142) (-892.158) (-890.158) [-892.838] * (-891.938) [-889.227] (-893.212) (-894.270) -- 0:01:31 348500 -- (-889.632) [-892.940] (-890.625) (-891.256) * (-895.458) (-892.877) (-890.065) [-896.518] -- 0:01:31 349000 -- (-889.583) (-890.475) (-895.512) [-890.532] * (-890.134) (-891.789) [-890.332] (-895.713) -- 0:01:31 349500 -- [-891.435] (-887.274) (-895.494) (-891.107) * (-892.676) [-892.977] (-888.959) (-892.746) -- 0:01:33 350000 -- (-891.048) (-888.621) (-890.232) [-892.090] * (-892.437) (-897.337) (-892.806) [-892.377] -- 0:01:32 Average standard deviation of split frequencies: 0.009410 350500 -- (-895.474) (-890.594) [-892.045] (-890.585) * (-891.850) (-891.682) (-890.924) [-890.186] -- 0:01:32 351000 -- (-893.445) (-895.061) [-891.884] (-899.057) * [-889.041] (-892.203) (-896.654) (-891.873) -- 0:01:32 351500 -- [-891.900] (-898.895) (-894.639) (-892.650) * (-892.144) (-893.080) [-890.566] (-900.513) -- 0:01:32 352000 -- (-899.241) [-892.262] (-895.312) (-895.922) * (-889.781) (-893.605) [-888.478] (-891.942) -- 0:01:32 352500 -- (-894.564) (-893.849) [-893.376] (-899.211) * [-893.083] (-898.996) (-896.541) (-892.447) -- 0:01:31 353000 -- (-891.345) [-889.452] (-889.161) (-893.782) * [-890.867] (-893.842) (-890.175) (-894.148) -- 0:01:31 353500 -- [-889.575] (-891.506) (-898.501) (-891.388) * (-897.588) [-890.187] (-889.914) (-899.126) -- 0:01:31 354000 -- (-890.442) (-891.183) [-894.300] (-888.853) * (-892.913) (-893.117) [-889.376] (-896.176) -- 0:01:31 354500 -- [-890.908] (-889.616) (-888.678) (-892.481) * [-890.246] (-892.425) (-900.832) (-891.787) -- 0:01:31 355000 -- (-893.294) (-893.160) [-892.141] (-892.264) * [-894.514] (-895.067) (-888.533) (-893.585) -- 0:01:30 Average standard deviation of split frequencies: 0.009269 355500 -- (-890.198) (-896.341) [-893.633] (-894.128) * (-892.871) (-891.763) [-889.208] (-892.588) -- 0:01:30 356000 -- (-889.829) [-892.226] (-894.141) (-893.839) * (-891.285) (-888.803) [-891.309] (-892.415) -- 0:01:30 356500 -- (-892.899) [-891.747] (-894.091) (-892.741) * (-896.130) (-892.775) [-891.766] (-895.731) -- 0:01:30 357000 -- (-888.289) (-895.936) [-887.549] (-891.381) * (-892.200) [-891.061] (-891.458) (-898.365) -- 0:01:31 357500 -- [-897.163] (-896.457) (-891.330) (-895.769) * [-891.493] (-895.595) (-891.177) (-895.269) -- 0:01:31 358000 -- (-891.993) (-890.368) (-894.213) [-888.474] * (-898.352) [-891.292] (-889.709) (-896.359) -- 0:01:31 358500 -- (-889.087) (-898.310) (-891.728) [-892.155] * [-890.370] (-893.339) (-889.658) (-896.542) -- 0:01:31 359000 -- (-892.459) (-899.271) [-891.828] (-891.943) * [-894.754] (-893.627) (-892.419) (-891.339) -- 0:01:31 359500 -- (-901.857) (-897.970) (-900.540) [-891.717] * (-890.342) [-893.675] (-893.360) (-894.154) -- 0:01:30 360000 -- (-893.859) (-892.485) (-895.436) [-887.240] * (-888.303) [-887.508] (-895.789) (-889.557) -- 0:01:30 Average standard deviation of split frequencies: 0.007842 360500 -- (-893.631) [-894.695] (-893.992) (-892.118) * (-890.621) (-891.390) [-892.694] (-892.037) -- 0:01:30 361000 -- (-894.852) (-892.690) (-897.137) [-897.958] * (-892.859) (-901.871) [-893.941] (-897.952) -- 0:01:30 361500 -- (-889.660) (-895.933) [-895.668] (-898.475) * [-891.897] (-897.090) (-896.937) (-894.501) -- 0:01:30 362000 -- (-898.467) (-893.529) (-899.019) [-893.464] * [-895.670] (-891.045) (-890.631) (-890.130) -- 0:01:29 362500 -- (-893.146) (-889.166) [-895.058] (-893.254) * (-892.895) (-896.616) [-891.803] (-892.326) -- 0:01:29 363000 -- [-896.446] (-894.569) (-893.737) (-893.438) * [-888.163] (-888.582) (-892.889) (-890.785) -- 0:01:29 363500 -- [-888.484] (-890.450) (-898.271) (-890.785) * [-894.680] (-899.427) (-896.756) (-892.794) -- 0:01:29 364000 -- (-894.898) (-897.574) [-889.571] (-890.662) * [-887.638] (-891.896) (-894.681) (-890.855) -- 0:01:30 364500 -- [-893.042] (-897.702) (-892.341) (-892.319) * [-895.773] (-893.297) (-891.754) (-887.612) -- 0:01:30 365000 -- (-892.894) (-891.364) (-888.303) [-896.919] * (-891.416) [-894.671] (-889.930) (-892.973) -- 0:01:30 Average standard deviation of split frequencies: 0.007728 365500 -- (-892.061) (-894.383) (-888.751) [-893.933] * [-897.082] (-896.009) (-893.737) (-892.719) -- 0:01:30 366000 -- (-889.616) (-892.271) [-889.438] (-891.676) * (-894.688) (-894.454) (-896.483) [-889.406] -- 0:01:30 366500 -- (-892.753) (-896.866) [-893.128] (-894.719) * [-888.892] (-892.939) (-892.779) (-889.004) -- 0:01:29 367000 -- (-890.937) (-893.674) (-896.535) [-893.273] * [-888.710] (-892.214) (-892.932) (-889.961) -- 0:01:29 367500 -- (-893.427) [-890.991] (-891.702) (-891.991) * [-890.172] (-888.148) (-888.530) (-895.020) -- 0:01:29 368000 -- (-894.348) (-887.745) (-892.708) [-893.451] * (-890.532) (-891.099) [-893.570] (-899.112) -- 0:01:29 368500 -- [-889.691] (-891.975) (-899.205) (-891.106) * [-890.922] (-892.715) (-891.021) (-896.207) -- 0:01:29 369000 -- [-892.356] (-890.072) (-893.216) (-889.487) * [-892.663] (-894.809) (-891.120) (-888.651) -- 0:01:28 369500 -- [-898.518] (-890.575) (-898.601) (-891.002) * [-891.623] (-891.164) (-888.864) (-892.867) -- 0:01:28 370000 -- (-892.206) (-894.623) [-892.888] (-889.747) * (-890.191) [-889.298] (-889.514) (-895.856) -- 0:01:28 Average standard deviation of split frequencies: 0.006359 370500 -- (-891.355) [-891.367] (-896.851) (-889.831) * (-887.673) (-895.311) (-894.629) [-889.635] -- 0:01:28 371000 -- [-887.734] (-890.263) (-897.027) (-890.378) * (-889.879) [-893.903] (-892.032) (-887.218) -- 0:01:29 371500 -- [-891.473] (-892.012) (-897.119) (-892.206) * [-892.015] (-893.427) (-891.828) (-894.151) -- 0:01:29 372000 -- (-898.753) (-891.151) (-888.777) [-890.891] * (-895.522) [-895.637] (-892.144) (-890.532) -- 0:01:29 372500 -- (-888.735) (-898.535) [-888.661] (-891.076) * (-892.861) (-896.782) (-894.782) [-891.867] -- 0:01:29 373000 -- (-887.505) [-891.657] (-898.352) (-889.176) * (-895.063) (-892.478) [-892.313] (-891.170) -- 0:01:29 373500 -- (-891.356) [-893.736] (-895.652) (-887.425) * (-888.022) (-892.633) [-892.549] (-888.626) -- 0:01:28 374000 -- (-893.355) [-897.515] (-893.851) (-898.170) * (-890.563) (-898.341) [-894.681] (-892.844) -- 0:01:28 374500 -- (-888.531) [-889.537] (-889.775) (-890.412) * [-893.240] (-892.837) (-894.746) (-889.731) -- 0:01:28 375000 -- (-898.435) (-888.947) (-889.693) [-889.031] * (-894.002) (-890.817) [-888.509] (-896.506) -- 0:01:28 Average standard deviation of split frequencies: 0.005015 375500 -- (-889.252) [-891.619] (-895.708) (-890.795) * (-900.464) [-896.137] (-891.592) (-895.199) -- 0:01:28 376000 -- (-895.014) (-895.522) (-889.322) [-895.266] * [-890.375] (-899.520) (-890.163) (-897.737) -- 0:01:27 376500 -- (-892.571) [-892.161] (-896.848) (-893.611) * (-893.894) (-895.442) [-890.653] (-891.491) -- 0:01:27 377000 -- (-897.381) (-890.022) [-892.223] (-896.433) * (-893.557) [-892.597] (-890.631) (-890.737) -- 0:01:27 377500 -- (-892.017) [-891.407] (-892.454) (-891.195) * [-891.732] (-891.761) (-895.150) (-891.271) -- 0:01:27 378000 -- [-889.844] (-894.130) (-893.581) (-887.987) * (-892.702) [-890.785] (-889.069) (-889.699) -- 0:01:28 378500 -- (-892.386) (-893.075) [-897.210] (-894.969) * (-893.982) (-889.950) (-888.410) [-893.513] -- 0:01:28 379000 -- (-890.154) [-892.784] (-889.029) (-892.169) * (-892.295) (-891.135) [-889.114] (-894.349) -- 0:01:28 379500 -- (-889.338) [-891.763] (-894.220) (-891.415) * (-889.190) (-889.252) (-891.571) [-891.222] -- 0:01:28 380000 -- (-895.667) (-892.486) (-890.868) [-892.971] * (-890.923) (-890.769) (-893.426) [-891.703] -- 0:01:28 Average standard deviation of split frequencies: 0.003715 380500 -- [-891.563] (-892.437) (-892.312) (-891.005) * [-894.574] (-889.895) (-891.184) (-890.027) -- 0:01:27 381000 -- (-891.583) (-888.260) (-890.022) [-895.203] * (-894.547) (-892.749) (-891.514) [-886.779] -- 0:01:27 381500 -- (-889.166) [-889.839] (-892.205) (-887.796) * (-900.506) [-892.988] (-890.657) (-892.616) -- 0:01:27 382000 -- (-890.499) (-892.494) [-891.979] (-892.763) * (-894.208) [-890.053] (-892.487) (-898.480) -- 0:01:27 382500 -- (-889.668) (-888.694) [-890.450] (-895.711) * (-894.257) (-892.479) (-895.580) [-897.103] -- 0:01:27 383000 -- [-893.145] (-890.676) (-899.385) (-892.333) * [-894.191] (-893.894) (-889.968) (-891.366) -- 0:01:26 383500 -- (-893.818) (-888.647) [-894.686] (-896.087) * (-890.143) (-891.319) [-894.491] (-894.060) -- 0:01:26 384000 -- [-890.565] (-891.119) (-887.320) (-899.131) * [-888.743] (-896.502) (-891.517) (-893.304) -- 0:01:26 384500 -- (-895.612) [-891.044] (-889.710) (-890.891) * (-890.548) (-894.467) (-890.282) [-892.791] -- 0:01:26 385000 -- (-896.148) (-895.919) [-887.559] (-889.927) * [-889.544] (-897.183) (-893.981) (-892.703) -- 0:01:27 Average standard deviation of split frequencies: 0.003664 385500 -- (-893.035) [-892.891] (-886.935) (-889.681) * (-892.664) (-891.942) [-890.670] (-890.936) -- 0:01:27 386000 -- (-896.921) (-894.305) [-890.473] (-895.864) * [-889.232] (-893.427) (-897.990) (-896.173) -- 0:01:27 386500 -- [-891.298] (-887.894) (-893.387) (-892.349) * (-892.472) (-889.518) [-895.150] (-889.445) -- 0:01:27 387000 -- (-893.386) [-894.760] (-894.576) (-893.996) * [-889.148] (-891.262) (-893.056) (-892.605) -- 0:01:27 387500 -- (-887.639) (-896.346) [-892.067] (-892.298) * [-892.308] (-892.730) (-895.338) (-891.179) -- 0:01:26 388000 -- (-889.488) (-897.022) [-893.893] (-896.227) * (-889.746) (-889.941) [-893.092] (-894.107) -- 0:01:26 388500 -- (-889.568) (-888.505) [-901.149] (-895.216) * [-891.903] (-889.725) (-890.957) (-893.453) -- 0:01:26 389000 -- (-896.548) [-889.726] (-891.847) (-892.251) * (-896.236) (-892.196) (-890.411) [-890.204] -- 0:01:26 389500 -- (-890.626) (-895.000) [-891.644] (-889.972) * (-901.229) (-895.184) (-895.655) [-888.853] -- 0:01:26 390000 -- (-887.572) (-891.584) (-896.673) [-889.865] * (-898.380) [-892.446] (-892.204) (-891.999) -- 0:01:26 Average standard deviation of split frequencies: 0.003620 390500 -- (-897.631) (-893.269) [-892.794] (-893.818) * (-900.673) [-892.338] (-894.944) (-891.567) -- 0:01:25 391000 -- (-896.968) (-890.965) [-896.118] (-895.951) * (-897.824) [-889.687] (-889.205) (-890.805) -- 0:01:25 391500 -- (-893.550) (-887.470) [-889.720] (-888.139) * (-898.129) [-890.247] (-889.147) (-893.197) -- 0:01:25 392000 -- (-893.043) (-890.428) [-900.794] (-896.712) * (-892.272) (-893.229) [-888.882] (-891.116) -- 0:01:26 392500 -- (-900.065) [-890.953] (-895.579) (-894.060) * (-899.849) (-890.714) (-890.951) [-891.105] -- 0:01:26 393000 -- (-899.250) (-894.662) (-892.140) [-892.890] * (-898.702) (-895.545) [-893.410] (-892.710) -- 0:01:26 393500 -- (-889.683) (-898.325) [-893.459] (-892.274) * (-900.414) (-894.867) [-893.915] (-887.207) -- 0:01:26 394000 -- (-890.850) [-896.424] (-894.111) (-896.733) * (-902.037) (-894.449) (-898.201) [-891.817] -- 0:01:26 394500 -- (-891.107) [-889.267] (-897.932) (-891.381) * (-891.821) (-892.350) (-890.078) [-890.172] -- 0:01:25 395000 -- (-894.461) (-890.336) (-894.173) [-888.426] * (-894.003) [-900.606] (-893.308) (-888.947) -- 0:01:25 Average standard deviation of split frequencies: 0.004762 395500 -- (-893.316) (-890.265) [-888.601] (-891.942) * [-900.063] (-894.694) (-897.732) (-887.188) -- 0:01:25 396000 -- (-895.461) (-892.526) [-890.617] (-894.688) * [-894.962] (-897.092) (-900.199) (-892.593) -- 0:01:25 396500 -- [-890.392] (-895.355) (-887.324) (-894.602) * (-889.428) [-897.248] (-898.505) (-894.269) -- 0:01:25 397000 -- (-891.259) (-889.614) [-887.543] (-898.338) * [-890.074] (-892.035) (-891.574) (-890.235) -- 0:01:25 397500 -- [-892.156] (-892.866) (-889.840) (-895.549) * (-891.071) (-892.585) (-891.619) [-888.769] -- 0:01:24 398000 -- [-890.122] (-897.435) (-892.221) (-898.195) * [-892.451] (-891.586) (-892.898) (-901.866) -- 0:01:24 398500 -- (-890.344) (-896.057) [-887.730] (-900.290) * (-890.624) (-890.930) (-895.170) [-894.736] -- 0:01:24 399000 -- (-887.719) (-894.744) [-892.590] (-897.044) * (-890.186) [-891.687] (-894.337) (-889.800) -- 0:01:25 399500 -- [-893.011] (-892.670) (-890.362) (-898.506) * (-891.678) [-888.484] (-892.084) (-892.099) -- 0:01:25 400000 -- (-893.736) (-888.355) [-895.147] (-896.098) * (-893.723) (-894.628) [-891.626] (-890.511) -- 0:01:25 Average standard deviation of split frequencies: 0.003530 400500 -- [-890.508] (-894.483) (-895.116) (-890.497) * [-891.105] (-893.157) (-892.189) (-894.758) -- 0:01:25 401000 -- (-887.068) (-891.089) (-892.943) [-890.326] * [-892.788] (-893.811) (-894.978) (-889.643) -- 0:01:25 401500 -- (-893.572) [-889.264] (-892.373) (-899.134) * (-892.027) (-892.561) [-894.015] (-891.804) -- 0:01:24 402000 -- [-888.006] (-889.755) (-893.814) (-890.107) * [-889.492] (-891.477) (-892.262) (-895.370) -- 0:01:24 402500 -- (-891.111) (-892.395) (-893.236) [-889.432] * [-890.769] (-890.600) (-892.286) (-890.680) -- 0:01:24 403000 -- (-895.717) [-889.247] (-890.461) (-889.504) * (-899.017) (-899.520) (-891.288) [-888.358] -- 0:01:24 403500 -- (-893.663) [-887.528] (-890.737) (-894.062) * (-889.453) [-890.025] (-892.848) (-890.665) -- 0:01:24 404000 -- (-890.453) [-891.414] (-890.508) (-892.043) * (-890.957) (-895.012) (-892.109) [-888.964] -- 0:01:24 404500 -- (-890.812) [-890.107] (-893.483) (-893.361) * (-898.308) [-887.994] (-890.686) (-890.684) -- 0:01:23 405000 -- (-893.168) [-892.574] (-892.982) (-888.728) * (-892.945) [-888.653] (-890.489) (-889.806) -- 0:01:23 Average standard deviation of split frequencies: 0.003483 405500 -- (-892.674) (-892.855) [-896.910] (-897.834) * (-893.819) (-888.976) (-893.347) [-891.047] -- 0:01:23 406000 -- (-893.344) (-891.104) (-891.360) [-892.054] * [-894.074] (-892.730) (-893.844) (-894.382) -- 0:01:24 406500 -- (-898.971) (-889.320) [-889.195] (-894.192) * (-892.900) (-889.957) [-894.476] (-899.085) -- 0:01:24 407000 -- [-895.561] (-895.841) (-888.885) (-892.918) * (-892.617) (-889.800) [-893.197] (-897.680) -- 0:01:24 407500 -- (-892.812) (-898.451) [-889.761] (-889.375) * [-889.773] (-891.693) (-890.007) (-890.987) -- 0:01:24 408000 -- (-892.103) (-897.935) (-889.746) [-888.589] * (-892.043) (-892.716) (-890.988) [-889.574] -- 0:01:24 408500 -- (-889.338) (-893.359) [-893.572] (-891.313) * (-893.626) [-889.095] (-891.875) (-890.323) -- 0:01:23 409000 -- (-889.369) (-889.692) [-887.652] (-891.121) * [-895.082] (-895.945) (-893.248) (-892.510) -- 0:01:23 409500 -- [-889.932] (-890.297) (-888.161) (-889.102) * (-892.165) (-891.392) [-892.998] (-887.367) -- 0:01:23 410000 -- (-888.548) (-893.129) [-889.401] (-892.953) * (-889.849) (-895.023) (-888.298) [-890.423] -- 0:01:23 Average standard deviation of split frequencies: 0.003444 410500 -- (-889.234) [-890.284] (-893.777) (-890.279) * (-891.260) (-894.327) (-890.483) [-898.089] -- 0:01:23 411000 -- (-890.630) (-890.075) [-891.141] (-897.461) * (-895.431) (-887.102) [-893.257] (-893.321) -- 0:01:23 411500 -- (-890.738) (-889.474) [-890.110] (-891.566) * (-891.738) (-896.696) [-894.133] (-893.234) -- 0:01:22 412000 -- (-891.052) (-894.506) (-888.319) [-889.958] * (-892.576) [-894.111] (-897.344) (-896.715) -- 0:01:22 412500 -- [-892.516] (-889.125) (-891.795) (-891.186) * (-895.104) [-890.739] (-895.899) (-892.698) -- 0:01:22 413000 -- (-893.303) [-891.279] (-890.343) (-890.891) * (-892.155) [-890.959] (-889.672) (-891.482) -- 0:01:23 413500 -- (-892.551) [-889.289] (-888.236) (-896.078) * [-896.769] (-891.225) (-892.760) (-894.187) -- 0:01:23 414000 -- (-894.386) [-888.357] (-890.776) (-893.004) * [-900.161] (-890.284) (-898.646) (-894.054) -- 0:01:23 414500 -- (-896.060) (-894.354) [-893.813] (-894.789) * (-891.671) [-893.410] (-893.328) (-903.155) -- 0:01:23 415000 -- (-892.678) (-891.675) (-892.014) [-893.341] * [-889.273] (-897.328) (-890.246) (-899.968) -- 0:01:23 Average standard deviation of split frequencies: 0.001133 415500 -- (-893.748) [-891.160] (-894.287) (-890.373) * (-892.682) (-891.175) (-893.455) [-892.306] -- 0:01:22 416000 -- (-890.539) [-887.992] (-898.663) (-890.720) * (-888.667) (-891.820) (-890.762) [-896.050] -- 0:01:22 416500 -- (-894.010) (-892.643) (-898.008) [-901.358] * (-896.931) (-897.455) (-894.135) [-894.460] -- 0:01:22 417000 -- (-894.330) (-896.224) [-895.178] (-895.750) * (-891.658) (-894.754) (-897.073) [-896.379] -- 0:01:22 417500 -- (-890.938) [-891.098] (-894.417) (-895.543) * [-891.729] (-892.056) (-896.279) (-891.287) -- 0:01:22 418000 -- (-890.840) (-893.188) (-892.821) [-890.215] * (-896.114) [-890.617] (-902.043) (-895.698) -- 0:01:22 418500 -- (-897.126) (-891.531) [-891.760] (-891.126) * (-897.974) (-890.065) (-895.649) [-887.920] -- 0:01:21 419000 -- (-898.554) (-897.218) [-891.275] (-890.579) * (-895.464) [-889.870] (-893.049) (-891.263) -- 0:01:21 419500 -- (-897.204) (-895.771) (-891.999) [-889.412] * (-898.083) [-898.962] (-894.366) (-893.446) -- 0:01:21 420000 -- (-897.513) [-890.897] (-893.679) (-893.290) * (-895.636) (-895.451) [-890.152] (-890.799) -- 0:01:22 Average standard deviation of split frequencies: 0.001121 420500 -- (-893.141) (-893.841) (-892.241) [-891.018] * [-891.494] (-890.741) (-889.943) (-890.079) -- 0:01:22 421000 -- (-890.981) (-888.505) [-892.226] (-894.282) * (-891.979) [-892.502] (-891.079) (-891.393) -- 0:01:22 421500 -- (-893.473) (-891.030) (-890.400) [-890.657] * (-894.036) [-890.012] (-888.983) (-893.266) -- 0:01:22 422000 -- (-889.864) (-888.093) [-891.572] (-899.372) * (-891.536) (-888.438) [-890.420] (-895.925) -- 0:01:22 422500 -- (-893.263) [-892.291] (-894.007) (-899.798) * (-893.200) [-890.529] (-890.865) (-893.378) -- 0:01:22 423000 -- (-895.256) (-890.112) (-889.055) [-891.816] * (-893.621) (-892.510) [-894.544] (-891.945) -- 0:01:21 423500 -- (-892.274) [-889.874] (-894.725) (-888.733) * [-892.757] (-894.453) (-890.547) (-892.228) -- 0:01:21 424000 -- (-890.887) (-898.521) [-897.241] (-888.801) * (-891.272) [-891.098] (-891.704) (-891.213) -- 0:01:21 424500 -- (-893.441) (-888.855) (-891.755) [-890.019] * (-888.135) (-897.481) [-892.536] (-888.213) -- 0:01:21 425000 -- (-891.097) (-890.325) [-892.996] (-891.596) * (-890.140) (-893.044) [-895.415] (-896.691) -- 0:01:21 Average standard deviation of split frequencies: 0.001107 425500 -- [-893.120] (-889.665) (-893.894) (-904.458) * (-890.142) [-895.831] (-893.022) (-891.793) -- 0:01:21 426000 -- (-888.311) (-891.156) [-889.387] (-896.051) * (-892.193) [-895.262] (-890.695) (-890.551) -- 0:01:20 426500 -- (-892.079) (-891.417) (-890.210) [-891.470] * (-895.170) (-889.843) (-895.279) [-892.901] -- 0:01:20 427000 -- (-889.233) (-891.983) (-891.101) [-890.539] * [-891.789] (-890.896) (-892.527) (-893.606) -- 0:01:21 427500 -- (-894.805) [-893.794] (-890.345) (-894.641) * (-892.631) (-891.787) (-894.356) [-887.847] -- 0:01:21 428000 -- (-896.192) [-889.290] (-898.880) (-890.971) * (-891.585) (-889.925) [-890.441] (-889.081) -- 0:01:21 428500 -- (-892.212) (-891.188) (-899.203) [-889.458] * (-893.523) (-894.137) (-891.016) [-891.005] -- 0:01:21 429000 -- [-892.785] (-892.299) (-894.106) (-890.290) * (-892.934) (-896.624) (-896.253) [-889.127] -- 0:01:21 429500 -- (-890.415) (-894.957) (-900.151) [-889.543] * (-891.847) [-893.379] (-890.273) (-889.113) -- 0:01:21 430000 -- (-892.787) (-892.962) [-893.113] (-894.998) * (-889.067) [-890.163] (-886.826) (-893.100) -- 0:01:20 Average standard deviation of split frequencies: 0.001095 430500 -- (-889.270) [-890.685] (-891.199) (-890.926) * (-893.138) [-892.399] (-891.395) (-896.185) -- 