--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 22:11:50 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/825-Oak-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -889.70          -897.64
2       -889.77          -897.94
--------------------------------------
TOTAL     -889.74          -897.80
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.522852    0.020542    0.280878    0.803748    0.497287    787.91   1144.45    1.000
r(A<->C){all}   0.117885    0.005050    0.001770    0.257085    0.106542    560.09    568.91    1.001
r(A<->G){all}   0.212347    0.007059    0.059244    0.372296    0.205007    496.56    558.65    1.002
r(A<->T){all}   0.237229    0.007176    0.082699    0.399957    0.227723    783.27    809.42    1.002
r(C<->G){all}   0.128731    0.002684    0.044040    0.235406    0.121330    807.66    845.39    1.001
r(C<->T){all}   0.176114    0.003498    0.060535    0.285755    0.171138    747.84    807.13    1.000
r(G<->T){all}   0.127694    0.003661    0.019685    0.240768    0.119516    654.97    697.32    1.000
pi(A){all}      0.120025    0.000213    0.090364    0.147662    0.119679   1375.25   1395.52    1.000
pi(C){all}      0.365767    0.000461    0.325288    0.409917    0.365668   1293.21   1397.11    1.000
pi(G){all}      0.239168    0.000388    0.201284    0.278077    0.238387   1314.49   1321.00    1.000
pi(T){all}      0.275040    0.000406    0.236830    0.315056    0.274351   1274.11   1346.44    1.000
alpha{1,2}      0.203478    0.033950    0.000260    0.524118    0.160956   1094.65   1217.07    1.001
alpha{3}        0.906771    0.349609    0.137599    2.074984    0.748727   1246.15   1273.14    1.000
pinvar{all}     0.278017    0.027465    0.000033    0.566670    0.264733    756.55    978.69    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-776.102101
Model 2: PositiveSelection	-771.423592
Model 0: one-ratio	-786.152998
Model 3: discrete	-771.423592
Model 7: beta	-776.207867
Model 8: beta&w>1	-771.425925


Model 0 vs 1	20.101794000000154

Model 2 vs 1	9.357017999999925

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)

            Pr(w>1)     post mean +- SE for w

    10 A      0.506         3.073
    66 A      0.961*        5.722
    68 P      0.990*        5.891
    69 L      0.993**       5.907
    73 V      0.999**       5.943
    76 K      0.989*        5.883
    77 Y      0.978*        5.821
    78 A      0.985*        5.860
    80 T      0.670         4.029
    89 K      0.991**       5.895
    90 A      0.970*        5.773
    92 T      0.670         4.029
    97 R      0.501         3.046

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)

            Pr(w>1)     post mean +- SE for w

    66 A      0.791         5.415 +- 3.049
    68 P      0.873         5.892 +- 2.795
    69 L      0.915         6.176 +- 2.651
    73 V      0.941         6.345 +- 2.530
    76 K      0.882         5.967 +- 2.772
    77 Y      0.822         5.569 +- 2.947
    78 A      0.880         5.979 +- 2.796
    80 T      0.542         3.742 +- 3.303
    89 K      0.896         6.053 +- 2.722
    90 A      0.784         5.315 +- 3.023
    92 T      0.542         3.742 +- 3.303


Model 8 vs 7	9.563883999999916

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)

            Pr(w>1)     post mean +- SE for w

    10 A      0.505         3.074
    66 A      0.959*        5.713
    68 P      0.989*        5.889
    69 L      0.992**       5.906
    73 V      0.999**       5.944
    76 K      0.988*        5.881
    77 Y      0.977*        5.816
    