0:01:20 431000 -- (-895.917) (-893.021) (-890.436) [-891.373] * (-895.502) [-889.371] (-890.817) (-888.536) -- 0:01:20 431500 -- (-894.339) (-897.093) [-887.504] (-890.190) * (-891.198) [-891.510] (-896.343) (-890.419) -- 0:01:20 432000 -- (-894.544) (-897.734) [-892.274] (-893.907) * (-893.778) (-891.128) (-889.258) [-888.192] -- 0:01:20 432500 -- (-889.915) (-900.620) (-896.840) [-889.836] * (-889.340) [-893.961] (-891.013) (-889.790) -- 0:01:20 433000 -- (-893.903) [-893.354] (-892.695) (-890.809) * [-893.661] (-889.926) (-891.681) (-891.177) -- 0:01:19 433500 -- (-899.622) (-899.207) [-889.337] (-891.689) * (-895.968) [-887.617] (-892.223) (-887.385) -- 0:01:19 434000 -- [-891.158] (-898.901) (-892.387) (-892.561) * (-894.976) (-892.744) [-892.611] (-890.300) -- 0:01:20 434500 -- (-894.670) (-898.614) [-887.981] (-893.812) * [-892.088] (-888.806) (-894.205) (-896.447) -- 0:01:20 435000 -- (-893.683) (-900.308) (-894.746) [-891.374] * (-895.229) (-890.589) (-892.163) [-889.837] -- 0:01:20 Average standard deviation of split frequencies: 0.002162 435500 -- (-888.016) (-890.630) (-894.590) [-890.285] * (-896.073) (-894.731) [-889.621] (-892.925) -- 0:01:20 436000 -- (-892.059) (-892.318) (-900.428) [-893.117] * (-895.409) [-894.074] (-892.152) (-889.203) -- 0:01:20 436500 -- [-891.430] (-894.458) (-893.289) (-887.181) * (-893.293) (-889.115) (-894.300) [-891.813] -- 0:01:20 437000 -- [-890.605] (-889.255) (-893.742) (-886.254) * (-895.886) [-890.957] (-889.553) (-891.873) -- 0:01:19 437500 -- (-888.110) (-889.655) (-887.787) [-887.407] * [-896.594] (-893.010) (-889.555) (-892.810) -- 0:01:19 438000 -- (-891.830) (-896.325) [-892.551] (-892.050) * (-889.187) (-895.198) [-889.195] (-889.112) -- 0:01:19 438500 -- (-891.553) (-889.353) (-887.655) [-888.438] * [-893.526] (-894.582) (-890.418) (-889.771) -- 0:01:19 439000 -- [-890.471] (-895.338) (-891.613) (-898.117) * (-891.200) [-891.474] (-895.300) (-891.557) -- 0:01:19 439500 -- (-893.574) (-890.292) [-889.494] (-892.170) * (-891.598) [-894.069] (-889.748) (-891.677) -- 0:01:19 440000 -- (-895.596) (-891.144) (-892.664) [-889.967] * [-891.577] (-892.459) (-891.791) (-893.115) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 440500 -- [-887.874] (-892.385) (-893.163) (-889.819) * (-889.497) (-890.138) [-892.782] (-893.501) -- 0:01:18 441000 -- (-895.766) [-899.948] (-892.246) (-892.898) * (-890.149) [-893.042] (-898.961) (-889.398) -- 0:01:18 441500 -- (-894.902) (-895.848) [-892.132] (-897.218) * [-887.814] (-892.030) (-894.892) (-894.028) -- 0:01:19 442000 -- (-890.634) (-894.693) (-894.668) [-892.867] * (-890.495) (-894.126) [-888.593] (-889.017) -- 0:01:19 442500 -- (-893.109) (-897.255) [-891.143] (-897.388) * [-890.391] (-889.379) (-889.675) (-896.795) -- 0:01:19 443000 -- [-896.748] (-893.157) (-890.995) (-895.008) * (-891.386) (-900.509) (-893.711) [-892.750] -- 0:01:19 443500 -- (-898.459) (-893.174) [-893.868] (-894.990) * [-890.352] (-901.532) (-893.873) (-886.916) -- 0:01:19 444000 -- (-893.431) (-896.183) [-890.166] (-893.194) * (-890.904) (-894.947) (-891.870) [-889.854] -- 0:01:18 444500 -- (-895.528) [-896.329] (-890.924) (-891.872) * (-894.191) [-892.416] (-891.889) (-895.501) -- 0:01:18 445000 -- (-892.860) (-893.633) (-891.758) [-891.909] * (-889.414) [-892.735] (-894.759) (-889.258) -- 0:01:18 Average standard deviation of split frequencies: 0.001057 445500 -- (-894.079) (-895.567) [-888.713] (-887.676) * (-896.183) [-891.529] (-896.610) (-891.668) -- 0:01:18 446000 -- [-891.994] (-894.656) (-890.929) (-889.383) * (-891.351) (-893.517) (-892.214) [-892.363] -- 0:01:18 446500 -- (-899.580) [-897.009] (-890.865) (-890.149) * (-894.389) (-893.493) (-894.414) [-891.924] -- 0:01:18 447000 -- (-895.485) [-889.802] (-889.279) (-897.862) * (-890.816) (-893.435) (-892.391) [-897.676] -- 0:01:17 447500 -- (-892.726) (-889.160) [-892.904] (-894.203) * (-893.483) (-889.038) (-896.967) [-896.656] -- 0:01:17 448000 -- (-891.868) (-893.042) [-894.221] (-891.401) * [-890.786] (-888.197) (-892.082) (-899.638) -- 0:01:17 448500 -- (-891.660) (-894.102) [-891.459] (-895.855) * (-895.144) (-892.102) [-889.807] (-892.295) -- 0:01:18 449000 -- [-890.465] (-898.337) (-898.777) (-893.296) * (-889.878) [-892.164] (-888.635) (-897.942) -- 0:01:18 449500 -- (-893.793) (-894.076) (-895.175) [-890.252] * (-892.998) (-893.413) [-893.307] (-895.739) -- 0:01:18 450000 -- (-889.725) (-896.663) (-890.884) [-890.339] * [-897.997] (-888.245) (-888.978) (-889.262) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 450500 -- [-889.150] (-892.654) (-888.526) (-893.642) * (-892.895) (-888.619) [-894.288] (-890.899) -- 0:01:18 451000 -- (-893.412) (-890.729) (-891.650) [-890.001] * (-893.328) (-893.842) (-895.085) [-890.213] -- 0:01:17 451500 -- (-891.706) (-887.820) (-889.553) [-886.462] * (-892.151) [-893.130] (-890.997) (-897.136) -- 0:01:17 452000 -- (-889.105) (-894.052) [-892.011] (-890.336) * (-891.869) [-892.263] (-888.448) (-893.398) -- 0:01:17 452500 -- (-893.844) (-890.349) [-893.901] (-891.512) * [-891.089] (-894.276) (-890.462) (-901.888) -- 0:01:17 453000 -- (-893.595) (-893.661) (-891.118) [-890.503] * (-889.060) (-893.593) [-892.204] (-898.827) -- 0:01:17 453500 -- (-891.480) [-889.315] (-896.345) (-889.369) * (-888.764) [-891.287] (-888.773) (-896.572) -- 0:01:17 454000 -- (-894.916) [-894.439] (-898.103) (-889.662) * (-891.336) (-891.440) (-891.105) [-892.801] -- 0:01:16 454500 -- [-892.437] (-897.210) (-895.322) (-892.611) * (-895.019) (-894.418) (-891.680) [-894.011] -- 0:01:16 455000 -- (-891.771) (-891.859) (-894.551) [-890.922] * (-893.772) (-891.795) (-895.276) [-889.661] -- 0:01:17 Average standard deviation of split frequencies: 0.002068 455500 -- (-892.816) [-892.652] (-888.627) (-897.163) * (-890.446) [-891.541] (-897.329) (-897.330) -- 0:01:17 456000 -- [-895.359] (-891.090) (-892.955) (-902.499) * (-892.028) [-889.423] (-897.186) (-897.315) -- 0:01:17 456500 -- (-894.722) (-890.971) [-889.385] (-893.170) * (-890.104) (-890.483) [-893.059] (-888.020) -- 0:01:17 457000 -- (-894.542) (-888.093) (-891.542) [-889.410] * [-894.835] (-900.350) (-890.520) (-891.031) -- 0:01:17 457500 -- (-892.096) [-890.562] (-897.646) (-888.946) * (-890.154) (-893.780) [-894.912] (-894.768) -- 0:01:17 458000 -- (-891.923) [-890.598] (-894.239) (-896.205) * [-890.489] (-894.634) (-890.706) (-893.040) -- 0:01:16 458500 -- (-895.508) (-891.419) [-892.610] (-900.055) * (-894.199) [-891.282] (-892.015) (-891.491) -- 0:01:16 459000 -- (-892.324) (-894.981) [-890.588] (-887.014) * [-893.360] (-896.529) (-891.317) (-891.382) -- 0:01:16 459500 -- (-890.767) (-891.010) [-890.301] (-894.742) * (-897.467) [-893.646] (-892.751) (-902.189) -- 0:01:16 460000 -- (-895.297) [-892.041] (-891.852) (-893.298) * [-890.388] (-889.534) (-890.877) (-896.217) -- 0:01:16 Average standard deviation of split frequencies: 0.001023 460500 -- (-892.275) [-896.341] (-892.952) (-893.592) * (-895.518) (-895.007) [-892.037] (-893.031) -- 0:01:16 461000 -- [-889.812] (-888.682) (-896.255) (-896.347) * (-896.954) (-902.061) [-888.705] (-896.999) -- 0:01:15 461500 -- [-900.412] (-888.556) (-893.312) (-890.735) * [-893.330] (-894.587) (-889.988) (-893.271) -- 0:01:15 462000 -- (-888.727) [-888.898] (-895.564) (-895.378) * (-889.432) (-893.739) (-895.580) [-896.299] -- 0:01:15 462500 -- (-891.738) (-892.667) [-890.611] (-891.023) * [-889.173] (-897.754) (-890.835) (-895.869) -- 0:01:16 463000 -- (-892.356) [-893.800] (-893.121) (-894.649) * (-886.058) (-893.594) [-893.006] (-895.625) -- 0:01:16 463500 -- [-891.025] (-899.233) (-891.132) (-893.285) * (-900.240) (-892.834) [-891.357] (-892.684) -- 0:01:16 464000 -- (-895.075) (-894.117) (-892.877) [-888.780] * [-896.197] (-893.643) (-893.381) (-893.792) -- 0:01:16 464500 -- (-893.980) (-893.969) [-891.648] (-888.793) * [-890.743] (-894.898) (-893.772) (-898.812) -- 0:01:16 465000 -- [-891.562] (-893.156) (-894.531) (-889.831) * [-889.493] (-890.146) (-890.439) (-898.443) -- 0:01:15 Average standard deviation of split frequencies: 0.001012 465500 -- [-891.458] (-896.597) (-892.101) (-889.921) * (-889.899) [-892.216] (-892.338) (-895.704) -- 0:01:15 466000 -- (-892.028) [-890.268] (-891.873) (-893.307) * (-890.090) (-892.151) [-893.872] (-894.554) -- 0:01:15 466500 -- (-891.874) [-893.300] (-899.270) (-896.124) * [-891.587] (-891.356) (-895.890) (-892.471) -- 0:01:15 467000 -- [-893.316] (-892.955) (-889.567) (-894.491) * [-889.043] (-889.046) (-891.468) (-893.242) -- 0:01:15 467500 -- (-889.885) (-891.080) (-899.794) [-896.123] * [-900.213] (-889.322) (-889.399) (-892.250) -- 0:01:15 468000 -- [-888.539] (-892.315) (-890.864) (-892.411) * (-895.667) [-892.870] (-889.125) (-896.835) -- 0:01:15 468500 -- [-888.441] (-893.657) (-893.743) (-893.497) * (-889.230) (-893.013) (-889.928) [-892.932] -- 0:01:14 469000 -- (-890.778) (-893.063) [-891.843] (-893.381) * (-888.519) (-896.471) (-893.327) [-893.622] -- 0:01:14 469500 -- (-888.866) (-892.859) [-889.647] (-888.680) * (-892.274) (-892.937) (-890.847) [-887.258] -- 0:01:15 470000 -- (-893.520) [-893.201] (-888.690) (-887.699) * (-892.103) [-890.580] (-889.555) (-899.215) -- 0:01:15 Average standard deviation of split frequencies: 0.001002 470500 -- [-890.205] (-891.627) (-894.771) (-889.686) * (-894.890) [-895.260] (-895.044) (-890.894) -- 0:01:15 471000 -- [-891.741] (-894.303) (-891.723) (-893.521) * [-890.518] (-892.061) (-892.346) (-892.108) -- 0:01:15 471500 -- (-891.801) (-891.337) (-894.953) [-893.764] * (-894.627) [-894.325] (-890.228) (-895.243) -- 0:01:15 472000 -- [-891.620] (-897.259) (-893.628) (-896.411) * [-895.083] (-889.054) (-892.021) (-899.504) -- 0:01:14 472500 -- (-901.744) (-893.579) (-892.604) [-893.352] * (-889.675) [-892.698] (-894.351) (-893.677) -- 0:01:14 473000 -- (-892.006) (-892.664) (-887.868) [-898.507] * (-891.921) (-899.978) (-890.246) [-892.524] -- 0:01:14 473500 -- [-891.881] (-895.481) (-894.472) (-896.572) * (-889.496) (-894.750) (-893.122) [-889.311] -- 0:01:14 474000 -- (-889.504) [-887.966] (-894.070) (-895.245) * [-890.591] (-891.356) (-890.225) (-891.510) -- 0:01:14 474500 -- (-895.563) (-894.295) (-898.321) [-899.580] * [-897.430] (-891.491) (-898.573) (-888.687) -- 0:01:14 475000 -- (-893.830) (-890.572) (-894.302) [-891.120] * (-897.731) (-892.650) (-892.406) [-889.513] -- 0:01:14 Average standard deviation of split frequencies: 0.000990 475500 -- [-891.611] (-890.333) (-891.972) (-891.053) * [-894.091] (-890.364) (-894.395) (-897.430) -- 0:01:13 476000 -- (-892.091) [-890.107] (-892.762) (-889.916) * (-890.813) (-890.103) [-890.801] (-903.119) -- 0:01:13 476500 -- [-888.744] (-890.273) (-889.229) (-892.693) * (-899.864) (-891.193) [-893.253] (-888.542) -- 0:01:14 477000 -- (-895.443) (-888.386) [-889.052] (-893.260) * (-891.930) (-890.256) [-891.468] (-890.277) -- 0:01:14 477500 -- (-892.689) [-893.522] (-893.357) (-887.848) * (-893.386) [-893.384] (-892.477) (-891.979) -- 0:01:14 478000 -- (-888.060) (-890.334) [-889.591] (-891.303) * [-893.818] (-890.080) (-890.575) (-894.973) -- 0:01:14 478500 -- [-892.110] (-894.061) (-891.910) (-894.816) * (-900.310) (-892.053) [-891.546] (-895.084) -- 0:01:14 479000 -- [-893.284] (-895.129) (-892.691) (-891.052) * (-897.457) [-891.539] (-890.444) (-891.358) -- 0:01:13 479500 -- [-894.694] (-887.953) (-891.811) (-894.249) * (-893.468) (-891.642) [-895.106] (-891.110) -- 0:01:13 480000 -- [-890.032] (-891.584) (-891.752) (-892.156) * (-892.204) [-888.718] (-891.382) (-892.014) -- 0:01:13 Average standard deviation of split frequencies: 0.000981 480500 -- (-895.964) (-889.572) (-896.996) [-892.518] * (-888.185) [-892.639] (-899.137) (-894.986) -- 0:01:13 481000 -- (-894.358) (-893.577) [-890.292] (-890.603) * [-890.333] (-891.098) (-901.345) (-889.841) -- 0:01:13 481500 -- [-887.717] (-894.669) (-889.524) (-893.624) * [-893.575] (-888.510) (-890.439) (-896.470) -- 0:01:13 482000 -- (-893.993) [-889.490] (-890.058) (-895.443) * [-889.683] (-892.369) (-891.657) (-895.386) -- 0:01:13 482500 -- (-892.744) [-888.704] (-894.795) (-890.257) * [-892.018] (-892.764) (-890.245) (-892.715) -- 0:01:12 483000 -- (-889.881) [-890.710] (-893.253) (-896.811) * [-890.474] (-891.376) (-894.108) (-887.469) -- 0:01:12 483500 -- (-894.546) (-889.957) [-891.307] (-893.700) * (-892.901) [-890.168] (-897.745) (-889.274) -- 0:01:13 484000 -- (-888.820) [-890.887] (-892.261) (-887.877) * [-892.524] (-890.273) (-895.712) (-893.412) -- 0:01:13 484500 -- (-896.952) (-891.836) (-892.151) [-889.955] * (-891.060) [-888.914] (-895.697) (-890.299) -- 0:01:13 485000 -- (-891.075) [-890.625] (-895.076) (-889.019) * [-893.033] (-889.905) (-892.081) (-890.602) -- 0:01:13 Average standard deviation of split frequencies: 0.000970 485500 -- (-889.992) (-893.819) (-891.300) [-892.139] * (-889.275) (-892.838) (-890.811) [-889.336] -- 0:01:13 486000 -- [-893.474] (-889.915) (-898.904) (-890.156) * (-894.707) [-891.003] (-892.556) (-892.159) -- 0:01:12 486500 -- (-893.182) (-895.388) (-891.082) [-894.290] * (-893.853) (-891.670) (-896.287) [-890.393] -- 0:01:12 487000 -- (-891.645) (-891.552) [-893.755] (-889.685) * [-892.035] (-896.062) (-890.785) (-891.735) -- 0:01:12 487500 -- (-891.073) (-889.633) (-896.687) [-891.923] * (-890.233) (-893.595) (-891.419) [-894.745] -- 0:01:12 488000 -- [-888.110] (-902.520) (-901.654) (-893.363) * (-892.529) (-894.384) (-890.136) [-892.381] -- 0:01:12 488500 -- (-894.277) (-897.909) (-896.533) [-889.555] * (-889.786) [-894.054] (-888.479) (-889.760) -- 0:01:12 489000 -- [-889.087] (-891.173) (-892.635) (-892.030) * (-892.591) (-890.160) (-889.932) [-891.182] -- 0:01:12 489500 -- [-888.457] (-895.257) (-888.785) (-890.269) * (-888.956) (-890.819) [-888.250] (-902.414) -- 0:01:11 490000 -- [-890.658] (-897.768) (-897.209) (-893.250) * (-898.425) (-894.168) (-895.062) [-899.736] -- 0:01:11 Average standard deviation of split frequencies: 0.000961 490500 -- [-891.590] (-894.255) (-889.973) (-889.417) * (-896.348) [-890.714] (-897.970) (-888.584) -- 0:01:12 491000 -- [-889.335] (-890.837) (-888.836) (-892.192) * [-890.690] (-890.081) (-892.838) (-894.482) -- 0:01:12 491500 -- [-887.089] (-892.987) (-891.494) (-891.318) * [-894.081] (-899.113) (-886.944) (-888.724) -- 0:01:12 492000 -- (-893.240) [-890.753] (-892.366) (-897.128) * [-890.812] (-888.937) (-892.588) (-891.882) -- 0:01:12 492500 -- (-890.794) [-891.893] (-891.165) (-894.232) * (-887.402) [-891.355] (-891.220) (-895.131) -- 0:01:12 493000 -- (-889.028) (-897.231) [-891.179] (-896.337) * (-893.748) [-888.957] (-895.250) (-892.397) -- 0:01:11 493500 -- (-888.019) [-895.780] (-896.503) (-891.143) * (-888.875) [-891.863] (-898.412) (-893.977) -- 0:01:11 494000 -- [-893.492] (-888.410) (-893.162) (-889.307) * (-889.994) [-890.340] (-894.870) (-896.918) -- 0:01:11 494500 -- [-889.102] (-894.875) (-892.621) (-891.536) * (-889.293) [-890.462] (-903.406) (-888.946) -- 0:01:11 495000 -- (-892.861) (-887.186) (-895.025) [-888.439] * (-891.046) [-893.529] (-897.956) (-892.472) -- 0:01:11 Average standard deviation of split frequencies: 0.001901 495500 -- (-897.937) (-893.606) (-889.477) [-891.817] * [-892.994] (-895.033) (-898.390) (-890.300) -- 0:01:11 496000 -- (-894.366) (-889.547) [-891.039] (-895.442) * [-890.242] (-896.655) (-895.847) (-891.829) -- 0:01:11 496500 -- (-892.660) [-891.155] (-890.027) (-896.030) * (-894.925) (-891.993) (-892.775) [-888.048] -- 0:01:10 497000 -- [-892.665] (-896.467) (-899.552) (-887.716) * (-895.529) [-891.371] (-890.953) (-893.489) -- 0:01:10 497500 -- (-889.339) (-891.218) [-894.319] (-894.942) * [-892.918] (-893.718) (-891.157) (-891.876) -- 0:01:11 498000 -- [-889.564] (-892.971) (-896.353) (-893.650) * (-892.246) [-893.719] (-894.752) (-893.252) -- 0:01:11 498500 -- [-890.273] (-891.990) (-889.511) (-892.389) * (-890.489) (-888.650) (-898.774) [-890.814] -- 0:01:11 499000 -- (-889.641) [-888.012] (-899.315) (-891.545) * [-891.983] (-893.260) (-891.738) (-893.712) -- 0:01:11 499500 -- [-894.649] (-890.330) (-891.634) (-891.137) * [-889.978] (-889.880) (-889.747) (-896.580) -- 0:01:11 500000 -- [-893.676] (-890.865) (-896.682) (-893.473) * [-890.048] (-895.159) (-890.953) (-891.399) -- 0:01:11 Average standard deviation of split frequencies: 0.000000 500500 -- (-893.018) [-890.304] (-894.835) (-902.150) * (-900.128) [-891.273] (-892.292) (-891.810) -- 0:01:10 501000 -- (-897.169) [-890.652] (-895.648) (-891.398) * (-889.153) [-893.863] (-888.787) (-888.591) -- 0:01:10 501500 -- (-890.886) [-889.769] (-890.563) (-889.808) * (-893.887) (-896.671) [-891.835] (-897.890) -- 0:01:10 502000 -- (-892.322) (-893.199) (-891.094) [-892.115] * [-897.729] (-890.728) (-898.761) (-892.788) -- 0:01:10 502500 -- (-901.179) [-889.236] (-894.870) (-890.046) * [-891.287] (-895.540) (-898.922) (-893.290) -- 0:01:10 503000 -- (-893.834) (-890.403) [-892.515] (-898.161) * (-895.347) (-898.493) [-889.552] (-894.921) -- 0:01:10 503500 -- (-890.706) (-889.937) [-891.023] (-890.879) * (-896.410) (-888.640) [-893.047] (-892.795) -- 0:01:10 504000 -- (-889.655) (-889.315) [-895.763] (-897.075) * (-893.016) (-896.829) [-891.212] (-897.575) -- 0:01:09 504500 -- (-893.967) (-893.479) [-894.036] (-897.917) * (-894.897) (-896.532) [-888.492] (-891.295) -- 0:01:10 505000 -- (-896.728) [-889.185] (-890.777) (-889.383) * (-894.022) [-890.274] (-888.917) (-898.925) -- 0:01:10 Average standard deviation of split frequencies: 0.000932 505500 -- (-891.399) (-892.591) (-897.173) [-891.287] * [-891.630] (-886.833) (-894.557) (-889.878) -- 0:01:10 506000 -- [-887.153] (-889.461) (-894.834) (-894.052) * (-889.778) [-891.898] (-892.852) (-895.205) -- 0:01:10 506500 -- (-890.645) (-888.705) [-890.634] (-895.254) * (-889.744) [-891.483] (-890.874) (-894.247) -- 0:01:10 507000 -- (-889.229) [-893.290] (-891.736) (-893.522) * [-890.398] (-891.036) (-897.102) (-896.871) -- 0:01:10 507500 -- [-890.686] (-892.216) (-890.361) (-889.638) * (-886.797) (-894.860) [-893.047] (-899.201) -- 0:01:09 508000 -- (-892.064) (-901.362) [-892.346] (-891.398) * [-887.991] (-897.697) (-887.026) (-898.562) -- 0:01:09 508500 -- [-891.285] (-896.590) (-893.607) (-895.757) * (-889.761) [-892.214] (-888.831) (-897.645) -- 0:01:09 509000 -- [-892.182] (-890.791) (-891.080) (-890.307) * (-895.235) (-891.895) [-887.415] (-899.182) -- 0:01:09 509500 -- (-891.034) (-892.756) (-894.223) [-894.677] * (-892.764) [-892.269] (-890.502) (-897.974) -- 0:01:09 510000 -- (-891.793) (-891.995) (-897.162) [-895.991] * (-888.137) [-892.658] (-887.911) (-894.080) -- 0:01:09 Average standard deviation of split frequencies: 0.000923 510500 -- (-898.800) (-898.038) [-898.369] (-901.958) * (-894.420) [-891.897] (-892.626) (-895.733) -- 0:01:09 511000 -- [-899.746] (-894.440) (-894.730) (-903.171) * (-893.687) [-893.000] (-889.577) (-892.330) -- 0:01:08 511500 -- (-891.566) [-895.225] (-890.365) (-888.980) * (-892.247) (-894.264) (-889.511) [-891.431] -- 0:01:09 512000 -- (-889.338) (-894.697) [-891.229] (-900.345) * (-888.221) (-894.378) [-889.987] (-895.369) -- 0:01:09 512500 -- [-889.769] (-894.978) (-890.814) (-896.055) * (-889.011) (-890.166) [-890.289] (-888.361) -- 0:01:09 513000 -- (-889.486) (-890.538) [-890.250] (-890.984) * (-890.144) [-889.308] (-890.524) (-895.481) -- 0:01:09 513500 -- [-897.367] (-893.581) (-887.661) (-894.194) * (-896.343) [-891.624] (-891.794) (-893.222) -- 0:01:09 514000 -- [-892.194] (-892.527) (-893.015) (-893.168) * (-897.177) (-888.484) (-890.778) [-896.269] -- 0:01:09 514500 -- [-890.842] (-896.904) (-889.356) (-892.262) * [-888.266] (-891.553) (-891.234) (-897.568) -- 0:01:08 515000 -- (-890.545) (-895.916) (-895.711) [-892.655] * (-891.709) (-890.499) [-890.293] (-890.704) -- 0:01:08 Average standard deviation of split frequencies: 0.000914 515500 -- [-896.409] (-888.378) (-892.268) (-892.894) * (-892.365) (-895.696) [-896.083] (-888.819) -- 0:01:08 516000 -- [-893.911] (-889.208) (-891.850) (-897.029) * (-896.311) (-892.396) (-889.953) [-890.265] -- 0:01:08 516500 -- [-891.328] (-892.393) (-894.343) (-890.231) * (-897.473) (-898.935) (-896.764) [-892.024] -- 0:01:08 517000 -- (-892.529) [-892.334] (-890.786) (-894.057) * (-891.192) [-886.557] (-893.952) (-889.649) -- 0:01:08 517500 -- (-890.172) (-897.317) (-893.151) [-890.165] * (-890.041) [-890.328] (-898.346) (-892.167) -- 0:01:08 518000 -- [-889.945] (-894.104) (-890.134) (-896.366) * (-889.591) (-889.913) (-891.688) [-890.311] -- 0:01:07 518500 -- (-899.552) (-894.252) (-893.407) [-894.538] * (-888.384) (-899.143) [-895.063] (-892.879) -- 0:01:08 519000 -- (-894.703) (-891.364) (-891.721) [-891.092] * [-888.058] (-894.203) (-892.447) (-890.309) -- 0:01:08 519500 -- [-894.448] (-893.786) (-891.201) (-892.031) * [-891.284] (-896.939) (-889.666) (-891.085) -- 0:01:08 520000 -- (-894.744) (-894.911) [-890.902] (-895.638) * (-888.684) (-893.486) [-890.296] (-891.095) -- 0:01:08 Average standard deviation of split frequencies: 0.000000 520500 -- (-894.196) (-896.137) [-893.277] (-894.926) * (-887.718) (-894.552) [-888.744] (-889.535) -- 0:01:08 521000 -- (-897.765) (-895.333) [-893.904] (-893.829) * [-890.222] (-893.261) (-887.799) (-894.177) -- 0:01:08 521500 -- [-892.919] (-889.280) (-892.390) (-896.055) * [-889.427] (-891.420) (-894.213) (-892.217) -- 0:01:07 522000 -- (-894.359) [-895.032] (-891.332) (-889.820) * (-889.923) (-888.201) [-890.966] (-887.726) -- 0:01:07 522500 -- (-893.378) [-889.598] (-894.991) (-894.114) * (-890.128) (-889.664) [-889.917] (-896.353) -- 0:01:07 523000 -- (-890.290) (-892.257) (-891.987) [-891.245] * (-900.145) (-893.947) [-888.949] (-890.562) -- 0:01:07 523500 -- (-891.710) [-889.714] (-892.445) (-891.713) * (-898.473) (-891.722) (-893.230) [-893.867] -- 0:01:07 524000 -- [-890.802] (-891.189) (-895.599) (-893.481) * (-893.540) [-890.223] (-898.482) (-890.604) -- 0:01:07 524500 -- (-896.061) [-890.299] (-896.779) (-896.011) * (-890.285) [-888.790] (-891.915) (-894.770) -- 0:01:07 525000 -- (-891.478) [-891.025] (-893.474) (-893.619) * [-890.671] (-892.930) (-892.482) (-897.021) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 525500 -- (-892.382) [-894.012] (-889.526) (-891.193) * (-890.420) (-890.113) [-889.440] (-896.610) -- 0:01:07 526000 -- (-901.806) (-898.742) (-893.001) [-891.080] * (-890.808) [-889.187] (-896.022) (-902.127) -- 0:01:07 526500 -- (-895.665) (-890.911) (-892.066) [-895.227] * (-889.751) (-889.903) [-889.924] (-901.775) -- 0:01:07 527000 -- [-888.952] (-891.343) (-892.735) (-891.535) * (-895.044) (-890.679) (-888.500) [-892.455] -- 0:01:07 527500 -- (-890.747) [-889.243] (-888.263) (-890.552) * [-892.439] (-889.459) (-886.543) (-895.749) -- 0:01:07 528000 -- [-892.057] (-892.557) (-891.587) (-896.729) * [-888.845] (-892.158) (-888.875) (-895.533) -- 0:01:07 528500 -- (-898.142) (-895.742) [-889.691] (-892.878) * (-891.541) (-888.156) [-890.789] (-889.422) -- 0:01:06 529000 -- (-893.136) [-893.571] (-898.257) (-889.003) * [-893.374] (-889.073) (-891.041) (-897.910) -- 0:01:06 529500 -- (-896.836) [-889.047] (-896.013) (-896.285) * (-887.673) (-890.252) [-894.828] (-901.990) -- 0:01:06 530000 -- (-894.551) (-894.371) (-895.567) [-903.649] * (-895.123) (-890.124) [-887.606] (-895.815) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 530500 -- [-892.462] (-896.297) (-890.829) (-898.206) * (-895.922) [-888.549] (-894.403) (-891.714) -- 0:01:06 531000 -- (-894.544) (-894.643) (-892.347) [-901.630] * (-893.025) [-891.856] (-892.175) (-905.014) -- 0:01:06 531500 -- [-890.491] (-892.947) (-891.284) (-897.305) * (-892.349) (-893.306) (-892.192) [-890.455] -- 0:01:06 532000 -- (-895.093) (-895.672) [-897.424] (-893.560) * [-893.566] (-890.068) (-891.653) (-903.414) -- 0:01:05 532500 -- (-895.585) [-889.854] (-892.738) (-891.770) * (-895.426) [-890.479] (-891.208) (-895.342) -- 0:01:05 533000 -- [-893.385] (-892.900) (-895.020) (-890.156) * (-893.655) [-894.253] (-895.338) (-892.982) -- 0:01:06 533500 -- (-889.027) (-898.593) [-891.853] (-891.057) * (-897.337) [-893.123] (-894.635) (-895.891) -- 0:01:06 534000 -- (-889.323) [-890.003] (-894.529) (-893.979) * (-891.665) (-892.616) [-893.104] (-890.561) -- 0:01:06 534500 -- (-890.597) (-891.294) (-896.003) [-896.088] * [-895.219] (-890.567) (-893.091) (-893.517) -- 0:01:06 535000 -- [-890.314] (-890.471) (-896.758) (-895.749) * (-889.438) [-889.725] (-892.155) (-896.142) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 535500 -- [-888.432] (-889.769) (-890.780) (-894.603) * (-897.470) [-887.855] (-892.361) (-893.365) -- 0:01:05 536000 -- [-891.933] (-897.995) (-890.498) (-889.671) * (-890.834) (-890.867) [-893.230] (-893.515) -- 0:01:05 536500 -- (-891.542) [-894.361] (-891.862) (-890.061) * [-891.711] (-895.536) (-892.548) (-892.970) -- 0:01:05 537000 -- (-897.972) (-893.641) (-894.397) [-892.812] * (-895.015) (-896.443) (-893.006) [-889.192] -- 0:01:05 537500 -- (-899.566) [-893.914] (-889.839) (-892.300) * (-892.486) (-898.158) [-889.661] (-901.028) -- 0:01:05 538000 -- [-903.682] (-889.792) (-886.816) (-895.276) * (-889.583) (-889.271) (-890.318) [-895.395] -- 0:01:05 538500 -- [-895.796] (-897.916) (-889.970) (-892.944) * [-891.650] (-890.539) (-894.636) (-892.236) -- 0:01:05 539000 -- [-892.202] (-889.914) (-891.103) (-888.003) * [-899.147] (-890.867) (-890.788) (-896.117) -- 0:01:05 539500 -- (-900.397) [-893.533] (-892.136) (-889.920) * [-892.826] (-890.049) (-893.912) (-893.456) -- 0:01:04 540000 -- (-891.149) (-891.539) [-894.235] (-894.031) * (-895.152) (-889.597) (-890.825) [-889.057] -- 0:01:05 Average standard deviation of split frequencies: 0.000872 540500 -- [-890.882] (-894.616) (-891.344) (-898.122) * (-891.410) (-888.292) [-892.456] (-890.666) -- 0:01:05 541000 -- [-888.587] (-889.021) (-892.412) (-889.118) * (-893.428) (-892.291) [-890.405] (-892.654) -- 0:01:05 541500 -- [-895.370] (-887.909) (-890.781) (-893.945) * (-895.674) (-893.792) [-894.132] (-890.650) -- 0:01:05 542000 -- (-892.761) (-886.826) [-890.357] (-890.134) * [-888.025] (-894.484) (-895.564) (-889.267) -- 0:01:05 542500 -- [-890.529] (-889.403) (-890.844) (-896.388) * [-893.037] (-896.759) (-893.725) (-891.937) -- 0:01:04 543000 -- (-888.828) (-894.102) [-889.905] (-893.398) * (-897.532) (-897.336) (-892.012) [-889.892] -- 0:01:04 543500 -- (-895.274) (-893.732) [-889.619] (-889.352) * (-894.273) [-890.151] (-897.018) (-889.332) -- 0:01:04 544000 -- (-896.986) (-902.383) [-886.936] (-891.552) * [-893.305] (-892.328) (-891.649) (-891.331) -- 0:01:04 544500 -- (-893.720) [-892.980] (-894.270) (-896.425) * (-893.670) (-895.821) [-891.458] (-896.211) -- 0:01:04 545000 -- (-894.597) [-889.862] (-891.422) (-894.570) * (-893.094) [-890.857] (-887.719) (-893.213) -- 0:01:04 Average standard deviation of split frequencies: 0.000863 545500 -- [-888.986] (-892.562) (-890.300) (-899.460) * [-894.313] (-890.944) (-890.814) (-891.859) -- 0:01:04 546000 -- (-891.444) (-896.222) (-892.097) [-892.057] * (-893.447) (-893.328) (-894.258) [-895.579] -- 0:01:04 546500 -- (-892.493) (-894.510) (-889.622) [-891.063] * (-897.031) [-894.356] (-894.880) (-892.406) -- 0:01:03 547000 -- (-900.160) [-890.663] (-894.743) (-888.579) * (-891.729) (-892.044) [-889.013] (-897.997) -- 0:01:04 547500 -- (-890.949) (-893.133) [-890.080] (-889.398) * [-890.250] (-897.798) (-893.732) (-889.768) -- 0:01:04 548000 -- [-891.473] (-892.738) (-892.002) (-888.174) * [-889.756] (-893.189) (-889.132) (-890.037) -- 0:01:04 548500 -- (-892.766) (-891.882) [-893.012] (-889.872) * [-895.544] (-900.615) (-891.815) (-891.677) -- 0:01:04 549000 -- (-898.764) (-896.751) (-897.028) [-887.485] * [-891.857] (-889.306) (-892.323) (-892.759) -- 0:01:04 549500 -- (-899.251) [-890.096] (-890.474) (-893.036) * (-894.316) [-889.575] (-889.047) (-890.394) -- 0:01:03 550000 -- (-897.426) (-888.934) [-891.621] (-893.376) * (-891.540) [-893.072] (-893.202) (-895.125) -- 0:01:03 Average standard deviation of split frequencies: 0.000856 550500 -- [-891.617] (-895.792) (-887.850) (-899.028) * (-892.485) [-891.845] (-891.319) (-892.426) -- 0:01:03 551000 -- [-891.546] (-888.895) (-890.404) (-891.487) * (-891.063) [-892.059] (-892.791) (-895.546) -- 0:01:03 551500 -- (-901.878) [-892.165] (-892.706) (-894.971) * (-889.093) [-897.157] (-898.816) (-899.207) -- 0:01:03 552000 -- [-889.281] (-892.806) (-894.593) (-893.836) * [-892.033] (-889.375) (-893.189) (-891.027) -- 0:01:03 552500 -- (-891.638) [-889.248] (-889.590) (-899.440) * (-899.187) (-891.324) [-893.404] (-891.755) -- 0:01:03 553000 -- [-890.502] (-895.202) (-888.223) (-894.514) * (-898.875) (-892.167) [-891.297] (-888.426) -- 0:01:03 553500 -- (-894.250) [-894.798] (-891.158) (-896.002) * (-893.023) (-891.743) (-890.991) [-892.349] -- 0:01:02 554000 -- [-890.711] (-894.359) (-893.785) (-895.015) * (-893.534) (-891.190) [-892.145] (-891.354) -- 0:01:03 554500 -- (-893.475) (-889.676) [-891.214] (-891.016) * (-892.243) [-891.209] (-890.684) (-890.346) -- 0:01:03 555000 -- [-894.848] (-889.295) (-889.020) (-890.827) * (-893.664) [-887.053] (-896.101) (-888.560) -- 0:01:03 Average standard deviation of split frequencies: 0.000848 555500 -- (-894.289) (-889.471) (-893.815) [-894.598] * [-890.633] (-890.980) (-890.104) (-887.710) -- 0:01:03 556000 -- (-890.114) (-888.235) [-890.118] (-898.313) * (-893.572) (-894.030) (-890.456) [-892.741] -- 0:01:03 556500 -- (-895.620) (-890.612) [-892.477] (-896.843) * [-889.714] (-888.902) (-896.568) (-897.538) -- 0:01:02 557000 -- (-890.932) (-887.507) (-891.226) [-899.065] * (-889.873) [-892.770] (-893.372) (-894.483) -- 0:01:02 557500 -- (-892.067) [-893.252] (-891.651) (-894.863) * [-888.028] (-895.933) (-893.297) (-893.316) -- 0:01:02 558000 -- [-890.587] (-891.826) (-894.425) (-893.983) * (-890.222) [-890.447] (-892.763) (-891.329) -- 0:01:02 558500 -- [-890.095] (-888.658) (-893.198) (-896.912) * [-895.634] (-895.817) (-898.206) (-894.476) -- 0:01:02 559000 -- [-890.069] (-895.312) (-890.982) (-896.398) * (-889.854) [-894.638] (-895.237) (-890.384) -- 0:01:02 559500 -- [-889.862] (-889.968) (-895.403) (-898.091) * [-887.593] (-896.793) (-890.507) (-891.146) -- 0:01:02 560000 -- (-894.064) (-891.966) (-893.123) [-888.642] * (-896.925) (-896.372) [-893.808] (-897.670) -- 0:01:02 Average standard deviation of split frequencies: 0.001682 560500 -- (-888.779) (-898.280) [-890.452] (-897.275) * (-894.148) [-892.837] (-889.882) (-897.125) -- 0:01:02 561000 -- (-889.640) [-895.962] (-889.093) (-892.124) * (-902.020) [-888.245] (-894.678) (-892.740) -- 0:01:02 561500 -- [-898.027] (-892.199) (-888.416) (-891.309) * (-892.262) (-890.058) [-890.084] (-889.437) -- 0:01:02 562000 -- (-893.062) (-895.688) [-894.556] (-891.754) * (-890.795) [-892.244] (-891.344) (-891.000) -- 0:01:02 562500 -- [-889.020] (-899.470) (-891.044) (-892.358) * [-891.085] (-889.923) (-895.008) (-897.209) -- 0:01:02 563000 -- (-890.189) (-892.721) (-891.356) [-890.966] * (-890.811) (-891.087) (-890.638) [-889.513] -- 0:01:02 563500 -- (-895.343) [-895.008] (-896.366) (-891.951) * (-889.762) [-888.752] (-893.640) (-891.229) -- 0:01:01 564000 -- (-889.801) (-890.893) (-889.397) [-889.320] * [-897.243] (-888.350) (-893.129) (-891.187) -- 0:01:01 564500 -- (-892.787) (-892.507) (-890.691) [-892.090] * (-890.029) [-893.343] (-891.564) (-894.726) -- 0:01:01 565000 -- (-891.078) (-892.281) (-891.201) [-894.780] * [-889.149] (-890.785) (-891.816) (-895.016) -- 0:01:01 Average standard deviation of split frequencies: 0.002499 565500 -- (-895.000) [-896.003] (-892.776) (-892.194) * (-892.188) [-889.271] (-891.565) (-893.461) -- 0:01:01 566000 -- (-887.958) (-893.326) (-893.436) [-888.147] * (-894.016) (-889.555) (-891.632) [-895.801] -- 0:01:01 566500 -- [-889.946] (-893.354) (-889.107) (-890.895) * (-892.015) [-890.998] (-891.951) (-891.115) -- 0:01:01 567000 -- (-893.370) [-897.173] (-891.879) (-894.683) * [-887.437] (-893.177) (-894.136) (-893.036) -- 0:01:01 567500 -- (-892.025) [-889.294] (-890.199) (-894.670) * (-900.058) (-890.943) (-893.155) [-892.806] -- 0:01:01 568000 -- (-890.463) (-894.127) (-894.410) [-895.953] * (-890.758) [-896.363] (-893.755) (-894.043) -- 0:01:01 568500 -- [-894.400] (-890.478) (-891.898) (-901.867) * [-892.690] (-893.093) (-899.572) (-892.850) -- 0:01:01 569000 -- (-889.519) [-889.543] (-898.927) (-893.677) * (-891.548) [-895.934] (-894.435) (-896.314) -- 0:01:01 569500 -- [-891.813] (-889.605) (-891.810) (-896.860) * (-888.777) [-890.045] (-890.669) (-889.343) -- 0:01:01 570000 -- [-897.283] (-895.798) (-901.598) (-889.075) * [-888.663] (-890.148) (-894.972) (-890.370) -- 0:01:01 Average standard deviation of split frequencies: 0.002478 570500 -- (-892.472) (-888.378) (-895.622) [-888.338] * [-893.377] (-892.425) (-891.595) (-893.544) -- 0:01:00 571000 -- (-888.079) [-889.192] (-898.118) (-892.704) * (-888.286) (-891.402) [-895.159] (-893.204) -- 0:01:00 571500 -- (-888.625) (-891.854) (-900.839) [-888.443] * (-889.922) (-891.624) [-892.669] (-889.272) -- 0:01:00 572000 -- [-890.795] (-893.386) (-898.661) (-895.554) * (-891.595) (-890.914) [-887.895] (-890.275) -- 0:01:00 572500 -- (-896.062) (-893.161) (-894.527) [-894.116] * (-891.534) [-890.302] (-897.237) (-890.507) -- 0:01:00 573000 -- (-897.753) (-896.454) (-895.837) [-888.283] * (-890.448) (-892.808) [-896.423] (-894.920) -- 0:01:00 573500 -- (-892.673) [-891.083] (-897.081) (-894.371) * (-887.987) (-891.357) [-890.388] (-896.930) -- 0:01:00 574000 -- (-889.796) [-888.575] (-897.436) (-898.398) * (-888.894) [-893.166] (-890.397) (-898.774) -- 0:01:00 574500 -- (-893.353) [-891.722] (-893.120) (-894.914) * (-890.436) (-890.587) (-898.229) [-898.160] -- 0:01:00 575000 -- (-895.119) (-888.581) (-890.381) [-890.170] * (-895.025) [-888.337] (-901.295) (-895.247) -- 0:01:00 Average standard deviation of split frequencies: 0.001637 575500 -- (-897.267) (-889.550) (-892.358) [-889.438] * [-889.990] (-892.525) (-895.043) (-891.863) -- 0:01:00 576000 -- [-888.692] (-892.739) (-891.470) (-890.940) * (-893.909) (-887.405) [-893.398] (-893.428) -- 0:01:00 576500 -- (-891.260) [-887.980] (-893.180) (-891.956) * [-887.966] (-888.320) (-892.004) (-890.630) -- 0:01:00 577000 -- [-890.261] (-891.778) (-894.756) (-892.685) * (-900.052) (-888.735) [-891.800] (-891.875) -- 0:01:00 577500 -- (-899.485) (-890.212) [-893.960] (-890.781) * (-894.717) [-890.799] (-896.076) (-889.494) -- 0:00:59 578000 -- [-892.591] (-893.192) (-895.218) (-892.674) * (-891.822) (-890.438) [-891.101] (-892.711) -- 0:00:59 578500 -- (-893.972) [-886.463] (-889.169) (-895.703) * (-895.601) [-891.609] (-890.622) (-896.529) -- 0:00:59 579000 -- [-889.349] (-890.031) (-896.642) (-897.605) * (-891.155) (-893.001) [-888.788] (-898.480) -- 0:00:59 579500 -- (-892.295) [-889.376] (-894.110) (-894.369) * [-891.885] (-894.809) (-895.266) (-891.498) -- 0:00:59 580000 -- (-891.694) [-890.575] (-889.302) (-893.827) * [-901.922] (-899.490) (-891.470) (-891.595) -- 0:00:59 Average standard deviation of split frequencies: 0.000000 580500 -- (-894.980) (-887.449) (-890.109) [-891.998] * (-892.188) (-890.688) (-891.416) [-892.544] -- 0:00:59 581000 -- (-893.334) (-891.380) (-892.054) [-892.655] * (-898.085) [-893.093] (-891.707) (-892.756) -- 0:00:59 581500 -- (-892.005) [-888.017] (-889.913) (-894.666) * (-898.928) (-889.504) (-889.040) [-888.080] -- 0:00:59 582000 -- [-886.965] (-895.807) (-889.137) (-891.653) * [-891.899] (-893.129) (-894.487) (-888.315) -- 0:00:59 582500 -- (-887.608) [-890.719] (-895.009) (-892.441) * (-896.926) (-892.315) (-892.654) [-894.383] -- 0:00:59 583000 -- (-894.253) (-891.042) [-887.968] (-889.997) * (-897.749) (-895.900) (-901.205) [-893.278] -- 0:00:59 583500 -- [-891.943] (-893.720) (-889.396) (-889.042) * (-891.781) [-892.746] (-894.241) (-894.079) -- 0:00:59 584000 -- (-891.482) [-898.213] (-890.063) (-893.853) * (-892.082) (-888.723) (-898.631) [-893.623] -- 0:00:59 584500 -- (-895.884) (-890.482) [-890.279] (-895.858) * (-891.925) (-891.700) [-892.135] (-891.863) -- 0:00:59 585000 -- [-887.567] (-892.884) (-891.757) (-890.421) * [-889.980] (-893.972) (-890.359) (-894.903) -- 0:00:58 Average standard deviation of split frequencies: 0.001609 585500 -- (-890.198) (-889.279) [-893.312] (-891.503) * (-891.771) (-892.804) [-894.150] (-896.079) -- 0:00:58 586000 -- (-894.457) (-901.695) (-893.778) [-887.133] * [-889.996] (-893.801) (-893.567) (-894.700) -- 0:00:58 586500 -- (-896.337) [-896.319] (-888.388) (-895.338) * (-890.603) [-889.020] (-894.069) (-893.895) -- 0:00:58 587000 -- (-892.547) [-899.541] (-886.021) (-891.857) * (-894.526) [-891.293] (-892.128) (-888.940) -- 0:00:58 587500 -- (-893.659) (-895.757) [-894.501] (-896.209) * (-891.439) [-889.471] (-895.751) (-888.746) -- 0:00:58 588000 -- (-890.098) (-894.420) [-889.703] (-889.343) * (-890.075) (-893.478) (-896.575) [-890.243] -- 0:00:58 588500 -- (-891.181) (-892.700) [-888.054] (-890.200) * (-891.072) [-890.517] (-898.262) (-889.086) -- 0:00:58 589000 -- (-890.600) [-892.120] (-890.091) (-895.250) * (-892.049) [-888.518] (-894.634) (-891.948) -- 0:00:58 589500 -- [-889.191] (-890.706) (-901.672) (-892.773) * (-893.271) (-894.623) (-892.264) [-892.336] -- 0:00:58 590000 -- [-894.931] (-893.486) (-892.684) (-891.955) * (-894.791) (-889.538) [-891.761] (-889.799) -- 0:00:58 Average standard deviation of split frequencies: 0.002394 590500 -- (-891.312) (-890.547) (-894.517) [-891.179] * (-892.407) [-894.041] (-889.629) (-891.871) -- 0:00:58 591000 -- (-891.191) (-891.437) (-898.674) [-890.827] * (-897.012) (-903.586) [-897.425] (-898.142) -- 0:00:58 591500 -- [-892.943] (-889.869) (-895.557) (-901.662) * (-900.984) [-891.420] (-895.323) (-888.385) -- 0:00:58 592000 -- [-888.449] (-889.901) (-894.798) (-894.853) * (-891.443) (-889.180) [-889.747] (-896.395) -- 0:00:57 592500 -- (-894.816) [-892.120] (-893.470) (-890.434) * (-892.976) (-891.090) [-893.082] (-894.807) -- 0:00:57 593000 -- (-892.393) (-891.498) (-895.186) [-890.292] * [-891.002] (-896.895) (-889.937) (-889.780) -- 0:00:57 593500 -- (-891.924) (-895.831) [-891.994] (-891.950) * (-893.461) [-891.540] (-887.938) (-888.991) -- 0:00:57 594000 -- [-888.527] (-889.416) (-895.899) (-893.750) * (-892.970) (-893.338) [-891.543] (-894.439) -- 0:00:57 594500 -- (-889.327) (-890.023) (-890.166) [-892.759] * (-890.419) (-899.839) [-896.100] (-894.343) -- 0:00:57 595000 -- [-892.352] (-888.693) (-893.561) (-892.043) * [-889.319] (-898.589) (-891.587) (-888.186) -- 0:00:57 Average standard deviation of split frequencies: 0.004746 595500 -- (-894.024) [-890.072] (-892.510) (-897.516) * [-888.790] (-895.013) (-895.843) (-890.453) -- 0:00:57 596000 -- (-893.282) (-893.090) [-890.177] (-892.671) * (-893.303) (-900.660) (-892.556) [-890.096] -- 0:00:57 596500 -- [-893.309] (-891.728) (-894.202) (-899.132) * (-888.786) [-893.819] (-895.200) (-888.316) -- 0:00:57 597000 -- (-906.066) (-888.306) (-889.898) [-890.535] * [-889.069] (-903.400) (-897.167) (-889.622) -- 0:00:57 597500 -- (-906.533) (-895.333) [-890.361] (-894.560) * (-889.806) (-899.037) [-893.422] (-889.402) -- 0:00:57 598000 -- (-900.237) [-891.536] (-890.778) (-892.870) * (-892.012) (-892.098) [-889.414] (-892.552) -- 0:00:57 598500 -- (-899.371) [-890.190] (-890.119) (-896.665) * (-891.326) (-889.918) (-889.843) [-896.955] -- 0:00:57 599000 -- (-893.618) (-887.736) [-890.367] (-899.387) * (-894.015) (-899.442) [-891.149] (-891.479) -- 0:00:56 599500 -- (-897.997) (-892.997) (-890.825) [-896.328] * [-887.559] (-898.417) (-891.219) (-894.764) -- 0:00:56 600000 -- [-897.949] (-892.927) (-889.603) (-893.507) * (-894.019) (-894.308) [-893.522] (-895.613) -- 0:00:56 Average standard deviation of split frequencies: 0.004709 600500 -- (-893.627) [-892.678] (-888.284) (-892.905) * (-893.521) (-892.549) (-893.138) [-888.028] -- 0:00:56 601000 -- (-892.027) (-888.784) [-888.328] (-894.006) * (-894.249) (-895.837) [-889.868] (-891.245) -- 0:00:56 601500 -- (-888.461) [-890.533] (-891.190) (-891.368) * (-892.414) (-899.159) (-892.833) [-893.341] -- 0:00:56 602000 -- (-891.642) (-891.247) [-892.618] (-893.542) * (-895.536) (-899.321) (-894.070) [-888.281] -- 0:00:56 602500 -- [-890.608] (-890.464) (-893.404) (-893.080) * (-894.567) [-895.068] (-903.458) (-892.308) -- 0:00:56 603000 -- [-896.824] (-894.722) (-896.442) (-888.142) * (-890.584) (-900.820) [-891.011] (-890.688) -- 0:00:56 603500 -- (-895.605) (-891.680) [-888.159] (-895.494) * (-894.982) (-895.981) (-892.092) [-892.520] -- 0:00:56 604000 -- (-891.576) (-893.172) (-895.030) [-891.247] * (-890.689) [-893.136] (-892.118) (-894.672) -- 0:00:56 604500 -- (-891.684) [-891.589] (-893.361) (-894.173) * (-890.846) (-896.802) [-891.360] (-894.322) -- 0:00:56 605000 -- (-891.680) (-889.730) (-892.753) [-895.098] * (-890.975) (-894.524) (-892.845) [-890.241] -- 0:00:56 Average standard deviation of split frequencies: 0.003889 605500 -- (-893.004) (-896.454) [-891.360] (-895.295) * (-891.187) (-894.536) [-897.471] (-891.255) -- 0:00:56 606000 -- [-890.909] (-897.817) (-893.602) (-890.169) * [-888.635] (-895.842) (-889.758) (-893.334) -- 0:00:55 606500 -- (-893.671) [-893.126] (-893.722) (-887.740) * (-889.772) (-894.679) [-891.410] (-898.013) -- 0:00:55 607000 -- (-889.637) [-888.603] (-894.596) (-892.624) * (-889.628) (-897.891) (-894.494) [-898.403] -- 0:00:55 607500 -- (-892.490) (-891.237) (-890.357) [-891.730] * (-889.373) (-895.258) [-895.708] (-891.057) -- 0:00:55 608000 -- [-887.430] (-892.079) (-890.990) (-890.657) * (-895.454) (-894.752) [-891.962] (-891.272) -- 0:00:55 608500 -- (-888.202) (-893.909) (-891.810) [-892.589] * [-895.942] (-893.610) (-889.000) (-892.330) -- 0:00:55 609000 -- (-895.223) (-892.784) (-894.515) [-892.788] * (-890.370) [-892.111] (-890.899) (-892.035) -- 0:00:55 609500 -- [-893.599] (-889.407) (-895.763) (-891.303) * (-890.622) [-890.300] (-893.005) (-888.275) -- 0:00:55 610000 -- (-898.517) (-896.475) (-890.887) [-889.446] * (-892.147) (-892.317) (-891.610) [-889.576] -- 0:00:55 Average standard deviation of split frequencies: 0.004632 610500 -- [-895.337] (-889.877) (-890.741) (-890.673) * (-894.720) (-887.756) (-895.500) [-889.390] -- 0:00:55 611000 -- (-891.540) (-898.351) [-893.456] (-895.415) * (-893.837) [-889.116] (-890.273) (-891.282) -- 0:00:55 611500 -- (-891.081) [-890.666] (-889.138) (-894.201) * (-895.403) (-891.000) [-889.158] (-890.206) -- 0:00:55 612000 -- (-888.310) (-890.604) [-895.013] (-892.444) * (-898.399) (-896.527) [-888.526] (-894.279) -- 0:00:55 612500 -- (-891.090) [-892.844] (-899.396) (-893.270) * (-892.027) (-892.042) (-890.507) [-890.330] -- 0:00:55 613000 -- [-892.468] (-891.484) (-893.893) (-897.701) * (-890.165) (-889.325) [-889.558] (-893.619) -- 0:00:54 613500 -- (-896.693) (-887.839) [-889.683] (-891.990) * (-892.582) (-895.996) [-888.716] (-894.393) -- 0:00:54 614000 -- (-898.252) (-894.749) (-894.045) [-889.771] * (-889.037) (-891.131) [-889.328] (-890.933) -- 0:00:54 614500 -- (-895.358) (-894.557) [-889.742] (-892.189) * (-890.456) [-891.801] (-894.771) (-894.432) -- 0:00:54 615000 -- (-891.050) (-898.298) (-889.836) [-889.860] * (-889.705) (-890.179) (-899.474) [-892.152] -- 0:00:54 Average standard deviation of split frequencies: 0.006887 615500 -- [-892.439] (-890.959) (-891.308) (-896.570) * (-889.905) (-888.411) (-894.448) [-887.523] -- 0:00:54 616000 -- (-891.061) [-889.101] (-891.343) (-897.459) * (-894.934) [-889.722] (-889.845) (-891.242) -- 0:00:54 616500 -- (-894.462) (-893.740) [-893.995] (-895.588) * (-892.627) (-891.158) (-892.079) [-892.258] -- 0:00:54 617000 -- (-891.392) (-891.592) [-890.291] (-897.637) * [-894.540] (-888.814) (-894.588) (-893.951) -- 0:00:54 617500 -- (-891.951) (-896.294) [-892.922] (-895.880) * (-890.797) (-887.493) [-892.913] (-889.305) -- 0:00:54 618000 -- (-892.534) (-891.532) [-892.923] (-894.629) * (-891.252) (-891.050) (-892.923) [-889.444] -- 0:00:54 618500 -- [-891.452] (-892.497) (-892.488) (-891.365) * [-894.345] (-893.603) (-898.411) (-892.851) -- 0:00:54 619000 -- (-890.366) (-888.658) [-898.756] (-890.358) * (-894.475) (-889.132) [-895.413] (-892.386) -- 0:00:54 619500 -- (-893.168) (-890.413) (-901.023) [-893.631] * (-891.435) [-891.464] (-898.105) (-890.391) -- 0:00:54 620000 -- (-891.245) [-891.118] (-903.238) (-894.879) * (-886.882) [-893.712] (-890.577) (-895.799) -- 0:00:53 Average standard deviation of split frequencies: 0.006836 620500 -- (-889.836) (-889.451) [-892.932] (-893.871) * (-894.082) (-890.634) (-895.885) [-894.425] -- 0:00:53 621000 -- (-887.347) (-892.129) [-890.871] (-898.012) * (-890.728) (-899.153) (-890.789) [-895.363] -- 0:00:53 621500 -- (-891.431) [-891.593] (-892.004) (-894.289) * [-890.441] (-900.367) (-894.136) (-893.305) -- 0:00:53 622000 -- (-893.974) [-893.970] (-892.009) (-892.737) * (-892.317) [-890.467] (-892.659) (-893.391) -- 0:00:53 622500 -- (-896.204) [-893.964] (-892.396) (-899.661) * [-890.060] (-890.966) (-891.594) (-889.808) -- 0:00:53 623000 -- [-896.979] (-893.982) (-889.730) (-903.520) * [-889.919] (-890.500) (-891.371) (-892.747) -- 0:00:53 623500 -- (-893.146) (-894.753) [-889.740] (-902.188) * (-893.044) (-890.249) (-892.736) [-895.627] -- 0:00:53 624000 -- (-893.578) [-890.395] (-890.285) (-897.476) * [-888.776] (-892.744) (-891.263) (-893.710) -- 0:00:53 624500 -- (-895.545) [-893.964] (-891.340) (-897.646) * (-888.310) (-893.655) [-890.814] (-893.483) -- 0:00:53 625000 -- [-892.096] (-898.254) (-897.571) (-892.818) * (-890.175) (-896.958) [-894.004] (-892.392) -- 0:00:53 Average standard deviation of split frequencies: 0.004518 625500 -- (-888.406) (-891.085) (-891.786) [-892.033] * [-889.148] (-898.066) (-890.988) (-889.478) -- 0:00:53 626000 -- (-888.712) (-894.432) (-888.102) [-890.650] * (-896.702) (-892.842) [-891.007] (-888.220) -- 0:00:53 626500 -- (-894.192) [-890.583] (-899.445) (-891.636) * (-890.235) (-892.976) (-889.346) [-888.717] -- 0:00:53 627000 -- (-893.042) (-894.171) [-890.941] (-893.671) * [-890.051] (-896.222) (-894.819) (-889.152) -- 0:00:52 627500 -- [-889.871] (-891.990) (-896.119) (-896.090) * (-894.299) (-889.510) [-890.408] (-888.956) -- 0:00:52 628000 -- [-896.300] (-893.102) (-894.276) (-894.711) * (-890.146) [-890.392] (-893.379) (-894.459) -- 0:00:52 628500 -- (-893.970) [-890.477] (-891.904) (-904.882) * (-890.630) [-890.357] (-891.418) (-894.546) -- 0:00:52 629000 -- (-892.675) (-892.190) [-892.250] (-898.701) * (-892.062) [-890.779] (-898.742) (-894.877) -- 0:00:52 629500 -- (-895.029) [-893.056] (-892.885) (-896.506) * [-888.576] (-896.459) (-901.305) (-888.698) -- 0:00:52 630000 -- (-889.306) (-892.230) (-897.762) [-891.705] * (-888.937) (-890.106) [-895.004] (-894.675) -- 0:00:52 Average standard deviation of split frequencies: 0.004485 630500 -- (-888.851) (-894.898) (-891.011) [-891.846] * (-894.006) (-896.345) [-894.595] (-887.149) -- 0:00:52 631000 -- (-890.884) [-889.965] (-890.548) (-892.011) * (-895.314) (-895.655) (-890.087) [-889.679] -- 0:00:52 631500 -- (-888.492) (-890.187) [-890.340] (-891.753) * (-894.735) (-892.869) (-891.454) [-886.768] -- 0:00:52 632000 -- (-890.652) (-887.170) (-891.991) [-892.382] * [-890.566] (-891.558) (-894.126) (-896.624) -- 0:00:52 632500 -- (-894.855) (-892.210) (-892.545) [-892.796] * (-891.267) [-890.360] (-892.211) (-892.809) -- 0:00:52 633000 -- [-890.225] (-889.922) (-888.922) (-899.982) * (-890.912) (-890.309) [-892.464] (-896.035) -- 0:00:52 633500 -- (-890.329) (-891.493) [-899.754] (-892.828) * (-891.046) (-891.907) [-888.887] (-888.777) -- 0:00:52 634000 -- (-889.753) [-893.350] (-891.336) (-893.446) * [-891.568] (-893.615) (-894.068) (-895.352) -- 0:00:51 634500 -- (-889.738) (-891.449) [-890.343] (-895.090) * (-895.863) (-891.455) [-890.837] (-891.936) -- 0:00:51 635000 -- (-891.387) (-896.906) [-890.557] (-896.808) * (-893.814) (-890.059) (-891.751) [-890.825] -- 0:00:51 Average standard deviation of split frequencies: 0.003706 635500 -- [-896.054] (-895.671) (-898.846) (-896.961) * (-895.638) [-890.633] (-892.266) (-888.087) -- 0:00:51 636000 -- (-891.508) (-894.369) (-893.600) [-891.863] * (-890.179) (-891.128) [-890.994] (-893.727) -- 0:00:51 636500 -- (-894.709) (-888.864) (-900.409) [-893.812] * (-890.359) (-895.950) (-892.877) [-893.524] -- 0:00:51 637000 -- (-891.504) (-894.330) (-897.156) [-889.395] * (-889.982) (-894.044) [-889.063] (-891.136) -- 0:00:51 637500 -- [-889.926] (-890.051) (-893.651) (-892.764) * (-894.444) (-891.902) (-893.480) [-899.110] -- 0:00:51 638000 -- (-888.772) (-890.159) (-893.811) [-889.194] * (-894.024) [-891.302] (-893.096) (-889.789) -- 0:00:51 638500 -- (-893.358) (-892.384) [-890.381] (-894.127) * [-891.222] (-892.444) (-895.131) (-886.383) -- 0:00:51 639000 -- [-895.739] (-891.922) (-893.726) (-893.532) * (-889.156) [-894.917] (-894.713) (-891.080) -- 0:00:51 639500 -- (-891.549) (-893.480) (-893.222) [-889.918] * [-894.167] (-891.430) (-890.768) (-887.828) -- 0:00:51 640000 -- [-892.610] (-888.014) (-898.273) (-893.814) * (-890.674) (-893.274) [-891.726] (-892.971) -- 0:00:51 Average standard deviation of split frequencies: 0.003679 640500 -- (-891.204) (-890.219) (-895.149) [-895.813] * (-892.267) (-898.774) [-889.088] (-896.073) -- 0:00:51 641000 -- [-888.936] (-890.910) (-890.503) (-893.103) * [-894.130] (-890.549) (-895.989) (-894.786) -- 0:00:50 641500 -- [-892.397] (-895.342) (-896.486) (-890.070) * [-888.081] (-891.095) (-893.337) (-892.163) -- 0:00:50 642000 -- (-893.863) (-890.820) (-898.792) [-891.127] * (-896.052) (-895.447) [-887.945] (-889.855) -- 0:00:50 642500 -- (-892.086) (-891.178) [-892.400] (-893.939) * (-888.226) (-894.706) [-889.577] (-890.075) -- 0:00:50 643000 -- (-895.552) (-891.098) [-892.907] (-893.014) * [-890.509] (-899.037) (-894.788) (-890.690) -- 0:00:50 643500 -- (-892.102) (-889.983) (-894.737) [-902.571] * (-890.733) (-893.250) (-891.585) [-894.691] -- 0:00:50 644000 -- [-891.291] (-895.203) (-889.965) (-901.153) * (-887.610) (-899.734) [-892.624] (-889.811) -- 0:00:50 644500 -- (-890.348) (-901.389) [-893.294] (-894.921) * (-895.569) (-893.140) [-890.755] (-893.775) -- 0:00:50 645000 -- [-892.793] (-897.854) (-896.081) (-892.615) * [-890.247] (-900.420) (-887.883) (-891.487) -- 0:00:50 Average standard deviation of split frequencies: 0.005108 645500 -- (-892.450) (-890.356) [-896.034] (-896.486) * (-888.148) (-894.653) [-891.693] (-887.684) -- 0:00:50 646000 -- (-891.364) (-889.604) (-889.303) [-894.716] * (-890.207) [-890.342] (-894.594) (-888.975) -- 0:00:50 646500 -- (-892.780) [-888.829] (-888.719) (-894.987) * (-888.093) (-893.347) (-889.812) [-891.611] -- 0:00:50 647000 -- (-891.352) [-889.636] (-890.544) (-894.852) * (-891.116) (-891.036) (-889.146) [-895.820] -- 0:00:50 647500 -- [-893.532] (-890.157) (-897.439) (-900.173) * [-891.868] (-893.504) (-895.533) (-893.802) -- 0:00:50 648000 -- (-891.634) (-889.268) (-892.801) [-893.093] * (-891.184) [-893.284] (-894.559) (-893.416) -- 0:00:49 648500 -- (-899.817) (-896.261) [-894.576] (-896.404) * (-887.770) (-890.550) (-898.753) [-891.040] -- 0:00:49 649000 -- (-891.670) (-892.712) (-893.399) [-892.013] * (-898.138) [-894.333] (-894.727) (-892.722) -- 0:00:49 649500 -- (-891.344) (-893.023) [-891.035] (-892.055) * (-893.010) (-893.697) [-892.101] (-890.074) -- 0:00:49 650000 -- [-892.527] (-889.464) (-889.931) (-889.899) * (-896.319) [-889.316] (-893.667) (-891.787) -- 0:00:49 Average standard deviation of split frequencies: 0.005796 650500 -- (-898.390) (-887.769) (-892.561) [-891.560] * (-891.988) [-890.687] (-891.932) (-890.528) -- 0:00:49 651000 -- (-894.420) [-891.073] (-896.685) (-896.231) * (-895.227) [-888.218] (-894.255) (-894.330) -- 0:00:49 651500 -- (-890.425) (-892.762) (-895.691) [-891.343] * (-894.085) [-893.559] (-895.600) (-891.530) -- 0:00:49 652000 -- (-897.575) [-897.507] (-895.349) (-892.407) * (-891.611) [-888.555] (-892.703) (-891.064) -- 0:00:49 652500 -- (-900.856) [-888.641] (-893.710) (-889.610) * (-890.079) [-889.141] (-893.369) (-896.021) -- 0:00:49 653000 -- (-893.645) (-888.427) (-892.438) [-891.149] * (-888.829) (-891.041) (-890.076) [-890.912] -- 0:00:49 653500 -- (-891.933) [-889.532] (-891.479) (-894.091) * (-887.304) (-893.090) (-902.009) [-890.973] -- 0:00:49 654000 -- (-894.200) (-895.039) (-891.515) [-889.651] * (-893.155) (-887.035) (-888.087) [-893.461] -- 0:00:49 654500 -- (-892.959) [-893.071] (-892.077) (-889.998) * (-891.958) [-889.438] (-889.014) (-893.012) -- 0:00:49 655000 -- [-891.367] (-895.828) (-896.787) (-889.263) * [-892.750] (-896.087) (-890.452) (-890.687) -- 0:00:48 Average standard deviation of split frequencies: 0.005749 655500 -- [-889.494] (-893.459) (-892.561) (-890.813) * [-888.848] (-899.985) (-890.924) (-891.066) -- 0:00:48 656000 -- (-890.407) (-889.476) (-893.230) [-893.472] * (-900.471) (-893.804) (-895.016) [-893.154] -- 0:00:48 656500 -- [-891.569] (-893.361) (-889.373) (-891.354) * (-895.640) (-893.966) [-890.787] (-889.857) -- 0:00:48 657000 -- (-892.646) (-892.749) [-890.199] (-891.040) * [-891.391] (-897.960) (-897.862) (-895.046) -- 0:00:48 657500 -- (-898.333) (-892.475) (-894.557) [-892.034] * (-887.711) (-895.376) (-894.900) [-896.258] -- 0:00:48 658000 -- (-894.727) (-894.845) (-893.331) [-891.131] * (-895.366) (-893.795) (-893.220) [-889.675] -- 0:00:48 658500 -- [-897.270] (-891.657) (-891.135) (-896.277) * (-894.718) [-892.465] (-889.591) (-890.611) -- 0:00:48 659000 -- (-890.982) (-888.508) (-900.990) [-895.861] * [-892.021] (-895.648) (-891.534) (-891.690) -- 0:00:48 659500 -- [-891.630] (-893.207) (-887.857) (-905.311) * (-894.463) (-896.769) (-890.659) [-891.939] -- 0:00:48 660000 -- [-892.375] (-893.323) (-890.009) (-894.709) * (-895.329) (-894.329) [-895.399] (-888.843) -- 0:00:48 Average standard deviation of split frequencies: 0.005708 660500 -- (-889.668) [-898.916] (-889.566) (-892.151) * (-893.120) [-893.951] (-888.587) (-890.822) -- 0:00:48 661000 -- (-895.036) [-893.420] (-895.958) (-894.972) * (-893.054) [-891.810] (-893.393) (-888.943) -- 0:00:48 661500 -- (-890.930) (-892.900) (-893.208) [-890.410] * (-900.673) (-889.974) [-893.744] (-892.922) -- 0:00:48 662000 -- (-888.132) (-891.380) [-889.973] (-889.383) * (-892.229) [-896.920] (-892.454) (-889.030) -- 0:00:47 662500 -- [-892.429] (-892.412) (-895.788) (-893.210) * [-893.641] (-893.814) (-890.522) (-895.397) -- 0:00:47 663000 -- (-890.000) (-891.336) (-893.830) [-892.104] * [-893.661] (-894.567) (-888.788) (-893.032) -- 0:00:47 663500 -- (-894.865) (-893.799) (-891.841) [-890.145] * (-895.199) (-891.674) (-894.567) [-895.130] -- 0:00:47 664000 -- [-892.819] (-889.240) (-891.404) (-892.214) * (-894.352) (-891.044) (-894.560) [-893.584] -- 0:00:48 664500 -- (-893.212) (-893.340) (-895.372) [-891.699] * (-892.162) [-890.805] (-892.210) (-889.768) -- 0:00:47 665000 -- [-887.373] (-892.430) (-894.504) (-890.967) * [-897.045] (-892.283) (-892.299) (-897.512) -- 0:00:47 Average standard deviation of split frequencies: 0.006370 665500 -- (-889.498) (-895.087) [-891.731] (-893.275) * (-895.339) (-894.135) [-892.387] (-893.640) -- 0:00:47 666000 -- (-893.752) (-889.254) [-891.833] (-892.426) * (-889.317) (-898.080) (-889.566) [-894.358] -- 0:00:47 666500 -- (-892.291) (-893.727) [-890.365] (-891.149) * [-890.334] (-891.576) (-894.774) (-888.668) -- 0:00:47 667000 -- [-888.596] (-892.606) (-891.656) (-893.091) * (-896.193) [-887.464] (-891.072) (-890.606) -- 0:00:47 667500 -- (-891.967) (-896.290) (-889.961) [-889.144] * (-894.465) [-894.753] (-889.851) (-895.304) -- 0:00:47 668000 -- (-895.061) (-891.331) (-891.456) [-888.794] * (-889.220) (-898.727) [-888.514] (-899.423) -- 0:00:47 668500 -- (-892.449) (-889.230) [-890.311] (-892.229) * [-893.173] (-892.562) (-892.743) (-890.559) -- 0:00:47 669000 -- (-895.340) [-890.144] (-896.725) (-890.117) * (-893.448) (-890.787) (-890.395) [-896.449] -- 0:00:47 669500 -- (-893.975) [-888.956] (-896.151) (-889.314) * (-895.462) (-889.252) (-890.097) [-891.426] -- 0:00:46 670000 -- (-890.702) [-891.951] (-889.426) (-889.423) * [-892.567] (-894.354) (-888.830) (-894.982) -- 0:00:46 Average standard deviation of split frequencies: 0.005623 670500 -- (-890.131) (-892.980) (-894.309) [-892.340] * (-890.140) [-895.182] (-894.403) (-897.860) -- 0:00:46 671000 -- (-893.362) (-889.644) (-890.356) [-888.587] * [-890.604] (-890.671) (-897.139) (-894.213) -- 0:00:47 671500 -- (-894.657) (-889.564) [-889.111] (-894.763) * (-893.531) (-893.397) [-893.847] (-891.447) -- 0:00:46 672000 -- (-892.488) (-892.123) [-889.135] (-890.782) * [-893.761] (-890.930) (-889.533) (-892.734) -- 0:00:46 672500 -- (-888.469) (-892.602) [-897.535] (-890.754) * [-890.113] (-891.502) (-900.104) (-893.374) -- 0:00:46 673000 -- (-893.381) (-890.157) [-890.366] (-888.769) * [-892.131] (-890.138) (-892.706) (-891.086) -- 0:00:46 673500 -- (-893.546) [-894.200] (-894.223) (-888.096) * [-887.410] (-886.928) (-894.400) (-893.351) -- 0:00:46 674000 -- [-889.687] (-888.079) (-897.458) (-893.555) * (-888.297) (-895.464) (-896.653) [-889.468] -- 0:00:46 674500 -- (-893.278) (-892.232) (-890.091) [-890.138] * (-889.322) [-894.331] (-891.181) (-895.203) -- 0:00:46 675000 -- (-892.624) [-888.268] (-895.265) (-894.802) * (-891.391) (-891.119) [-890.017] (-892.905) -- 0:00:46 Average standard deviation of split frequencies: 0.004881 675500 -- (-892.577) (-890.046) (-893.372) [-895.953] * [-893.455] (-894.193) (-898.752) (-889.952) -- 0:00:46 676000 -- (-891.424) (-895.599) [-889.025] (-896.430) * (-889.903) [-887.077] (-897.291) (-895.242) -- 0:00:46 676500 -- (-896.271) [-890.976] (-889.435) (-894.069) * (-890.975) [-888.513] (-891.242) (-895.271) -- 0:00:45 677000 -- [-891.129] (-891.012) (-890.323) (-903.669) * (-890.942) [-893.894] (-892.547) (-895.261) -- 0:00:45 677500 -- [-895.350] (-892.807) (-893.026) (-890.520) * (-896.079) [-892.849] (-890.559) (-896.812) -- 0:00:45 678000 -- (-890.397) [-891.083] (-894.461) (-890.672) * (-895.843) (-894.093) (-888.054) [-889.073] -- 0:00:46 678500 -- (-893.357) (-892.490) (-893.675) [-889.474] * (-889.920) [-892.710] (-891.594) (-891.079) -- 0:00:45 679000 -- [-890.306] (-895.025) (-889.502) (-892.585) * (-891.688) (-891.813) (-892.612) [-889.928] -- 0:00:45 679500 -- [-889.346] (-893.802) (-891.684) (-887.977) * [-890.443] (-897.229) (-895.804) (-894.404) -- 0:00:45 680000 -- [-889.177] (-893.131) (-889.820) (-891.604) * (-895.159) [-890.928] (-891.602) (-895.122) -- 0:00:45 Average standard deviation of split frequencies: 0.004848 680500 -- (-893.413) (-892.040) [-893.004] (-892.660) * [-889.896] (-890.766) (-891.619) (-894.844) -- 0:00:45 681000 -- (-893.940) (-893.423) [-889.515] (-891.938) * (-894.052) [-889.885] (-894.662) (-891.620) -- 0:00:45 681500 -- (-895.968) (-890.704) (-889.490) [-890.279] * [-891.611] (-892.795) (-895.689) (-891.262) -- 0:00:45 682000 -- (-896.651) [-888.953] (-892.959) (-894.075) * [-891.479] (-891.368) (-895.398) (-892.364) -- 0:00:45 682500 -- (-895.862) (-892.700) [-891.914] (-892.806) * [-891.693] (-896.442) (-891.503) (-898.587) -- 0:00:45 683000 -- (-887.603) [-887.751] (-894.391) (-893.227) * (-888.866) (-891.902) (-893.863) [-902.787] -- 0:00:45 683500 -- (-892.017) (-889.771) (-893.189) [-889.331] * (-888.663) [-891.503] (-889.283) (-893.762) -- 0:00:44 684000 -- (-893.974) (-894.879) (-895.341) [-891.060] * (-891.495) (-888.927) [-889.992] (-894.487) -- 0:00:44 684500 -- (-891.748) [-892.391] (-893.085) (-892.917) * (-896.057) (-892.765) (-892.560) [-892.803] -- 0:00:44 685000 -- [-893.475] (-895.246) (-889.318) (-890.685) * (-901.734) (-890.080) [-887.885] (-889.420) -- 0:00:45 Average standard deviation of split frequencies: 0.004810 685500 -- [-889.163] (-894.921) (-889.691) (-896.932) * (-898.556) [-894.139] (-889.663) (-898.283) -- 0:00:44 686000 -- (-888.493) (-890.806) [-889.867] (-894.841) * (-899.404) [-894.728] (-890.328) (-894.908) -- 0:00:44 686500 -- (-894.312) [-894.733] (-891.579) (-893.396) * (-893.630) (-892.357) (-889.841) [-894.706] -- 0:00:44 687000 -- (-891.293) [-893.981] (-890.489) (-891.859) * (-891.081) (-888.564) (-891.343) [-896.303] -- 0:00:44 687500 -- (-892.227) (-890.497) [-889.933] (-901.749) * (-891.349) [-887.760] (-889.954) (-894.716) -- 0:00:44 688000 -- [-894.360] (-892.447) (-895.469) (-896.893) * (-890.695) (-891.382) (-888.809) [-894.006] -- 0:00:44 688500 -- (-889.134) [-888.379] (-891.284) (-896.990) * (-893.212) (-888.295) (-890.964) [-889.408] -- 0:00:44 689000 -- (-890.512) (-901.234) [-895.729] (-894.997) * (-897.182) [-894.024] (-892.569) (-896.295) -- 0:00:44 689500 -- [-894.363] (-896.766) (-888.105) (-890.072) * (-891.760) [-888.008] (-888.795) (-894.465) -- 0:00:44 690000 -- (-894.065) (-897.201) [-889.462] (-892.924) * [-890.582] (-889.441) (-891.181) (-890.713) -- 0:00:44 Average standard deviation of split frequencies: 0.006143 690500 -- (-890.413) (-896.126) (-897.255) [-887.194] * (-892.204) (-890.975) [-897.588] (-891.760) -- 0:00:43 691000 -- (-887.433) (-891.456) [-899.187] (-891.288) * (-891.420) [-889.758] (-891.930) (-890.499) -- 0:00:43 691500 -- [-888.162] (-894.791) (-894.131) (-894.535) * (-887.655) (-888.726) [-888.725] (-891.439) -- 0:00:43 692000 -- (-890.309) [-891.878] (-893.042) (-892.415) * (-890.274) (-890.343) (-888.444) [-889.177] -- 0:00:44 692500 -- [-893.360] (-892.676) (-891.157) (-893.056) * (-891.659) (-891.670) (-893.853) [-893.327] -- 0:00:43 693000 -- (-896.695) (-888.192) [-890.998] (-892.159) * (-895.786) (-895.274) [-892.468] (-896.076) -- 0:00:43 693500 -- [-894.418] (-894.344) (-893.439) (-894.160) * (-895.729) [-894.920] (-892.373) (-893.177) -- 0:00:43 694000 -- (-895.141) (-890.630) [-888.834] (-897.843) * (-891.172) (-897.210) [-888.815] (-889.708) -- 0:00:43 694500 -- (-892.035) (-888.573) [-893.503] (-890.268) * [-890.870] (-896.479) (-893.146) (-891.786) -- 0:00:43 695000 -- (-890.657) (-891.286) [-893.741] (-894.488) * [-890.756] (-894.999) (-890.697) (-886.556) -- 0:00:43 Average standard deviation of split frequencies: 0.005418 695500 -- (-893.572) (-894.518) [-892.395] (-890.651) * (-897.727) (-893.214) (-895.684) [-890.371] -- 0:00:43 696000 -- (-890.699) (-894.176) [-888.904] (-892.079) * (-891.769) [-891.282] (-892.389) (-889.693) -- 0:00:43 696500 -- (-893.216) [-893.910] (-891.687) (-890.992) * (-892.661) (-892.455) (-888.407) [-892.558] -- 0:00:43 697000 -- [-890.301] (-889.743) (-901.830) (-894.569) * (-896.150) (-893.475) [-889.716] (-892.346) -- 0:00:43 697500 -- (-893.493) [-896.140] (-896.220) (-893.516) * [-892.683] (-889.689) (-892.428) (-890.496) -- 0:00:42 698000 -- [-893.082] (-893.011) (-893.638) (-894.860) * (-889.279) [-896.801] (-892.619) (-890.744) -- 0:00:42 698500 -- (-897.328) (-892.533) [-890.153] (-895.673) * (-892.015) (-895.158) [-894.093] (-887.847) -- 0:00:43 699000 -- (-893.097) (-892.153) [-892.745] (-892.848) * (-890.813) (-890.513) (-894.218) [-891.446] -- 0:00:43 699500 -- [-891.508] (-890.889) (-890.671) (-897.455) * (-890.415) (-894.315) (-890.256) [-890.073] -- 0:00:42 700000 -- (-892.132) [-893.331] (-889.151) (-897.510) * (-894.614) (-898.113) (-888.661) [-898.317] -- 0:00:42 Average standard deviation of split frequencies: 0.003364 700500 -- (-894.047) [-891.802] (-900.134) (-894.800) * (-898.937) (-899.353) [-889.953] (-893.493) -- 0:00:42 701000 -- (-892.802) [-893.474] (-892.235) (-895.835) * (-891.862) (-890.182) [-891.339] (-891.944) -- 0:00:42 701500 -- [-887.567] (-894.397) (-889.524) (-898.499) * [-888.844] (-896.616) (-890.753) (-900.349) -- 0:00:42 702000 -- (-892.320) (-894.028) (-894.815) [-893.962] * (-894.892) (-893.276) (-892.383) [-892.378] -- 0:00:42 702500 -- [-888.952] (-895.390) (-890.567) (-894.040) * (-894.057) (-898.393) (-896.510) [-891.740] -- 0:00:42 703000 -- (-896.929) [-889.460] (-889.963) (-892.920) * (-894.107) [-887.595] (-893.658) (-890.925) -- 0:00:42 703500 -- (-896.408) (-894.783) (-893.816) [-895.772] * [-891.628] (-892.469) (-893.315) (-891.184) -- 0:00:42 704000 -- (-893.371) [-888.521] (-891.249) (-897.900) * (-893.471) (-894.819) (-890.489) [-888.730] -- 0:00:42 704500 -- [-892.394] (-893.478) (-890.533) (-896.980) * [-890.153] (-893.165) (-890.841) (-889.881) -- 0:00:41 705000 -- (-889.864) [-893.175] (-889.541) (-891.589) * [-890.077] (-893.273) (-890.140) (-894.628) -- 0:00:41 Average standard deviation of split frequencies: 0.003339 705500 -- (-889.328) [-889.917] (-889.776) (-890.633) * [-891.681] (-892.762) (-887.724) (-891.172) -- 0:00:42 706000 -- [-889.994] (-893.115) (-891.911) (-892.444) * (-895.884) (-895.284) [-894.267] (-899.134) -- 0:00:42 706500 -- (-896.937) (-891.456) [-889.516] (-891.575) * (-896.624) (-891.933) (-891.842) [-891.433] -- 0:00:41 707000 -- (-888.785) (-893.266) (-891.544) [-889.233] * (-891.798) (-887.728) (-891.029) [-893.167] -- 0:00:41 707500 -- [-893.174] (-891.726) (-894.418) (-889.591) * [-892.782] (-892.965) (-895.864) (-890.058) -- 0:00:41 708000 -- (-887.992) (-892.133) [-891.318] (-894.424) * [-890.217] (-893.309) (-891.313) (-891.583) -- 0:00:41 708500 -- (-897.592) [-890.794] (-891.650) (-892.351) * (-894.509) (-887.114) (-892.240) [-890.660] -- 0:00:41 709000 -- (-891.669) [-888.283] (-895.951) (-890.538) * (-892.326) (-887.712) (-894.753) [-890.246] -- 0:00:41 709500 -- (-891.728) (-897.165) [-891.686] (-898.300) * (-895.319) (-888.192) [-892.825] (-890.837) -- 0:00:41 710000 -- (-890.425) (-890.582) [-894.929] (-892.944) * [-893.039] (-889.302) (-889.934) (-886.706) -- 0:00:41 Average standard deviation of split frequencies: 0.002653 710500 -- [-890.183] (-894.483) (-891.317) (-893.565) * [-891.955] (-888.392) (-890.361) (-890.738) -- 0:00:41 711000 -- (-890.908) (-895.651) [-894.238] (-900.559) * (-904.782) (-890.939) [-890.338] (-897.469) -- 0:00:41 711500 -- [-894.642] (-888.148) (-891.480) (-896.851) * (-896.464) (-892.114) (-891.091) [-891.490] -- 0:00:40 712000 -- [-890.463] (-897.752) (-895.269) (-893.688) * (-889.523) [-892.748] (-888.587) (-895.993) -- 0:00:40 712500 -- (-898.197) (-897.689) [-894.216] (-891.499) * (-892.457) (-894.635) [-892.159] (-890.583) -- 0:00:41 713000 -- (-896.183) [-891.254] (-895.057) (-891.021) * (-894.219) (-894.405) [-887.632] (-896.198) -- 0:00:41 713500 -- [-892.279] (-893.369) (-900.873) (-888.378) * (-890.357) (-893.386) (-893.080) [-892.177] -- 0:00:40 714000 -- (-900.743) (-891.921) (-897.576) [-892.682] * [-890.632] (-895.475) (-895.251) (-893.589) -- 0:00:40 714500 -- (-889.102) [-888.525] (-893.085) (-893.262) * [-895.581] (-896.257) (-892.920) (-894.916) -- 0:00:40 715000 -- (-892.153) (-890.257) [-891.344] (-891.306) * (-896.690) (-897.204) [-893.841] (-889.569) -- 0:00:40 Average standard deviation of split frequencies: 0.001975 715500 -- (-897.864) [-893.947] (-888.837) (-890.267) * (-891.054) (-893.179) (-893.603) [-889.259] -- 0:00:40 716000 -- (-892.003) (-893.685) [-889.265] (-889.312) * [-892.083] (-894.982) (-893.895) (-890.930) -- 0:00:40 716500 -- (-896.387) (-889.474) [-890.036] (-892.245) * [-889.355] (-895.595) (-894.027) (-890.407) -- 0:00:40 717000 -- (-890.386) [-890.164] (-890.575) (-892.739) * (-889.530) (-889.472) [-892.401] (-891.953) -- 0:00:40 717500 -- (-888.385) (-890.996) (-889.389) [-889.163] * (-895.440) (-890.080) (-893.083) [-890.815] -- 0:00:40 718000 -- (-890.193) (-891.214) (-889.782) [-898.355] * (-891.854) [-891.134] (-891.660) (-898.021) -- 0:00:40 718500 -- (-893.710) (-893.596) (-891.849) [-894.026] * (-890.488) (-896.431) [-888.402] (-894.380) -- 0:00:39 719000 -- (-893.603) (-897.253) (-894.337) [-892.982] * (-891.129) [-886.989] (-894.766) (-896.450) -- 0:00:39 719500 -- [-891.361] (-893.043) (-891.341) (-893.744) * (-890.920) (-891.417) [-891.366] (-893.942) -- 0:00:40 720000 -- [-890.403] (-895.243) (-892.573) (-894.563) * (-892.522) (-893.562) [-890.647] (-894.726) -- 0:00:40 Average standard deviation of split frequencies: 0.001962 720500 -- (-891.813) (-896.537) (-893.210) [-890.410] * [-892.621] (-893.545) (-891.622) (-895.898) -- 0:00:39 721000 -- [-893.538] (-891.211) (-898.409) (-893.134) * (-892.549) [-891.009] (-895.317) (-901.331) -- 0:00:39 721500 -- (-891.882) (-890.716) [-892.065] (-889.922) * (-893.546) (-895.500) (-893.677) [-890.373] -- 0:00:39 722000 -- (-895.413) (-893.726) [-891.089] (-889.983) * (-891.035) [-894.037] (-890.921) (-889.415) -- 0:00:39 722500 -- (-889.336) [-892.205] (-898.473) (-894.892) * (-892.126) [-889.734] (-889.570) (-890.158) -- 0:00:39 723000 -- (-899.544) [-889.358] (-891.511) (-890.368) * (-888.284) [-892.330] (-896.101) (-890.418) -- 0:00:39 723500 -- (-895.446) [-890.884] (-891.342) (-894.271) * (-889.701) (-893.880) (-894.313) [-892.398] -- 0:00:39 724000 -- (-888.255) (-889.268) [-892.766] (-890.108) * [-888.120] (-891.274) (-891.641) (-892.197) -- 0:00:39 724500 -- (-888.433) [-890.732] (-895.424) (-891.926) * (-891.185) [-890.044] (-899.131) (-897.388) -- 0:00:39 725000 -- (-894.092) (-895.987) [-892.044] (-893.529) * (-891.491) (-890.563) (-895.957) [-890.019] -- 0:00:39 Average standard deviation of split frequencies: 0.001948 725500 -- [-893.914] (-894.964) (-897.557) (-889.552) * (-889.623) (-890.817) [-895.511] (-896.697) -- 0:00:38 726000 -- [-892.173] (-890.821) (-892.855) (-891.639) * (-889.156) (-889.019) [-890.014] (-889.305) -- 0:00:38 726500 -- (-891.685) [-889.417] (-887.124) (-892.538) * (-889.003) (-895.689) [-893.401] (-889.879) -- 0:00:39 727000 -- [-890.618] (-890.576) (-889.897) (-890.393) * [-891.483] (-892.937) (-892.216) (-889.823) -- 0:00:39 727500 -- [-891.420] (-889.677) (-888.085) (-891.395) * (-889.217) (-893.355) (-892.072) [-890.021] -- 0:00:38 728000 -- [-896.417] (-889.877) (-890.481) (-891.174) * (-890.947) (-890.757) (-899.226) [-889.029] -- 0:00:38 728500 -- (-889.473) [-889.513] (-890.999) (-897.396) * (-893.031) (-889.951) [-890.117] (-889.859) -- 0:00:38 729000 -- (-892.300) (-891.276) [-892.769] (-888.715) * (-894.861) (-889.521) [-887.983] (-893.937) -- 0:00:38 729500 -- (-889.894) [-891.931] (-893.594) (-896.852) * (-889.127) (-891.556) [-891.732] (-889.689) -- 0:00:38 730000 -- (-893.307) (-892.075) [-890.204] (-898.724) * (-889.992) (-897.127) [-896.410] (-894.320) -- 0:00:38 Average standard deviation of split frequencies: 0.002581 730500 -- (-892.845) [-891.071] (-895.151) (-895.224) * [-891.470] (-894.092) (-890.674) (-889.447) -- 0:00:38 731000 -- (-895.450) [-891.823] (-893.149) (-896.583) * (-899.012) [-894.437] (-893.394) (-891.156) -- 0:00:38 731500 -- (-892.102) (-895.184) [-888.043] (-902.432) * (-893.255) (-899.062) (-892.758) [-891.433] -- 0:00:38 732000 -- (-892.084) [-889.830] (-888.685) (-896.428) * (-897.945) (-896.402) (-894.170) [-888.366] -- 0:00:38 732500 -- [-890.190] (-892.510) (-896.366) (-890.567) * [-888.603] (-889.185) (-890.558) (-892.962) -- 0:00:37 733000 -- (-895.109) (-893.256) (-889.018) [-888.661] * (-896.086) (-896.389) [-891.536] (-892.106) -- 0:00:38 733500 -- (-890.607) (-892.925) (-887.945) [-887.528] * (-891.355) (-893.986) (-891.975) [-888.770] -- 0:00:38 734000 -- (-891.741) [-897.366] (-897.760) (-892.662) * (-892.523) (-889.192) (-891.282) [-887.233] -- 0:00:38 734500 -- (-893.747) (-894.517) (-895.122) [-889.904] * (-892.313) (-890.411) [-888.562] (-890.557) -- 0:00:37 735000 -- [-889.643] (-892.580) (-899.754) (-890.957) * (-888.690) (-892.046) (-889.944) [-892.745] -- 0:00:37 Average standard deviation of split frequencies: 0.002562 735500 -- (-894.142) [-892.405] (-897.302) (-893.063) * (-893.251) (-893.097) (-888.761) [-890.639] -- 0:00:37 736000 -- (-890.226) (-893.239) (-896.107) [-893.581] * (-892.612) [-889.573] (-892.890) (-897.502) -- 0:00:37 736500 -- (-889.015) [-890.281] (-898.034) (-892.916) * (-892.828) (-894.159) [-889.696] (-888.811) -- 0:00:37 737000 -- (-889.941) [-900.539] (-895.244) (-895.064) * (-888.026) [-888.935] (-890.332) (-890.138) -- 0:00:37 737500 -- (-890.530) (-891.762) (-895.786) [-890.361] * (-891.733) [-890.986] (-888.767) (-887.680) -- 0:00:37 738000 -- (-895.594) (-890.111) [-891.052] (-895.377) * (-893.993) (-889.212) [-889.088] (-891.506) -- 0:00:37 738500 -- (-892.666) [-888.410] (-890.934) (-892.986) * (-889.776) [-895.893] (-889.970) (-895.003) -- 0:00:37 739000 -- (-892.999) (-897.405) (-892.953) [-890.958] * (-889.604) (-893.367) (-893.545) [-891.788] -- 0:00:37 739500 -- (-898.015) (-892.336) (-896.251) [-890.713] * [-890.855] (-893.851) (-895.266) (-889.956) -- 0:00:36 740000 -- (-896.976) [-890.020] (-890.965) (-888.808) * (-889.544) (-891.214) [-890.855] (-897.251) -- 0:00:37 Average standard deviation of split frequencies: 0.003819 740500 -- [-888.323] (-891.929) (-890.868) (-895.849) * (-896.509) (-892.988) [-889.577] (-895.907) -- 0:00:37 741000 -- [-888.236] (-890.235) (-893.939) (-894.501) * [-890.660] (-897.410) (-892.390) (-890.947) -- 0:00:37 741500 -- (-894.126) (-893.478) (-893.638) [-893.853] * (-888.593) (-894.642) [-890.261] (-888.515) -- 0:00:36 742000 -- (-895.025) (-895.912) (-893.093) [-889.398] * (-890.969) [-894.501] (-891.444) (-890.444) -- 0:00:36 742500 -- (-892.719) [-892.098] (-888.437) (-892.399) * (-891.256) (-891.556) (-892.932) [-890.926] -- 0:00:36 743000 -- (-898.665) (-892.808) [-890.006] (-892.955) * (-895.254) (-896.923) [-895.123] (-890.764) -- 0:00:36 743500 -- (-895.235) [-895.104] (-892.059) (-895.341) * (-890.933) (-897.846) [-887.300] (-894.172) -- 0:00:36 744000 -- (-896.341) (-890.883) [-890.697] (-893.349) * (-891.799) [-894.195] (-893.715) (-894.631) -- 0:00:36 744500 -- [-892.721] (-889.345) (-897.267) (-895.309) * (-890.155) (-888.463) [-893.982] (-892.698) -- 0:00:36 745000 -- (-899.176) [-891.938] (-892.799) (-905.223) * (-892.213) [-887.942] (-893.893) (-892.051) -- 0:00:36 Average standard deviation of split frequencies: 0.003791 745500 -- (-889.102) (-894.588) (-893.422) [-896.874] * (-892.883) (-890.712) (-897.301) [-889.698] -- 0:00:36 746000 -- [-893.551] (-892.143) (-893.196) (-891.474) * (-893.253) (-890.335) [-895.018] (-892.887) -- 0:00:36 746500 -- (-889.754) [-897.098] (-890.411) (-888.066) * (-892.980) (-898.888) [-888.927] (-896.634) -- 0:00:35 747000 -- [-891.389] (-891.363) (-889.079) (-891.916) * [-893.761] (-892.968) (-887.837) (-892.864) -- 0:00:36 747500 -- [-896.188] (-895.714) (-890.451) (-898.042) * (-892.191) (-899.148) (-890.801) [-889.335] -- 0:00:36 748000 -- [-897.431] (-892.797) (-892.615) (-901.070) * (-889.190) (-896.220) [-890.542] (-892.794) -- 0:00:36 748500 -- [-891.192] (-895.560) (-891.683) (-890.066) * (-892.220) [-896.733] (-891.472) (-887.756) -- 0:00:35 749000 -- (-892.085) (-895.360) [-888.128] (-892.945) * (-890.217) (-891.150) [-893.778] (-890.281) -- 0:00:35 749500 -- (-893.818) [-896.887] (-887.232) (-890.334) * (-888.396) [-888.909] (-890.179) (-886.767) -- 0:00:35 750000 -- [-888.420] (-890.553) (-893.015) (-891.039) * (-890.801) [-894.443] (-890.112) (-888.578) -- 0:00:35 Average standard deviation of split frequencies: 0.003140 750500 -- (-895.384) (-893.454) [-893.488] (-894.947) * (-887.580) (-898.137) [-896.235] (-892.616) -- 0:00:35 751000 -- [-891.728] (-890.156) (-903.269) (-891.451) * [-895.413] (-898.749) (-894.537) (-890.833) -- 0:00:35 751500 -- (-890.246) (-890.617) (-893.422) [-888.064] * (-894.020) (-894.931) (-889.601) [-890.154] -- 0:00:35 752000 -- [-893.522] (-895.594) (-890.817) (-889.085) * (-894.789) (-894.644) (-892.900) [-891.212] -- 0:00:35 752500 -- (-892.672) (-900.696) [-891.890] (-895.815) * (-891.727) (-892.031) [-889.069] (-889.562) -- 0:00:35 753000 -- (-889.464) [-888.940] (-891.392) (-892.193) * [-893.611] (-897.525) (-891.406) (-893.162) -- 0:00:35 753500 -- (-890.922) (-887.435) (-890.513) [-893.465] * (-896.907) (-892.863) (-893.483) [-892.537] -- 0:00:35 754000 -- [-890.277] (-893.546) (-891.986) (-892.136) * (-893.124) (-894.699) [-887.462] (-888.653) -- 0:00:35 754500 -- (-889.654) (-894.089) (-888.921) [-889.550] * (-889.819) (-891.567) (-893.351) [-890.560] -- 0:00:35 755000 -- (-891.416) (-906.900) [-892.947] (-888.308) * [-893.552] (-893.003) (-890.661) (-888.749) -- 0:00:35 Average standard deviation of split frequencies: 0.003118 755500 -- (-895.077) [-887.676] (-894.495) (-893.026) * (-893.001) [-891.961] (-892.404) (-892.569) -- 0:00:34 756000 -- (-887.749) (-897.150) [-890.146] (-893.832) * (-888.905) [-892.277] (-889.167) (-892.053) -- 0:00:34 756500 -- [-897.510] (-893.505) (-889.448) (-891.740) * (-887.597) (-892.824) [-893.014] (-890.275) -- 0:00:34 757000 -- [-895.099] (-891.777) (-889.985) (-892.910) * [-890.501] (-890.136) (-895.557) (-890.085) -- 0:00:34 757500 -- (-890.554) (-890.047) [-889.029] (-894.056) * [-891.224] (-890.941) (-893.194) (-898.026) -- 0:00:34 758000 -- (-897.559) [-888.325] (-892.321) (-893.329) * (-892.431) [-892.407] (-894.191) (-897.250) -- 0:00:34 758500 -- (-889.170) (-895.102) [-889.693] (-892.326) * (-887.893) (-892.201) (-894.267) [-890.933] -- 0:00:34 759000 -- (-890.732) (-893.769) [-893.034] (-890.313) * (-893.208) (-900.394) (-891.004) [-891.599] -- 0:00:34 759500 -- (-897.678) (-892.161) (-894.512) [-893.681] * (-895.351) [-898.337] (-890.905) (-893.530) -- 0:00:34 760000 -- (-892.154) (-892.849) [-888.883] (-892.118) * (-889.391) (-897.168) [-894.455] (-897.320) -- 0:00:34 Average standard deviation of split frequencies: 0.003099 760500 -- [-891.783] (-897.966) (-889.442) (-887.842) * (-888.854) (-893.081) [-891.018] (-889.997) -- 0:00:34 761000 -- (-890.272) (-895.303) (-894.819) [-892.543] * (-888.268) [-891.314] (-893.830) (-905.188) -- 0:00:34 761500 -- (-895.852) (-895.700) (-891.788) [-891.432] * (-889.614) (-891.237) [-891.189] (-892.465) -- 0:00:34 762000 -- (-891.732) (-890.327) [-893.073] (-892.454) * (-889.112) (-902.921) (-892.696) [-889.798] -- 0:00:34 762500 -- [-889.946] (-900.048) (-890.227) (-890.458) * (-893.015) (-895.609) [-888.194] (-891.480) -- 0:00:33 763000 -- (-897.673) (-891.696) (-889.237) [-888.007] * (-896.037) [-890.673] (-889.518) (-896.421) -- 0:00:33 763500 -- (-897.058) (-888.433) (-889.095) [-891.097] * (-890.885) (-896.733) (-890.576) [-890.903] -- 0:00:33 764000 -- (-890.586) (-897.061) (-890.459) [-893.363] * (-895.471) (-892.990) [-891.890] (-893.376) -- 0:00:33 764500 -- (-893.327) (-894.841) (-900.178) [-889.700] * (-894.088) (-894.116) [-889.505] (-893.160) -- 0:00:33 765000 -- (-894.429) (-893.168) (-898.082) [-892.587] * (-891.037) (-893.655) (-888.892) [-890.469] -- 0:00:33 Average standard deviation of split frequencies: 0.002462 765500 -- (-896.549) (-895.885) [-887.887] (-898.959) * (-897.625) (-889.802) (-892.944) [-891.127] -- 0:00:33 766000 -- (-898.764) (-901.451) (-893.361) [-890.558] * (-887.524) [-890.969] (-897.592) (-892.270) -- 0:00:33 766500 -- (-894.381) (-895.633) [-890.237] (-889.599) * (-890.188) (-890.003) (-894.673) [-893.206] -- 0:00:33 767000 -- (-894.776) (-895.945) (-893.858) [-891.274] * (-896.194) (-893.334) (-892.428) [-888.346] -- 0:00:33 767500 -- (-888.997) (-892.566) (-895.544) [-888.295] * [-894.147] (-891.848) (-886.702) (-890.426) -- 0:00:33 768000 -- (-894.298) (-893.171) (-888.233) [-890.464] * (-893.633) (-893.555) [-888.685] (-894.550) -- 0:00:33 768500 -- [-888.687] (-899.695) (-890.535) (-896.218) * (-889.801) (-890.635) (-887.481) [-891.366] -- 0:00:33 769000 -- (-892.936) [-890.365] (-891.475) (-893.633) * (-891.317) (-893.326) [-896.992] (-896.538) -- 0:00:33 769500 -- (-891.195) (-891.412) [-896.208] (-895.727) * (-892.033) [-892.121] (-895.294) (-894.125) -- 0:00:32 770000 -- [-893.935] (-892.809) (-902.328) (-899.042) * [-890.964] (-893.239) (-887.538) (-900.139) -- 0:00:32 Average standard deviation of split frequencies: 0.001835 770500 -- (-893.458) [-896.276] (-890.381) (-896.943) * (-894.141) (-896.256) [-887.961] (-896.866) -- 0:00:32 771000 -- (-890.191) (-894.662) (-894.634) [-897.907] * (-892.543) (-896.227) (-892.888) [-897.307] -- 0:00:32 771500 -- [-895.670] (-894.894) (-892.928) (-897.720) * (-891.056) (-892.371) (-893.270) [-893.324] -- 0:00:32 772000 -- [-890.893] (-891.000) (-891.939) (-897.846) * (-890.047) (-891.438) (-895.119) [-889.935] -- 0:00:32 772500 -- (-890.623) (-889.323) (-890.195) [-894.061] * (-896.059) [-891.511] (-899.105) (-887.684) -- 0:00:32 773000 -- [-893.754] (-898.070) (-891.572) (-893.607) * (-894.235) (-893.559) [-888.426] (-892.217) -- 0:00:32 773500 -- (-893.933) (-895.771) [-893.090] (-895.142) * (-891.632) [-897.293] (-896.709) (-896.142) -- 0:00:32 774000 -- (-889.835) (-894.121) [-889.844] (-895.982) * (-890.583) (-890.535) [-892.649] (-891.468) -- 0:00:32 774500 -- (-894.704) [-889.907] (-894.674) (-890.995) * (-889.064) [-891.538] (-894.908) (-898.431) -- 0:00:32 775000 -- [-896.521] (-890.923) (-894.073) (-893.277) * [-891.782] (-900.432) (-888.803) (-897.444) -- 0:00:32 Average standard deviation of split frequencies: 0.001215 775500 -- (-893.925) (-896.226) [-887.069] (-891.987) * (-894.260) (-892.282) (-889.815) [-888.278] -- 0:00:32 776000 -- (-890.424) (-892.343) [-896.926] (-887.650) * (-893.057) (-889.949) [-888.789] (-894.888) -- 0:00:32 776500 -- (-894.490) (-900.473) (-890.283) [-889.060] * (-894.775) (-891.283) (-896.770) [-888.995] -- 0:00:31 777000 -- (-887.676) (-896.439) (-899.951) [-889.962] * (-889.748) (-891.988) (-895.604) [-890.289] -- 0:00:31 777500 -- (-891.071) (-889.404) (-889.428) [-891.925] * (-893.458) [-892.568] (-895.701) (-893.718) -- 0:00:31 778000 -- [-890.022] (-887.691) (-894.795) (-890.583) * (-890.071) [-890.634] (-894.968) (-896.835) -- 0:00:31 778500 -- (-890.802) [-891.303] (-897.852) (-890.286) * (-892.458) [-890.224] (-895.529) (-897.770) -- 0:00:31 779000 -- (-900.069) (-893.875) (-898.235) [-896.688] * [-892.031] (-897.046) (-886.684) (-893.967) -- 0:00:31 779500 -- [-892.349] (-896.195) (-897.312) (-889.421) * (-890.263) (-898.624) [-889.916] (-896.757) -- 0:00:31 780000 -- (-889.821) (-894.139) [-892.461] (-890.720) * (-893.917) [-897.807] (-898.093) (-891.420) -- 0:00:31 Average standard deviation of split frequencies: 0.001208 780500 -- (-890.145) [-897.042] (-890.362) (-889.327) * [-890.421] (-889.412) (-899.830) (-893.493) -- 0:00:31 781000 -- (-894.576) (-893.988) [-894.124] (-891.229) * (-890.712) [-890.923] (-891.452) (-892.220) -- 0:00:31 781500 -- (-887.867) (-892.742) (-892.490) [-891.257] * (-894.348) [-891.900] (-891.698) (-891.689) -- 0:00:31 782000 -- (-889.749) [-887.920] (-894.452) (-892.455) * (-891.922) (-896.891) [-892.192] (-890.318) -- 0:00:31 782500 -- (-892.040) (-889.039) [-892.360] (-890.830) * (-891.083) (-895.852) [-891.516] (-891.960) -- 0:00:31 783000 -- (-896.615) (-894.684) (-893.616) [-893.634] * (-891.297) [-893.703] (-892.342) (-891.149) -- 0:00:31 783500 -- (-891.907) (-900.509) [-890.217] (-891.463) * (-892.931) [-889.589] (-896.766) (-889.469) -- 0:00:30 784000 -- (-896.083) (-888.627) (-888.917) [-892.859] * (-891.116) (-890.159) [-893.296] (-889.456) -- 0:00:30 784500 -- [-891.714] (-892.352) (-893.545) (-902.400) * [-891.817] (-891.707) (-891.797) (-890.488) -- 0:00:30 785000 -- (-890.450) [-894.420] (-891.217) (-891.152) * [-897.928] (-897.595) (-894.291) (-893.572) -- 0:00:30 Average standard deviation of split frequencies: 0.001200 785500 -- (-895.884) (-891.849) (-891.561) [-892.627] * (-899.325) (-893.211) (-890.479) [-892.021] -- 0:00:30 786000 -- (-890.541) [-890.836] (-892.696) (-894.225) * (-890.755) (-891.264) [-896.674] (-895.731) -- 0:00:30 786500 -- (-892.045) [-894.307] (-894.859) (-892.308) * [-890.866] (-888.803) (-891.526) (-891.013) -- 0:00:30 787000 -- (-895.390) (-893.674) (-897.425) [-891.540] * (-895.332) [-891.182] (-892.290) (-894.659) -- 0:00:30 787500 -- (-889.224) [-890.694] (-888.135) (-892.743) * (-890.987) (-892.314) [-890.668] (-890.597) -- 0:00:30 788000 -- (-893.312) [-893.071] (-891.152) (-887.395) * (-890.231) (-894.843) [-890.507] (-889.083) -- 0:00:30 788500 -- (-897.710) [-892.114] (-893.632) (-890.544) * (-891.166) (-895.479) [-888.755] (-892.018) -- 0:00:30 789000 -- (-896.536) [-891.021] (-898.490) (-892.673) * [-889.499] (-894.207) (-891.933) (-896.030) -- 0:00:30 789500 -- (-899.335) (-888.513) (-898.348) [-891.964] * (-887.620) (-890.511) [-890.743] (-890.975) -- 0:00:30 790000 -- (-892.030) (-891.306) (-893.477) [-894.592] * (-900.050) (-895.291) [-888.323] (-894.313) -- 0:00:30 Average standard deviation of split frequencies: 0.000000 790500 -- [-890.664] (-890.265) (-892.311) (-893.653) * (-902.393) (-888.814) [-892.533] (-892.168) -- 0:00:29 791000 -- (-892.719) [-893.722] (-896.639) (-891.197) * (-895.414) (-892.435) [-891.069] (-893.056) -- 0:00:29 791500 -- (-892.401) [-895.838] (-890.267) (-888.743) * (-894.972) [-891.648] (-892.434) (-891.880) -- 0:00:29 792000 -- (-893.245) (-902.957) [-888.215] (-896.071) * (-890.404) [-891.385] (-895.680) (-894.955) -- 0:00:29 792500 -- [-892.332] (-893.073) (-894.526) (-899.796) * (-889.672) [-893.096] (-893.222) (-898.314) -- 0:00:29 793000 -- (-896.322) (-892.016) (-895.098) [-892.095] * (-893.862) [-895.650] (-895.367) (-894.168) -- 0:00:29 793500 -- (-889.790) (-891.088) [-890.115] (-894.565) * (-897.067) [-891.267] (-897.874) (-894.044) -- 0:00:29 794000 -- (-886.878) [-891.998] (-888.895) (-893.089) * (-893.287) (-891.533) [-892.274] (-892.582) -- 0:00:29 794500 -- [-891.496] (-892.269) (-891.019) (-892.049) * [-893.522] (-896.277) (-889.219) (-896.898) -- 0:00:29 795000 -- (-895.785) (-891.460) [-891.389] (-895.743) * (-890.875) (-900.680) [-891.986] (-892.689) -- 0:00:29 Average standard deviation of split frequencies: 0.000000 795500 -- (-892.599) (-890.606) [-895.871] (-895.037) * (-894.813) (-890.553) [-891.926] (-898.833) -- 0:00:29 796000 -- [-891.665] (-891.673) (-889.740) (-894.632) * [-889.848] (-889.792) (-888.334) (-898.232) -- 0:00:29 796500 -- [-891.509] (-893.125) (-890.483) (-895.230) * (-895.213) [-890.894] (-897.997) (-895.230) -- 0:00:29 797000 -- (-893.315) (-901.501) [-892.530] (-889.886) * [-891.768] (-887.371) (-891.410) (-892.209) -- 0:00:29 797500 -- (-893.617) (-897.695) [-891.794] (-894.871) * (-895.377) [-891.004] (-898.395) (-896.300) -- 0:00:28 798000 -- (-895.518) (-897.077) (-894.970) [-890.291] * [-894.458] (-893.340) (-893.936) (-892.416) -- 0:00:28 798500 -- (-894.859) (-894.293) (-892.117) [-891.750] * [-901.948] (-892.866) (-889.044) (-902.067) -- 0:00:28 799000 -- (-889.837) (-893.318) (-897.950) [-891.577] * [-889.615] (-895.314) (-900.969) (-891.248) -- 0:00:28 799500 -- (-888.679) (-890.810) (-894.933) [-888.992] * [-894.576] (-900.231) (-900.969) (-891.507) -- 0:00:28 800000 -- [-889.219] (-899.932) (-897.192) (-892.108) * (-892.640) (-896.749) (-892.684) [-891.946] -- 0:00:28 Average standard deviation of split frequencies: 0.000000 800500 -- (-892.770) (-892.165) [-889.597] (-893.021) * [-891.047] (-896.677) (-888.899) (-895.050) -- 0:00:28 801000 -- (-892.977) [-890.238] (-890.233) (-890.718) * (-890.673) [-891.443] (-893.819) (-888.944) -- 0:00:28 801500 -- [-893.737] (-893.853) (-896.867) (-891.854) * (-890.051) (-898.302) [-887.958] (-892.856) -- 0:00:28 802000 -- [-888.957] (-896.318) (-890.106) (-890.624) * (-892.942) [-893.937] (-889.445) (-893.520) -- 0:00:28 802500 -- (-890.705) (-890.534) (-896.011) [-890.045] * (-895.962) [-891.352] (-891.712) (-895.596) -- 0:00:28 803000 -- [-892.207] (-892.114) (-893.920) (-892.736) * [-891.254] (-904.368) (-888.844) (-892.052) -- 0:00:28 803500 -- (-889.704) [-891.074] (-895.536) (-889.147) * [-891.126] (-894.201) (-890.304) (-888.434) -- 0:00:28 804000 -- [-890.194] (-893.106) (-894.253) (-894.436) * (-892.535) (-894.468) [-889.709] (-891.668) -- 0:00:28 804500 -- (-887.766) (-897.801) [-891.577] (-895.852) * (-894.491) (-894.131) (-891.938) [-894.218] -- 0:00:27 805000 -- [-891.206] (-895.645) (-896.674) (-893.583) * (-894.480) [-896.700] (-895.248) (-892.315) -- 0:00:27 Average standard deviation of split frequencies: 0.000585 805500 -- [-887.319] (-892.100) (-895.794) (-892.129) * (-894.579) (-892.755) [-891.633] (-890.613) -- 0:00:27 806000 -- (-895.518) (-894.532) (-891.874) [-893.523] * (-897.213) (-897.377) [-890.816] (-889.345) -- 0:00:27 806500 -- [-891.472] (-896.641) (-894.294) (-893.237) * [-894.030] (-889.352) (-895.937) (-891.353) -- 0:00:27 807000 -- (-892.975) (-893.792) (-891.535) [-893.306] * (-889.783) (-891.235) [-888.138] (-894.381) -- 0:00:27 807500 -- [-896.205] (-888.815) (-890.945) (-894.442) * (-889.518) (-891.622) (-892.757) [-893.151] -- 0:00:27 808000 -- (-891.290) (-893.115) [-888.143] (-893.530) * [-888.545] (-896.141) (-890.257) (-890.052) -- 0:00:27 808500 -- (-887.687) [-888.617] (-894.484) (-895.627) * (-889.696) (-892.302) [-890.275] (-895.199) -- 0:00:27 809000 -- (-890.303) (-891.810) [-889.841] (-893.425) * (-889.385) (-894.537) (-900.875) [-894.512] -- 0:00:27 809500 -- (-895.243) [-889.339] (-891.240) (-895.411) * (-892.551) [-892.273] (-892.731) (-889.201) -- 0:00:27 810000 -- (-890.869) (-897.845) (-892.439) [-891.233] * [-887.689] (-893.716) (-891.078) (-894.348) -- 0:00:27 Average standard deviation of split frequencies: 0.000582 810500 -- (-891.242) (-893.169) (-887.872) [-888.350] * (-890.283) (-889.312) [-893.839] (-896.909) -- 0:00:27 811000 -- (-892.893) (-895.502) [-890.574] (-892.464) * (-896.417) (-891.842) (-894.671) [-890.409] -- 0:00:27 811500 -- (-887.667) (-902.265) (-888.242) [-890.896] * (-891.958) [-896.257] (-889.788) (-894.092) -- 0:00:26 812000 -- [-894.621] (-891.168) (-892.010) (-893.754) * [-893.794] (-896.027) (-892.482) (-892.886) -- 0:00:26 812500 -- (-901.445) (-896.014) [-892.585] (-888.998) * (-899.423) (-891.579) [-889.761] (-891.181) -- 0:00:26 813000 -- (-897.242) (-891.880) (-891.819) [-895.371] * (-898.446) [-892.407] (-894.388) (-894.554) -- 0:00:26 813500 -- (-896.633) (-894.532) (-897.521) [-891.503] * [-899.668] (-892.169) (-894.619) (-895.601) -- 0:00:26 814000 -- (-891.497) [-888.733] (-897.790) (-889.503) * [-890.850] (-889.280) (-892.707) (-896.444) -- 0:00:26 814500 -- (-889.767) [-891.441] (-890.590) (-889.926) * (-888.992) (-895.913) (-890.004) [-891.223] -- 0:00:26 815000 -- [-893.571] (-890.213) (-890.521) (-892.027) * [-887.285] (-892.452) (-891.405) (-895.636) -- 0:00:26 Average standard deviation of split frequencies: 0.002311 815500 -- (-896.260) (-892.988) [-889.992] (-890.018) * [-892.452] (-897.662) (-893.324) (-894.138) -- 0:00:26 816000 -- (-892.999) (-887.587) (-892.459) [-891.052] * (-890.382) [-891.853] (-891.435) (-890.475) -- 0:00:26 816500 -- (-892.292) (-890.137) (-889.494) [-890.230] * [-895.114] (-893.637) (-893.042) (-891.458) -- 0:00:26 817000 -- (-891.051) [-891.037] (-890.939) (-894.564) * (-894.550) [-888.357] (-894.877) (-892.210) -- 0:00:26 817500 -- [-895.721] (-893.757) (-890.704) (-895.098) * (-889.817) (-897.403) (-889.016) [-891.567] -- 0:00:26 818000 -- [-893.275] (-888.772) (-895.321) (-890.818) * (-892.662) [-889.840] (-889.171) (-890.882) -- 0:00:26 818500 -- (-894.639) (-895.533) [-891.278] (-895.455) * [-893.900] (-895.217) (-892.701) (-891.216) -- 0:00:25 819000 -- (-893.793) (-892.505) (-890.524) [-895.645] * (-892.275) (-896.590) [-891.404] (-902.014) -- 0:00:25 819500 -- (-905.104) (-892.468) [-890.818] (-896.659) * (-891.438) [-887.038] (-895.843) (-891.583) -- 0:00:25 820000 -- (-889.172) [-889.136] (-893.857) (-893.164) * [-890.573] (-888.862) (-889.507) (-895.059) -- 0:00:25 Average standard deviation of split frequencies: 0.002872 820500 -- [-894.962] (-890.000) (-894.255) (-900.486) * (-890.387) (-894.125) [-888.345] (-890.514) -- 0:00:25 821000 -- (-889.711) [-887.749] (-892.496) (-896.294) * (-895.304) (-893.044) [-888.723] (-893.849) -- 0:00:25 821500 -- (-891.451) [-891.860] (-887.424) (-889.777) * (-892.439) (-897.634) [-896.513] (-888.462) -- 0:00:25 822000 -- [-888.017] (-891.026) (-896.681) (-888.570) * (-892.086) (-901.256) [-890.314] (-893.587) -- 0:00:25 822500 -- [-890.112] (-888.615) (-898.665) (-889.397) * [-897.025] (-900.826) (-890.432) (-891.589) -- 0:00:25 823000 -- (-888.569) (-891.833) [-895.748] (-899.355) * [-888.660] (-893.907) (-888.837) (-893.373) -- 0:00:25 823500 -- [-893.685] (-891.153) (-892.840) (-895.171) * (-890.936) (-895.979) (-890.244) [-889.474] -- 0:00:25 824000 -- (-893.122) [-890.322] (-892.891) (-899.536) * [-890.065] (-887.271) (-892.561) (-890.506) -- 0:00:25 824500 -- (-889.698) (-888.477) (-888.619) [-890.770] * [-891.886] (-892.457) (-892.451) (-894.245) -- 0:00:25 825000 -- (-889.538) [-899.145] (-896.523) (-894.291) * [-893.396] (-891.035) (-890.676) (-890.782) -- 0:00:25 Average standard deviation of split frequencies: 0.001712 825500 -- (-892.182) (-897.765) [-889.332] (-890.443) * (-895.163) (-893.245) (-901.753) [-889.238] -- 0:00:24 826000 -- (-888.955) (-890.701) (-893.524) [-892.420] * (-900.436) (-899.850) [-898.464] (-891.405) -- 0:00:24 826500 -- (-890.889) [-892.885] (-890.047) (-890.081) * [-895.566] (-896.606) (-890.035) (-898.715) -- 0:00:24 827000 -- (-890.508) (-890.792) [-895.075] (-891.008) * (-888.893) (-897.392) (-894.589) [-890.516] -- 0:00:24 827500 -- (-891.588) [-893.060] (-888.872) (-894.252) * [-890.681] (-892.543) (-894.545) (-896.469) -- 0:00:24 828000 -- [-892.176] (-895.102) (-890.213) (-890.200) * [-896.247] (-890.612) (-890.946) (-894.929) -- 0:00:24 828500 -- (-899.493) (-894.208) [-890.135] (-893.162) * (-893.491) (-894.128) [-892.816] (-895.134) -- 0:00:24 829000 -- (-896.660) [-889.436] (-891.473) (-892.036) * [-893.582] (-893.678) (-900.399) (-890.784) -- 0:00:24 829500 -- (-896.334) [-893.168] (-892.307) (-893.657) * (-893.173) [-890.170] (-897.028) (-894.218) -- 0:00:24 830000 -- [-896.523] (-893.140) (-895.208) (-896.781) * (-892.703) [-888.702] (-889.203) (-896.810) -- 0:00:24 Average standard deviation of split frequencies: 0.002270 830500 -- (-892.987) [-891.073] (-899.464) (-889.408) * [-889.979] (-892.932) (-889.611) (-891.759) -- 0:00:24 831000 -- (-894.289) (-896.904) (-896.761) [-890.320] * (-893.617) (-892.213) (-894.280) [-889.149] -- 0:00:24 831500 -- [-891.823] (-890.020) (-896.440) (-895.290) * (-893.190) [-889.267] (-891.660) (-891.824) -- 0:00:24 832000 -- (-891.663) (-892.363) [-889.316] (-891.679) * (-890.704) [-891.758] (-892.257) (-892.190) -- 0:00:24 832500 -- (-894.485) (-892.909) (-895.287) [-895.121] * (-889.519) (-889.779) (-897.533) [-894.446] -- 0:00:23 833000 -- (-888.215) (-898.389) [-894.543] (-888.962) * (-898.833) (-890.456) (-893.896) [-890.825] -- 0:00:23 833500 -- (-891.753) (-895.179) (-890.171) [-889.901] * (-891.162) [-891.387] (-895.213) (-888.719) -- 0:00:23 834000 -- (-889.853) (-887.934) [-891.521] (-892.768) * [-893.798] (-894.418) (-889.198) (-891.087) -- 0:00:23 834500 -- (-887.693) (-888.905) [-889.507] (-892.704) * (-892.361) [-895.989] (-889.652) (-891.289) -- 0:00:23 835000 -- (-893.496) (-892.471) [-895.603] (-891.151) * (-890.954) (-895.089) [-891.978] (-892.496) -- 0:00:23 Average standard deviation of split frequencies: 0.002256 835500 -- (-900.467) (-892.864) [-891.707] (-887.983) * (-892.104) (-898.758) (-892.207) [-892.371] -- 0:00:23 836000 -- [-892.509] (-888.444) (-891.942) (-900.780) * (-894.129) [-890.189] (-893.180) (-893.311) -- 0:00:23 836500 -- (-892.711) [-893.912] (-891.641) (-891.537) * (-893.882) (-890.942) [-892.567] (-890.282) -- 0:00:23 837000 -- (-894.922) (-893.414) [-896.294] (-893.299) * (-896.914) (-898.241) (-890.082) [-888.211] -- 0:00:23 837500 -- (-889.749) [-891.394] (-896.238) (-895.576) * [-890.248] (-894.507) (-892.036) (-889.620) -- 0:00:23 838000 -- [-891.330] (-893.922) (-895.552) (-894.537) * (-891.874) (-893.444) [-897.388] (-888.971) -- 0:00:23 838500 -- (-890.434) [-892.601] (-892.021) (-891.171) * (-895.148) (-895.849) (-893.702) [-894.696] -- 0:00:23 839000 -- [-892.713] (-891.677) (-889.775) (-900.489) * (-894.660) (-896.796) [-895.782] (-891.421) -- 0:00:23 839500 -- (-890.130) [-895.516] (-887.610) (-896.177) * (-895.466) (-891.506) [-887.229] (-893.526) -- 0:00:22 840000 -- [-892.977] (-891.502) (-891.001) (-891.469) * (-893.318) (-897.479) [-892.886] (-891.543) -- 0:00:22 Average standard deviation of split frequencies: 0.002804 840500 -- [-892.477] (-891.091) (-894.638) (-893.484) * (-890.349) (-891.334) (-890.291) [-894.147] -- 0:00:22 841000 -- [-890.819] (-891.743) (-904.494) (-893.825) * (-897.634) [-891.575] (-893.168) (-894.020) -- 0:00:22 841500 -- (-899.496) [-897.645] (-896.882) (-895.957) * (-890.658) (-895.800) [-889.137] (-892.025) -- 0:00:22 842000 -- (-893.399) (-898.772) (-891.434) [-889.566] * (-891.679) (-897.969) (-888.564) [-894.651] -- 0:00:22 842500 -- (-893.505) (-895.691) (-899.050) [-890.878] * (-895.042) (-892.275) [-889.906] (-889.427) -- 0:00:22 843000 -- [-891.939] (-891.626) (-891.924) (-891.635) * [-888.713] (-892.325) (-890.767) (-889.587) -- 0:00:22 843500 -- (-887.869) (-892.137) (-892.032) [-895.322] * [-896.996] (-889.701) (-894.546) (-893.343) -- 0:00:22 844000 -- [-890.135] (-894.460) (-889.926) (-891.764) * (-891.143) (-895.588) (-894.886) [-890.719] -- 0:00:22 844500 -- (-890.812) (-894.451) [-889.293] (-892.866) * (-893.424) [-890.236] (-894.186) (-899.057) -- 0:00:22 845000 -- (-888.078) [-893.408] (-894.871) (-888.320) * (-897.355) (-895.940) (-889.444) [-892.985] -- 0:00:22 Average standard deviation of split frequencies: 0.003343 845500 -- (-893.605) [-890.029] (-892.901) (-891.554) * (-894.333) (-891.256) (-895.633) [-892.606] -- 0:00:22 846000 -- (-896.658) (-899.070) (-891.884) [-890.267] * [-898.007] (-897.038) (-898.262) (-891.492) -- 0:00:22 846500 -- (-894.001) (-892.469) (-897.251) [-894.258] * (-891.939) [-888.522] (-891.417) (-887.950) -- 0:00:21 847000 -- (-896.125) [-889.138] (-891.552) (-890.963) * (-895.516) (-895.310) (-894.768) [-895.452] -- 0:00:21 847500 -- [-890.788] (-888.639) (-899.217) (-891.931) * (-895.453) (-889.429) (-894.404) [-895.002] -- 0:00:21 848000 -- (-894.952) (-897.411) [-894.671] (-900.708) * (-890.592) (-890.269) [-898.059] (-893.118) -- 0:00:21 848500 -- (-892.286) [-897.104] (-891.052) (-897.801) * [-898.165] (-890.012) (-901.150) (-895.648) -- 0:00:21 849000 -- [-898.633] (-896.340) (-892.171) (-897.357) * (-896.080) [-889.666] (-890.500) (-889.611) -- 0:00:21 849500 -- (-893.697) (-888.982) [-889.491] (-894.753) * (-896.451) (-891.770) [-887.791] (-888.765) -- 0:00:21 850000 -- (-891.021) [-888.435] (-891.243) (-895.543) * (-894.327) (-894.601) [-888.327] (-891.256) -- 0:00:21 Average standard deviation of split frequencies: 0.002217 850500 -- [-890.290] (-894.968) (-896.514) (-894.372) * [-894.052] (-892.427) (-893.113) (-893.511) -- 0:00:21 851000 -- (-892.983) (-892.586) [-890.706] (-895.915) * (-891.157) (-889.883) [-891.375] (-890.500) -- 0:00:21 851500 -- (-893.958) [-891.333] (-895.664) (-891.499) * [-896.258] (-891.389) (-890.024) (-890.183) -- 0:00:21 852000 -- (-892.673) (-888.169) (-891.481) [-892.889] * (-895.351) (-891.565) (-894.959) [-891.249] -- 0:00:21 852500 -- (-888.687) [-889.373] (-890.026) (-893.003) * (-890.651) (-892.097) (-891.979) [-890.220] -- 0:00:21 853000 -- (-888.602) [-890.842] (-904.170) (-890.614) * [-892.872] (-891.326) (-895.021) (-892.948) -- 0:00:21 853500 -- (-891.466) (-892.647) (-890.993) [-897.582] * (-889.838) [-889.522] (-890.928) (-889.625) -- 0:00:20 854000 -- (-891.230) (-891.998) [-891.890] (-889.433) * [-892.276] (-890.930) (-890.713) (-890.715) -- 0:00:20 854500 -- (-893.959) (-889.465) [-892.585] (-894.662) * (-893.382) [-891.131] (-889.212) (-893.714) -- 0:00:20 855000 -- [-893.809] (-890.242) (-893.822) (-894.006) * (-888.849) (-891.128) (-891.604) [-893.976] -- 0:00:20 Average standard deviation of split frequencies: 0.002754 855500 -- (-888.097) [-890.829] (-897.065) (-892.998) * (-888.618) [-890.080] (-888.977) (-888.813) -- 0:00:20 856000 -- [-888.416] (-892.246) (-900.599) (-895.881) * (-895.858) (-889.255) (-891.164) [-890.813] -- 0:00:20 856500 -- (-888.649) (-893.014) [-895.583] (-900.147) * [-892.910] (-890.435) (-889.824) (-889.627) -- 0:00:20 857000 -- (-895.901) (-895.603) [-895.030] (-900.500) * (-897.910) (-894.958) (-889.799) [-893.313] -- 0:00:20 857500 -- (-892.620) (-893.558) [-889.576] (-891.580) * (-899.700) [-890.538] (-888.752) (-890.896) -- 0:00:20 858000 -- (-895.087) (-891.180) (-892.454) [-892.061] * (-890.599) (-893.283) [-892.384] (-892.834) -- 0:00:20 858500 -- (-892.217) (-891.757) (-891.445) [-891.125] * (-887.565) (-896.927) [-891.339] (-890.939) -- 0:00:20 859000 -- (-889.965) (-891.131) [-890.622] (-890.373) * (-889.320) [-893.796] (-892.813) (-895.500) -- 0:00:20 859500 -- (-891.517) [-890.599] (-890.583) (-891.991) * [-893.031] (-887.982) (-895.210) (-893.512) -- 0:00:20 860000 -- (-891.758) [-890.006] (-892.092) (-892.330) * (-893.063) (-891.065) [-893.517] (-890.315) -- 0:00:20 Average standard deviation of split frequencies: 0.003834 860500 -- (-894.939) (-892.384) [-895.288] (-896.323) * (-897.459) (-892.642) [-895.304] (-889.977) -- 0:00:19 861000 -- [-892.649] (-897.396) (-891.075) (-895.102) * [-890.125] (-891.993) (-895.004) (-892.124) -- 0:00:19 861500 -- (-891.759) (-896.885) (-892.695) [-895.127] * (-890.494) [-891.696] (-889.357) (-892.109) -- 0:00:19 862000 -- (-891.103) [-898.608] (-889.927) (-889.155) * [-890.720] (-895.965) (-892.062) (-889.207) -- 0:00:19 862500 -- (-893.034) (-896.731) (-890.105) [-889.759] * (-892.653) [-892.160] (-890.975) (-890.058) -- 0:00:19 863000 -- (-894.603) [-895.971] (-888.134) (-892.673) * (-896.067) (-899.899) (-892.456) [-891.327] -- 0:00:19 863500 -- (-889.583) [-896.528] (-890.331) (-894.960) * [-891.530] (-902.097) (-893.770) (-890.772) -- 0:00:19 864000 -- (-890.089) (-898.981) (-895.041) [-889.253] * [-892.447] (-892.195) (-896.017) (-894.748) -- 0:00:19 864500 -- [-890.861] (-892.446) (-892.086) (-895.062) * (-897.983) (-889.452) (-901.003) [-891.699] -- 0:00:19 865000 -- (-892.670) (-906.090) (-893.007) [-893.044] * (-893.699) (-888.911) (-901.968) [-893.367] -- 0:00:19 Average standard deviation of split frequencies: 0.003266 865500 -- (-889.496) (-895.907) [-891.633] (-892.784) * (-889.463) [-889.700] (-890.569) (-897.775) -- 0:00:19 866000 -- (-889.049) [-893.831] (-898.506) (-893.508) * (-891.641) (-891.133) [-888.515] (-900.203) -- 0:00:19 866500 -- [-898.377] (-892.077) (-896.671) (-891.684) * [-892.646] (-892.694) (-889.080) (-894.434) -- 0:00:19 867000 -- (-891.003) [-888.722] (-895.346) (-892.492) * (-897.123) (-893.944) (-893.627) [-889.857] -- 0:00:19 867500 -- [-892.245] (-889.697) (-893.560) (-896.864) * (-892.821) (-898.284) (-888.557) [-891.655] -- 0:00:18 868000 -- (-894.596) [-892.712] (-888.721) (-893.762) * (-892.042) (-891.500) (-891.984) [-891.633] -- 0:00:18 868500 -- (-892.361) [-892.805] (-895.561) (-893.678) * (-892.581) (-893.602) [-891.168] (-891.834) -- 0:00:18 869000 -- (-893.189) (-890.339) (-900.591) [-895.592] * [-888.642] (-894.350) (-892.134) (-898.439) -- 0:00:18 869500 -- (-889.926) [-891.523] (-895.332) (-888.806) * (-888.111) (-893.138) [-889.236] (-889.874) -- 0:00:18 870000 -- [-896.011] (-894.982) (-892.930) (-898.886) * (-894.334) (-892.077) (-893.199) [-889.916] -- 0:00:18 Average standard deviation of split frequencies: 0.003249 870500 -- (-893.908) [-888.510] (-894.401) (-891.900) * (-892.835) (-892.943) [-890.202] (-891.934) -- 0:00:18 871000 -- (-894.322) [-886.332] (-893.803) (-890.701) * (-895.670) (-896.543) [-892.268] (-892.835) -- 0:00:18 871500 -- (-892.771) (-894.724) (-897.038) [-895.759] * (-890.409) [-893.451] (-891.397) (-896.172) -- 0:00:18 872000 -- [-890.375] (-890.733) (-893.289) (-891.364) * (-891.960) [-891.530] (-897.752) (-892.844) -- 0:00:18 872500 -- [-888.390] (-900.563) (-894.019) (-889.784) * (-891.344) (-892.522) (-891.076) [-889.628] -- 0:00:18 873000 -- (-893.130) [-899.781] (-894.055) (-888.904) * (-890.907) (-891.380) [-895.855] (-893.943) -- 0:00:18 873500 -- [-891.966] (-894.008) (-893.027) (-889.197) * (-890.467) [-890.262] (-890.196) (-888.758) -- 0:00:18 874000 -- (-896.019) (-890.688) [-888.081] (-890.817) * (-888.673) (-888.913) [-894.155] (-892.483) -- 0:00:18 874500 -- (-894.385) (-895.900) (-892.062) [-888.340] * (-891.069) (-888.854) [-893.266] (-894.071) -- 0:00:17 875000 -- (-891.452) (-891.329) [-891.328] (-893.754) * (-890.309) (-887.743) (-892.307) [-893.170] -- 0:00:17 Average standard deviation of split frequencies: 0.003229 875500 -- [-890.631] (-894.060) (-891.231) (-892.630) * (-891.800) (-890.997) [-887.411] (-895.231) -- 0:00:17 876000 -- [-889.723] (-889.587) (-893.446) (-892.318) * (-892.055) (-893.977) [-891.793] (-896.545) -- 0:00:17 876500 -- (-895.775) (-890.071) (-890.643) [-889.070] * (-895.623) (-894.491) [-887.860] (-900.297) -- 0:00:17 877000 -- (-892.860) [-892.391] (-887.250) (-891.604) * (-892.248) (-893.252) [-901.976] (-893.235) -- 0:00:17 877500 -- (-892.770) [-892.189] (-896.465) (-889.177) * (-895.251) (-890.527) (-890.398) [-888.940] -- 0:00:17 878000 -- [-893.739] (-892.610) (-890.286) (-891.912) * (-890.236) (-894.601) (-891.209) [-890.222] -- 0:00:17 878500 -- (-895.351) (-898.269) [-890.925] (-894.736) * [-890.523] (-891.596) (-888.107) (-895.177) -- 0:00:17 879000 -- [-892.482] (-892.798) (-895.862) (-894.160) * (-894.898) (-889.306) [-886.929] (-888.451) -- 0:00:17 879500 -- [-889.958] (-896.396) (-890.416) (-889.151) * [-886.553] (-892.539) (-890.795) (-888.612) -- 0:00:17 880000 -- (-895.149) (-894.432) (-896.721) [-889.086] * (-892.601) (-891.404) [-889.120] (-890.168) -- 0:00:17 Average standard deviation of split frequencies: 0.003212 880500 -- (-892.192) [-896.191] (-889.997) (-889.738) * [-892.030] (-891.883) (-893.311) (-894.424) -- 0:00:17 881000 -- (-889.886) [-894.992] (-892.768) (-891.094) * (-891.177) [-888.995] (-892.132) (-901.152) -- 0:00:17 881500 -- (-893.445) [-894.311] (-892.418) (-893.720) * (-891.644) (-891.198) (-897.783) [-890.757] -- 0:00:16 882000 -- (-890.304) (-893.565) (-891.746) [-889.277] * (-890.037) (-889.607) (-892.987) [-891.236] -- 0:00:16 882500 -- (-894.225) (-892.697) (-891.779) [-896.991] * [-890.819] (-889.585) (-902.940) (-899.721) -- 0:00:16 883000 -- (-895.463) (-891.814) (-894.014) [-888.410] * (-889.168) (-893.565) (-892.169) [-895.285] -- 0:00:16 883500 -- (-892.156) [-886.918] (-895.471) (-889.001) * [-889.234] (-893.751) (-894.355) (-894.007) -- 0:00:16 884000 -- [-892.867] (-889.443) (-895.390) (-892.039) * [-890.416] (-896.640) (-891.407) (-895.767) -- 0:00:16 884500 -- (-892.357) (-895.414) (-894.751) [-892.202] * [-889.437] (-893.013) (-890.253) (-893.427) -- 0:00:16 885000 -- (-890.997) [-892.015] (-890.687) (-893.042) * (-887.072) (-889.284) (-893.190) [-894.522] -- 0:00:16 Average standard deviation of split frequencies: 0.002660 885500 -- (-893.432) [-896.958] (-893.461) (-888.974) * (-896.020) (-895.942) [-891.392] (-887.982) -- 0:00:16 886000 -- (-892.927) (-895.295) (-893.929) [-888.660] * [-889.090] (-892.245) (-892.211) (-890.832) -- 0:00:16 886500 -- (-889.059) (-892.509) [-895.022] (-902.040) * (-889.525) [-890.163] (-896.865) (-890.368) -- 0:00:16 887000 -- (-891.652) (-893.927) (-897.700) [-893.340] * (-898.635) [-894.226] (-892.682) (-890.382) -- 0:00:16 887500 -- [-890.111] (-889.826) (-896.349) (-895.801) * (-889.696) (-891.056) (-891.188) [-889.573] -- 0:00:16 888000 -- (-891.069) [-894.849] (-887.845) (-894.817) * [-889.368] (-887.947) (-891.200) (-892.935) -- 0:00:16 888500 -- [-894.158] (-890.782) (-894.199) (-896.454) * (-893.688) (-895.093) (-891.754) [-888.638] -- 0:00:15 889000 -- (-894.873) (-889.158) (-892.139) [-894.307] * (-891.027) (-894.527) [-893.679] (-893.235) -- 0:00:15 889500 -- (-892.549) [-892.967] (-892.099) (-893.977) * (-891.292) (-893.532) [-893.725] (-889.471) -- 0:00:15 890000 -- (-902.102) (-892.936) [-891.535] (-897.749) * (-895.069) [-893.544] (-895.130) (-889.029) -- 0:00:15 Average standard deviation of split frequencies: 0.002646 890500 -- [-891.055] (-897.671) (-891.284) (-888.244) * (-894.358) [-890.688] (-893.523) (-895.962) -- 0:00:15 891000 -- [-895.645] (-893.877) (-891.733) (-895.067) * (-895.555) (-890.571) (-887.528) [-892.299] -- 0:00:15 891500 -- (-894.575) (-893.196) (-893.995) [-893.560] * [-889.546] (-888.582) (-888.137) (-897.470) -- 0:00:15 892000 -- (-890.260) [-896.239] (-891.290) (-893.305) * [-893.975] (-890.581) (-894.463) (-898.802) -- 0:00:15 892500 -- [-891.877] (-891.812) (-898.064) (-891.895) * (-890.737) (-890.075) (-892.245) [-890.594] -- 0:00:15 893000 -- (-888.621) (-889.848) [-893.331] (-889.145) * (-890.179) (-895.269) (-891.856) [-889.635] -- 0:00:15 893500 -- (-894.886) (-894.728) [-892.493] (-894.036) * [-895.957] (-898.187) (-897.024) (-900.316) -- 0:00:15 894000 -- (-889.267) (-894.218) (-890.859) [-890.378] * (-888.099) [-889.103] (-901.286) (-892.941) -- 0:00:15 894500 -- (-892.153) [-896.359] (-890.635) (-892.373) * [-890.359] (-889.769) (-891.166) (-893.801) -- 0:00:15 895000 -- (-895.057) (-896.488) [-891.684] (-893.839) * (-896.997) [-888.382] (-894.624) (-893.482) -- 0:00:15 Average standard deviation of split frequencies: 0.002631 895500 -- (-894.532) [-891.664] (-892.221) (-889.578) * (-897.782) [-892.184] (-891.052) (-887.403) -- 0:00:14 896000 -- [-891.499] (-891.628) (-893.534) (-893.327) * (-888.893) (-890.463) (-890.240) [-890.266] -- 0:00:14 896500 -- (-892.964) [-892.763] (-898.268) (-891.983) * (-892.823) (-896.075) (-890.643) [-890.826] -- 0:00:14 897000 -- [-892.398] (-896.015) (-894.054) (-889.337) * (-894.356) (-893.533) (-895.448) [-893.049] -- 0:00:14 897500 -- [-888.386] (-891.181) (-897.735) (-887.756) * [-894.223] (-894.128) (-888.784) (-893.904) -- 0:00:14 898000 -- (-889.276) [-892.124] (-894.737) (-900.916) * (-890.649) [-890.399] (-891.998) (-900.759) -- 0:00:14 898500 -- [-890.249] (-894.873) (-887.739) (-894.909) * [-890.192] (-894.724) (-892.486) (-895.089) -- 0:00:14 899000 -- (-888.571) [-889.147] (-892.225) (-892.568) * (-894.203) (-891.329) [-898.562] (-891.926) -- 0:00:14 899500 -- (-889.722) (-891.459) (-890.649) [-891.186] * (-892.997) (-891.968) (-894.997) [-892.562] -- 0:00:14 900000 -- (-898.682) (-888.080) [-891.543] (-894.314) * (-895.540) [-893.437] (-892.636) (-897.731) -- 0:00:14 Average standard deviation of split frequencies: 0.002094 900500 -- (-891.664) (-891.416) (-887.795) [-898.117] * [-890.152] (-896.914) (-894.552) (-904.697) -- 0:00:14 901000 -- [-888.996] (-893.926) (-892.300) (-893.143) * (-889.824) (-890.622) [-901.004] (-891.047) -- 0:00:14 901500 -- [-889.504] (-893.478) (-899.004) (-894.499) * (-891.598) (-892.632) (-894.458) [-892.127] -- 0:00:14 902000 -- (-891.887) (-894.623) (-894.531) [-891.148] * (-888.851) [-895.095] (-894.761) (-891.577) -- 0:00:14 902500 -- (-892.309) [-892.945] (-898.137) (-891.599) * [-893.922] (-891.758) (-895.393) (-889.022) -- 0:00:13 903000 -- (-891.455) (-889.958) (-893.137) [-888.907] * (-895.970) [-894.342] (-891.142) (-895.189) -- 0:00:13 903500 -- (-894.351) (-894.048) [-890.572] (-893.226) * (-896.646) [-891.099] (-898.398) (-891.519) -- 0:00:13 904000 -- (-896.640) (-891.564) [-888.861] (-890.219) * [-892.574] (-890.909) (-891.599) (-891.233) -- 0:00:13 904500 -- (-895.801) (-895.077) (-891.121) [-889.732] * (-891.978) (-893.637) (-890.294) [-888.245] -- 0:00:13 905000 -- [-891.873] (-896.844) (-888.961) (-894.286) * (-891.662) (-898.087) (-891.945) [-891.830] -- 0:00:13 Average standard deviation of split frequencies: 0.002081 905500 -- (-894.034) (-891.219) (-889.101) [-892.408] * [-892.699] (-896.527) (-890.411) (-894.254) -- 0:00:13 906000 -- (-894.107) [-886.916] (-889.088) (-900.494) * (-893.434) (-892.210) (-891.384) [-890.855] -- 0:00:13 906500 -- (-890.834) (-890.878) [-888.949] (-891.890) * (-890.023) (-891.661) [-890.831] (-892.114) -- 0:00:13 907000 -- [-897.581] (-891.485) (-890.777) (-896.808) * (-890.990) (-888.224) [-891.235] (-893.341) -- 0:00:13 907500 -- (-895.479) (-891.197) [-892.010] (-893.591) * [-890.164] (-894.827) (-900.234) (-894.174) -- 0:00:13 908000 -- (-890.117) (-890.392) (-895.163) [-891.860] * (-891.436) (-890.809) (-894.044) [-893.360] -- 0:00:13 908500 -- (-888.332) (-899.546) [-890.858] (-894.893) * [-893.899] (-894.492) (-890.344) (-895.866) -- 0:00:13 909000 -- [-887.917] (-894.702) (-890.585) (-891.419) * (-893.554) (-888.280) [-891.688] (-896.019) -- 0:00:13 909500 -- (-890.932) (-890.474) [-894.202] (-891.812) * (-890.675) (-890.352) [-890.660] (-890.790) -- 0:00:12 910000 -- (-896.867) (-894.428) (-894.485) [-892.547] * (-891.870) [-891.176] (-898.250) (-891.741) -- 0:00:12 Average standard deviation of split frequencies: 0.003106 910500 -- (-897.761) (-889.073) [-892.277] (-897.215) * [-891.212] (-897.403) (-898.833) (-890.285) -- 0:00:12 911000 -- (-893.566) [-888.074] (-894.615) (-896.188) * (-889.096) (-894.250) (-892.769) [-891.928] -- 0:00:12 911500 -- [-891.506] (-892.267) (-894.139) (-894.702) * (-888.718) [-892.053] (-890.084) (-892.567) -- 0:00:12 912000 -- [-886.370] (-893.086) (-898.012) (-895.347) * (-890.329) (-892.136) [-888.461] (-891.013) -- 0:00:12 912500 -- (-890.571) (-891.191) (-896.905) [-890.445] * [-894.544] (-888.677) (-893.366) (-895.165) -- 0:00:12 913000 -- (-891.629) [-889.798] (-887.759) (-896.540) * (-894.308) [-888.950] (-893.775) (-889.548) -- 0:00:12 913500 -- (-892.139) (-896.133) [-890.782] (-895.631) * (-895.147) (-891.738) (-890.894) [-892.826] -- 0:00:12 914000 -- (-898.576) [-888.890] (-897.242) (-894.632) * (-896.447) (-890.469) (-894.932) [-889.871] -- 0:00:12 914500 -- (-896.329) [-892.671] (-897.900) (-892.492) * [-893.761] (-892.581) (-889.672) (-890.200) -- 0:00:12 915000 -- (-896.326) [-891.345] (-898.589) (-893.682) * [-896.044] (-890.692) (-893.129) (-895.393) -- 0:00:12 Average standard deviation of split frequencies: 0.004117 915500 -- [-897.366] (-889.080) (-899.169) (-892.607) * (-890.392) [-891.916] (-894.049) (-889.947) -- 0:00:12 916000 -- (-897.796) [-891.512] (-900.040) (-895.441) * (-891.076) [-889.065] (-897.913) (-892.187) -- 0:00:12 916500 -- [-890.843] (-896.185) (-893.947) (-891.207) * (-893.836) [-890.482] (-891.655) (-890.726) -- 0:00:11 917000 -- (-893.340) (-894.083) (-894.345) [-891.095] * [-890.580] (-890.705) (-889.137) (-890.940) -- 0:00:11 917500 -- (-890.989) (-888.803) [-896.466] (-891.574) * (-895.146) [-888.722] (-890.973) (-892.314) -- 0:00:11 918000 -- (-894.943) [-892.847] (-895.234) (-895.993) * (-896.737) (-896.529) (-892.088) [-888.473] -- 0:00:11 918500 -- (-890.191) (-890.536) [-891.765] (-898.537) * (-888.895) [-893.114] (-890.206) (-889.068) -- 0:00:11 919000 -- (-899.572) (-888.437) [-891.145] (-895.426) * [-889.446] (-894.842) (-895.944) (-891.376) -- 0:00:11 919500 -- (-898.637) (-890.009) [-897.001] (-893.256) * [-892.839] (-900.330) (-899.413) (-892.179) -- 0:00:11 920000 -- (-891.966) (-897.984) [-887.567] (-893.823) * (-893.611) (-893.269) (-895.335) [-895.786] -- 0:00:11 Average standard deviation of split frequencies: 0.004608 920500 -- [-889.060] (-891.616) (-892.598) (-897.907) * (-893.347) (-890.952) (-894.308) [-891.319] -- 0:00:11 921000 -- (-891.217) (-889.743) [-888.456] (-893.816) * (-892.636) (-896.076) [-893.345] (-893.344) -- 0:00:11 921500 -- (-894.145) (-889.491) (-893.137) [-890.862] * (-890.287) (-893.130) [-894.529] (-897.487) -- 0:00:11 922000 -- (-894.362) [-892.393] (-891.812) (-886.474) * (-890.943) (-892.006) [-892.238] (-898.187) -- 0:00:11 922500 -- (-891.473) (-895.094) [-892.515] (-893.613) * [-893.199] (-893.689) (-897.059) (-893.523) -- 0:00:11 923000 -- (-891.788) (-892.143) [-888.561] (-892.402) * (-895.826) (-894.438) [-890.427] (-894.861) -- 0:00:11 923500 -- (-889.121) (-892.869) [-890.936] (-892.298) * (-892.256) (-893.501) (-891.134) [-894.258] -- 0:00:10 924000 -- (-890.261) [-889.871] (-891.191) (-891.825) * [-892.085] (-890.403) (-888.929) (-895.725) -- 0:00:10 924500 -- (-894.518) [-892.004] (-892.989) (-891.417) * (-894.746) [-892.467] (-894.125) (-891.761) -- 0:00:10 925000 -- [-889.837] (-890.571) (-897.041) (-891.035) * (-889.250) (-890.795) [-891.828] (-888.720) -- 0:00:10 Average standard deviation of split frequencies: 0.004073 925500 -- (-888.512) [-889.794] (-892.120) (-894.338) * (-892.681) (-890.073) (-889.565) [-892.422] -- 0:00:10 926000 -- (-890.026) [-889.920] (-895.722) (-890.538) * (-897.234) [-892.900] (-895.784) (-895.937) -- 0:00:10 926500 -- (-892.554) [-892.127] (-889.857) (-890.021) * [-895.135] (-903.447) (-895.689) (-890.357) -- 0:00:10 927000 -- (-895.144) (-892.730) (-897.392) [-889.811] * (-890.243) (-893.542) (-895.661) [-896.002] -- 0:00:10 927500 -- [-889.132] (-892.376) (-889.144) (-891.030) * [-888.428] (-889.420) (-891.202) (-891.977) -- 0:00:10 928000 -- (-891.526) (-889.679) (-891.429) [-888.614] * (-892.387) [-888.383] (-893.052) (-898.250) -- 0:00:10 928500 -- (-889.673) (-889.586) [-890.284] (-892.726) * [-888.076] (-892.849) (-894.364) (-897.893) -- 0:00:10 929000 -- (-893.560) (-895.367) (-893.619) [-891.403] * [-892.474] (-898.037) (-892.418) (-897.657) -- 0:00:10 929500 -- (-891.166) (-891.847) (-895.689) [-887.428] * [-888.356] (-899.032) (-889.667) (-895.436) -- 0:00:10 930000 -- (-889.719) (-894.923) [-890.816] (-890.423) * (-895.029) [-893.023] (-889.457) (-893.238) -- 0:00:10 Average standard deviation of split frequencies: 0.004052 930500 -- (-892.538) (-898.093) (-890.850) [-889.137] * (-895.357) (-899.351) [-892.816] (-895.098) -- 0:00:09 931000 -- (-893.420) (-897.626) (-893.988) [-889.692] * [-892.529] (-895.966) (-895.892) (-895.908) -- 0:00:09 931500 -- (-895.371) (-894.766) (-892.533) [-890.733] * (-893.602) [-893.392] (-888.988) (-889.856) -- 0:00:09 932000 -- (-892.186) [-891.991] (-889.350) (-892.520) * [-892.255] (-897.420) (-893.453) (-890.558) -- 0:00:09 932500 -- (-897.745) (-887.577) (-893.969) [-897.669] * (-892.961) [-890.014] (-891.927) (-891.407) -- 0:00:09 933000 -- (-892.842) [-890.141] (-889.845) (-894.850) * (-890.934) [-892.857] (-890.842) (-890.540) -- 0:00:09 933500 -- [-890.649] (-890.736) (-892.017) (-892.355) * (-901.390) [-891.903] (-891.985) (-888.338) -- 0:00:09 934000 -- [-890.617] (-893.214) (-890.201) (-893.177) * (-898.485) (-891.329) [-888.715] (-887.885) -- 0:00:09 934500 -- [-894.243] (-894.022) (-892.884) (-893.642) * (-890.664) [-889.170] (-893.445) (-894.284) -- 0:00:09 935000 -- [-890.156] (-896.989) (-890.118) (-892.660) * (-892.431) [-894.654] (-893.111) (-896.175) -- 0:00:09 Average standard deviation of split frequencies: 0.004029 935500 -- [-888.612] (-895.283) (-892.150) (-890.789) * (-894.984) [-892.180] (-897.458) (-893.356) -- 0:00:09 936000 -- [-891.439] (-892.339) (-899.524) (-890.829) * (-895.104) [-890.827] (-896.303) (-896.974) -- 0:00:09 936500 -- [-889.606] (-891.270) (-890.844) (-892.958) * (-896.692) [-895.143] (-892.725) (-897.329) -- 0:00:09 937000 -- (-890.305) (-889.099) (-897.701) [-890.032] * (-896.959) [-890.511] (-890.269) (-892.799) -- 0:00:09 937500 -- (-889.424) (-893.918) [-892.929] (-890.188) * (-895.191) [-891.973] (-897.376) (-893.355) -- 0:00:08 938000 -- (-895.493) (-890.514) [-889.117] (-889.873) * (-890.185) [-895.249] (-895.918) (-892.078) -- 0:00:08 938500 -- (-891.312) (-893.870) [-893.471] (-892.508) * (-894.530) (-890.058) (-892.356) [-890.689] -- 0:00:08 939000 -- (-893.025) (-889.872) (-891.377) [-891.973] * (-894.262) [-893.410] (-891.713) (-887.789) -- 0:00:08 939500 -- (-892.185) [-890.790] (-892.149) (-890.874) * [-891.958] (-889.659) (-898.455) (-893.541) -- 0:00:08 940000 -- (-897.772) [-894.464] (-890.399) (-892.868) * (-895.823) [-891.229] (-893.955) (-892.910) -- 0:00:08 Average standard deviation of split frequencies: 0.004009 940500 -- (-888.893) (-895.073) (-902.837) [-894.114] * (-900.700) (-887.680) [-895.441] (-894.836) -- 0:00:08 941000 -- [-887.493] (-892.955) (-893.011) (-894.693) * [-890.139] (-896.508) (-889.436) (-891.439) -- 0:00:08 941500 -- (-888.704) (-888.356) (-892.000) [-891.913] * (-888.690) (-896.567) (-893.235) [-890.630] -- 0:00:08 942000 -- (-895.719) (-889.354) (-890.796) [-888.706] * (-892.454) (-891.897) [-894.759] (-893.055) -- 0:00:08 942500 -- (-900.007) [-892.180] (-887.336) (-893.337) * (-893.574) (-889.953) (-891.422) [-890.761] -- 0:00:08 943000 -- [-894.855] (-889.308) (-891.586) (-897.060) * (-893.446) (-888.602) [-892.936] (-889.957) -- 0:00:08 943500 -- (-893.114) (-889.807) (-893.922) [-888.910] * [-890.212] (-894.964) (-900.596) (-893.355) -- 0:00:08 944000 -- (-891.023) (-887.857) [-894.651] (-890.215) * (-890.241) (-893.917) (-894.372) [-891.993] -- 0:00:08 944500 -- (-893.964) (-890.912) [-891.157] (-892.599) * [-889.075] (-898.172) (-891.489) (-897.827) -- 0:00:07 945000 -- (-894.903) [-889.117] (-895.076) (-890.770) * (-894.173) (-889.844) [-894.525] (-893.446) -- 0:00:07 Average standard deviation of split frequencies: 0.003987 945500 -- (-888.991) [-890.004] (-890.001) (-894.148) * (-898.664) (-890.737) (-894.121) [-895.633] -- 0:00:07 946000 -- [-891.500] (-889.841) (-889.799) (-892.253) * (-901.148) (-890.161) [-890.571] (-891.055) -- 0:00:07 946500 -- (-898.963) (-893.350) [-897.223] (-896.410) * (-894.660) (-894.897) (-889.595) [-892.829] -- 0:00:07 947000 -- (-893.064) (-889.206) (-892.318) [-892.418] * (-890.114) [-889.685] (-892.603) (-894.881) -- 0:00:07 947500 -- (-892.995) [-889.145] (-888.071) (-897.774) * (-895.666) (-890.095) [-893.561] (-892.224) -- 0:00:07 948000 -- [-892.104] (-897.881) (-896.628) (-894.959) * (-890.287) [-893.811] (-894.391) (-891.691) -- 0:00:07 948500 -- (-893.594) (-894.776) [-897.849] (-892.403) * (-888.243) (-890.533) (-891.848) [-891.200] -- 0:00:07 949000 -- [-888.501] (-892.575) (-893.172) (-891.950) * (-891.162) (-894.861) (-889.012) [-887.969] -- 0:00:07 949500 -- (-892.595) [-896.303] (-897.175) (-889.958) * (-898.316) [-893.740] (-892.352) (-889.730) -- 0:00:07 950000 -- (-895.990) [-892.055] (-890.400) (-891.340) * (-892.466) (-901.209) [-888.441] (-890.953) -- 0:00:07 Average standard deviation of split frequencies: 0.003967 950500 -- (-895.729) (-890.166) (-899.545) [-891.149] * (-893.085) [-887.979] (-894.604) (-891.841) -- 0:00:07 951000 -- [-890.145] (-889.401) (-895.335) (-890.294) * [-892.049] (-887.824) (-889.332) (-890.827) -- 0:00:07 951500 -- (-896.869) (-891.704) [-891.049] (-894.620) * (-889.469) (-891.399) [-897.412] (-891.490) -- 0:00:06 952000 -- (-897.399) (-897.131) (-892.422) [-889.811] * (-890.510) [-893.749] (-896.586) (-891.734) -- 0:00:06 952500 -- (-898.244) (-890.982) [-890.203] (-889.670) * [-893.047] (-891.153) (-888.581) (-897.915) -- 0:00:06 953000 -- (-889.296) [-893.987] (-891.565) (-895.061) * (-894.284) (-892.991) [-889.733] (-893.112) -- 0:00:06 953500 -- (-891.388) (-893.171) (-898.599) [-890.189] * [-894.621] (-888.682) (-893.884) (-889.262) -- 0:00:06 954000 -- [-889.353] (-891.786) (-894.248) (-900.894) * (-890.892) [-890.590] (-895.533) (-890.101) -- 0:00:06 954500 -- (-892.995) (-892.991) (-889.964) [-895.533] * (-894.559) (-887.516) [-889.292] (-892.558) -- 0:00:06 955000 -- (-890.489) (-890.188) (-890.428) [-894.038] * (-893.491) [-889.287] (-890.304) (-891.680) -- 0:00:06 Average standard deviation of split frequencies: 0.004931 955500 -- (-894.179) [-888.681] (-899.220) (-893.659) * [-892.640] (-893.610) (-890.587) (-897.967) -- 0:00:06 956000 -- (-888.508) (-889.165) (-894.433) [-892.264] * (-892.923) (-888.697) [-889.363] (-892.036) -- 0:00:06 956500 -- (-890.171) [-893.261] (-893.976) (-889.271) * [-889.783] (-891.987) (-898.105) (-893.857) -- 0:00:06 957000 -- [-894.083] (-892.568) (-891.832) (-892.001) * (-890.210) (-895.902) (-893.952) [-893.402] -- 0:00:06 957500 -- (-888.421) (-891.782) [-893.605] (-890.196) * (-896.209) (-891.506) [-888.102] (-895.138) -- 0:00:06 958000 -- (-894.861) [-891.120] (-893.715) (-898.753) * [-890.456] (-893.124) (-889.950) (-892.413) -- 0:00:06 958500 -- [-890.556] (-894.770) (-887.367) (-894.935) * [-895.442] (-895.769) (-900.684) (-891.565) -- 0:00:05 959000 -- [-892.614] (-891.719) (-891.221) (-895.849) * [-895.094] (-889.730) (-889.151) (-894.319) -- 0:00:05 959500 -- (-894.326) (-888.817) [-890.637] (-897.039) * [-889.626] (-896.906) (-895.185) (-892.795) -- 0:00:05 960000 -- (-896.293) (-890.420) (-895.755) [-891.115] * (-896.144) (-895.030) [-890.568] (-889.610) -- 0:00:05 Average standard deviation of split frequencies: 0.004416 960500 -- (-891.728) (-893.033) [-893.087] (-891.989) * (-895.449) (-895.182) (-887.334) [-895.493] -- 0:00:05 961000 -- [-902.521] (-890.498) (-899.391) (-893.584) * [-896.615] (-899.872) (-889.261) (-894.279) -- 0:00:05 961500 -- (-889.940) (-888.771) (-899.561) [-891.195] * (-893.662) (-893.770) [-889.748] (-891.593) -- 0:00:05 962000 -- (-892.965) [-892.414] (-895.556) (-893.130) * (-891.108) (-890.621) (-897.413) [-888.107] -- 0:00:05 962500 -- (-892.976) [-889.246] (-894.984) (-897.862) * (-894.284) [-889.156] (-892.734) (-889.325) -- 0:00:05 963000 -- (-892.526) [-891.052] (-890.140) (-890.670) * (-895.507) (-888.810) [-891.675] (-893.259) -- 0:00:05 963500 -- [-888.979] (-894.018) (-889.408) (-898.305) * (-894.990) [-891.090] (-896.486) (-890.525) -- 0:00:05 964000 -- (-889.970) [-890.551] (-890.358) (-896.740) * [-891.077] (-888.244) (-899.043) (-893.964) -- 0:00:05 964500 -- (-889.671) (-890.953) [-890.880] (-890.242) * (-900.053) [-890.087] (-889.783) (-892.909) -- 0:00:05 965000 -- (-893.334) (-888.199) [-899.226] (-889.230) * (-898.429) [-890.708] (-892.950) (-892.749) -- 0:00:05 Average standard deviation of split frequencies: 0.003904 965500 -- (-892.781) [-891.705] (-890.529) (-896.977) * (-891.443) [-891.748] (-893.310) (-889.569) -- 0:00:04 966000 -- (-889.702) [-891.027] (-889.587) (-889.989) * (-894.025) [-892.868] (-897.315) (-893.633) -- 0:00:04 966500 -- (-895.341) [-892.245] (-895.176) (-889.009) * [-893.766] (-892.055) (-893.015) (-892.903) -- 0:00:04 967000 -- (-888.413) (-892.408) [-887.743] (-889.199) * (-894.363) [-890.437] (-891.754) (-897.028) -- 0:00:04 967500 -- (-892.494) (-897.621) [-891.799] (-893.118) * (-888.947) [-895.200] (-890.466) (-894.424) -- 0:00:04 968000 -- (-891.647) [-887.410] (-893.239) (-896.635) * [-892.492] (-900.733) (-891.890) (-896.168) -- 0:00:04 968500 -- [-893.730] (-890.102) (-888.673) (-895.469) * [-890.074] (-894.870) (-892.343) (-891.876) -- 0:00:04 969000 -- (-894.408) (-894.108) (-892.737) [-888.264] * (-894.252) [-890.364] (-893.184) (-889.211) -- 0:00:04 969500 -- (-896.140) (-897.819) (-893.343) [-891.798] * [-896.058] (-894.633) (-887.441) (-889.551) -- 0:00:04 970000 -- (-891.655) (-900.096) [-889.971] (-896.146) * (-899.899) [-889.812] (-896.543) (-893.840) -- 0:00:04 Average standard deviation of split frequencies: 0.002914 970500 -- (-888.711) (-897.789) (-891.384) [-888.284] * (-892.543) (-891.721) (-891.183) [-888.313] -- 0:00:04 971000 -- [-888.437] (-896.772) (-892.792) (-889.828) * (-896.637) (-890.870) [-893.002] (-891.412) -- 0:00:04 971500 -- (-890.300) (-891.931) [-891.046] (-886.469) * [-892.877] (-893.071) (-895.261) (-897.026) -- 0:00:04 972000 -- (-891.951) (-897.249) (-892.396) [-887.403] * (-891.429) [-891.850] (-894.069) (-890.782) -- 0:00:04 972500 -- (-893.687) (-898.810) (-891.172) [-893.619] * [-894.145] (-901.589) (-897.538) (-891.258) -- 0:00:03 973000 -- (-896.571) (-891.967) (-894.406) [-888.992] * (-892.021) [-892.685] (-893.724) (-890.973) -- 0:00:03 973500 -- (-893.578) [-889.889] (-900.079) (-892.147) * (-893.179) (-891.977) [-891.962] (-892.042) -- 0:00:03 974000 -- [-893.915] (-894.558) (-891.042) (-887.780) * (-900.624) (-890.732) (-899.477) [-890.751] -- 0:00:03 974500 -- (-900.584) (-889.929) (-891.059) [-888.296] * [-893.803] (-896.514) (-897.202) (-890.338) -- 0:00:03 975000 -- (-903.724) [-892.711] (-892.180) (-894.552) * (-893.676) (-898.952) [-897.103] (-896.586) -- 0:00:03 Average standard deviation of split frequencies: 0.002898 975500 -- (-899.446) (-893.383) [-891.924] (-891.898) * (-894.757) (-894.026) (-895.400) [-890.302] -- 0:00:03 976000 -- (-891.755) (-897.238) (-889.431) [-891.724] * (-893.129) (-901.859) (-897.754) [-890.227] -- 0:00:03 976500 -- [-889.859] (-894.771) (-892.334) (-892.259) * (-891.538) (-890.418) [-890.114] (-892.402) -- 0:00:03 977000 -- (-888.455) (-893.220) (-889.055) [-888.391] * (-892.175) (-891.507) (-893.316) [-893.076] -- 0:00:03 977500 -- [-889.306] (-899.711) (-893.142) (-892.789) * (-892.234) [-894.938] (-890.552) (-897.195) -- 0:00:03 978000 -- [-893.628] (-897.156) (-893.542) (-889.803) * (-893.999) [-904.463] (-898.938) (-890.834) -- 0:00:03 978500 -- [-894.840] (-892.888) (-890.171) (-890.267) * [-891.612] (-899.893) (-893.359) (-893.487) -- 0:00:03 979000 -- (-895.038) (-892.914) (-891.510) [-889.727] * [-891.137] (-899.430) (-890.964) (-893.364) -- 0:00:03 979500 -- (-895.088) [-889.271] (-892.538) (-893.840) * [-890.775] (-889.057) (-893.090) (-900.557) -- 0:00:02 980000 -- [-890.783] (-888.364) (-892.647) (-890.720) * [-892.484] (-897.268) (-890.830) (-894.158) -- 0:00:02 Average standard deviation of split frequencies: 0.002884 980500 -- [-891.353] (-889.444) (-890.080) (-890.371) * (-892.747) [-888.440] (-892.851) (-893.366) -- 0:00:02 981000 -- (-896.280) [-890.694] (-891.732) (-891.226) * (-892.315) [-889.365] (-891.574) (-889.591) -- 0:00:02 981500 -- (-894.021) (-894.846) [-890.284] (-887.805) * (-890.967) (-892.715) [-891.928] (-892.161) -- 0:00:02 982000 -- [-893.269] (-893.967) (-895.985) (-889.674) * (-892.115) [-890.065] (-890.685) (-897.359) -- 0:00:02 982500 -- (-895.762) (-894.332) (-892.644) [-892.109] * [-891.122] (-889.563) (-896.261) (-891.408) -- 0:00:02 983000 -- (-891.016) [-893.720] (-898.257) (-889.071) * (-890.634) (-891.191) (-891.601) [-891.366] -- 0:00:02 983500 -- (-894.331) (-888.256) (-893.438) [-898.605] * (-889.531) (-890.248) (-895.679) [-893.173] -- 0:00:02 984000 -- (-893.573) (-890.491) (-887.463) [-889.274] * [-894.939] (-888.584) (-898.308) (-895.727) -- 0:00:02 984500 -- [-888.938] (-893.429) (-892.935) (-894.514) * (-888.194) (-889.941) [-889.214] (-895.772) -- 0:00:02 985000 -- (-891.126) (-890.557) (-890.299) [-891.832] * (-899.232) (-891.666) [-889.283] (-892.324) -- 0:00:02 Average standard deviation of split frequencies: 0.002869 985500 -- [-893.279] (-889.510) (-894.052) (-888.438) * (-892.938) (-889.819) [-892.706] (-892.646) -- 0:00:02 986000 -- (-891.823) (-891.394) (-890.708) [-889.504] * (-890.812) (-895.670) (-891.531) [-888.675] -- 0:00:02 986500 -- (-888.318) (-896.465) [-889.365] (-891.206) * (-892.905) [-894.073] (-889.901) (-887.181) -- 0:00:01 987000 -- [-890.913] (-887.316) (-895.860) (-892.106) * (-892.507) [-892.032] (-891.751) (-893.615) -- 0:00:01 987500 -- (-892.091) (-892.111) (-894.775) [-892.824] * [-893.311] (-898.469) (-889.429) (-891.536) -- 0:00:01 988000 -- [-893.136] (-891.951) (-899.204) (-893.968) * (-888.944) (-900.156) [-890.931] (-891.652) -- 0:00:01 988500 -- (-896.363) (-887.859) [-891.784] (-903.366) * (-888.082) (-892.599) (-890.948) [-893.534] -- 0:00:01 989000 -- (-889.861) [-891.673] (-893.989) (-892.481) * (-888.813) [-892.025] (-886.665) (-896.720) -- 0:00:01 989500 -- (-888.806) [-890.410] (-895.294) (-888.850) * (-896.094) (-888.744) [-894.173] (-902.335) -- 0:00:01 990000 -- [-890.539] (-889.073) (-893.634) (-893.498) * (-894.869) [-890.212] (-893.220) (-892.801) -- 0:00:01 Average standard deviation of split frequencies: 0.003331 990500 -- (-891.856) (-893.181) [-890.394] (-888.809) * (-894.668) (-890.303) [-891.193] (-897.164) -- 0:00:01 991000 -- (-896.677) (-897.364) [-895.824] (-894.104) * (-890.694) (-895.660) [-890.106] (-890.999) -- 0:00:01 991500 -- [-891.380] (-896.831) (-892.965) (-894.305) * (-896.978) (-891.566) [-889.651] (-888.048) -- 0:00:01 992000 -- (-892.838) (-892.731) (-889.863) [-890.596] * (-890.395) [-891.678] (-891.536) (-893.506) -- 0:00:01 992500 -- [-891.532] (-890.961) (-893.189) (-895.599) * (-893.431) (-888.969) (-895.627) [-890.830] -- 0:00:01 993000 -- (-890.799) [-887.912] (-891.994) (-891.154) * (-889.866) (-895.474) (-890.761) [-890.117] -- 0:00:01 993500 -- (-892.095) (-898.830) (-893.113) [-893.869] * (-890.463) (-894.794) [-890.825] (-895.795) -- 0:00:00 994000 -- (-893.993) [-893.549] (-889.415) (-900.530) * (-895.768) (-888.037) (-893.338) [-897.594] -- 0:00:00 994500 -- (-889.646) (-890.407) (-891.295) [-900.023] * (-889.272) [-891.166] (-888.964) (-891.071) -- 0:00:00 995000 -- [-894.123] (-888.259) (-890.194) (-900.409) * [-891.736] (-891.584) (-894.640) (-894.526) -- 0:00:00 Average standard deviation of split frequencies: 0.003786 995500 -- (-892.545) (-892.430) (-892.798) [-894.132] * (-891.172) (-895.745) [-894.097] (-891.282) -- 0:00:00 996000 -- [-890.267] (-895.649) (-892.221) (-896.245) * [-892.121] (-893.620) (-889.099) (-894.867) -- 0:00:00 996500 -- (-894.034) (-893.164) [-890.577] (-894.208) * (-898.344) (-892.316) (-892.376) [-892.779] -- 0:00:00 997000 -- (-895.259) (-897.913) [-889.566] (-894.321) * [-894.571] (-888.899) (-895.389) (-889.419) -- 0:00:00 997500 -- (-893.818) [-886.846] (-891.746) (-892.612) * [-892.550] (-888.817) (-888.351) (-895.594) -- 0:00:00 998000 -- (-891.710) [-890.519] (-895.599) (-899.384) * (-891.661) [-888.294] (-891.999) (-894.103) -- 0:00:00 998500 -- (-890.319) [-888.375] (-894.178) (-895.719) * [-892.243] (-895.014) (-894.992) (-896.950) -- 0:00:00 999000 -- (-895.929) [-894.786] (-896.123) (-894.757) * [-894.061] (-893.290) (-894.517) (-893.298) -- 0:00:00 999500 -- (-896.694) [-895.691] (-895.753) (-891.803) * (-896.194) (-893.903) (-894.186) [-891.805] -- 0:00:00 1000000 -- (-890.852) (-891.066) (-892.648) [-898.292] * (-889.756) (-893.771) (-888.193) [-895.331] -- 0:00:00 Average standard deviation of split frequencies: 0.002827 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -890.851632 -- 10.840362 Chain 1 -- -890.851632 -- 10.840362 Chain 2 -- -891.066008 -- 12.892868 Chain 2 -- -891.066008 -- 12.892868 Chain 3 -- -892.648414 -- 11.106489 Chain 3 -- -892.648414 -- 11.106489 Chain 4 -- -898.291719 -- 12.488587 Chain 4 -- -898.291719 -- 12.488587 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -889.755832 -- 12.250880 Chain 1 -- -889.755832 -- 12.250880 Chain 2 -- -893.770506 -- 13.031470 Chain 2 -- -893.770506 -- 13.031470 Chain 3 -- -888.192769 -- 5.693924 Chain 3 -- -888.192769 -- 5.693924 Chain 4 -- -895.331365 -- 13.365909 Chain 4 -- -895.331365 -- 13.365909 Analysis completed in 2 mins 23 seconds Analysis used 143.12 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -885.43 Likelihood of best state for "cold" chain of run 2 was -885.43 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 67.7 % ( 62 %) Dirichlet(Revmat{all}) 78.4 % ( 59 %) Slider(Revmat{all}) 30.5 % ( 29 %) Dirichlet(Pi{all}) 31.0 % ( 26 %) Slider(Pi{all}) 51.0 % ( 29 %) Multiplier(Alpha{1,2}) 49.5 % ( 32 %) Multiplier(Alpha{3}) 67.1 % ( 44 %) Slider(Pinvar{all}) 7.1 % ( 6 %) NNI(Tau{all},V{all}) 5.7 % ( 4 %) ParsSPR(Tau{all},V{all}) 26.4 % ( 32 %) Multiplier(V{all}) 37.2 % ( 41 %) Nodeslider(V{all}) 26.1 % ( 26 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 68.7 % ( 61 %) Dirichlet(Revmat{all}) 78.9 % ( 67 %) Slider(Revmat{all}) 30.4 % ( 28 %) Dirichlet(Pi{all}) 30.4 % ( 22 %) Slider(Pi{all}) 51.1 % ( 24 %) Multiplier(Alpha{1,2}) 49.8 % ( 27 %) Multiplier(Alpha{3}) 66.4 % ( 52 %) Slider(Pinvar{all}) 6.9 % ( 7 %) NNI(Tau{all},V{all}) 5.5 % ( 3 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 24 %) Multiplier(V{all}) 37.1 % ( 28 %) Nodeslider(V{all}) 26.1 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.84 0.70 0.58 2 | 166436 0.86 0.72 3 | 166868 166737 0.87 4 | 166253 166929 166777 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.84 0.70 0.58 2 | 166519 0.85 0.73 3 | 167199 166365 0.87 4 | 166961 166471 166485 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -890.56 | 2 1 1 | | 1 1 2 1 2 | | 1 2 1 2 | | 1 1 1 1 | | 1 2 | | 1 2 2 1 1 2 2 1 1 | |1 2 1 2 2 2 2* 2 | | * 2 1 2 2 2 1212 2 112 1 2 2 2 | | 2 1 1 2 2 2121 2 | |2 2 2 1 2 2 2 2 1 2 1 | | 12 1 11 2 1 1 21 11121 1 12 1 2 21 22| | 1 2 1 1 1| | 1 2 22 1 2 1 1 | | 2 2 1 1 | | 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -892.82 ^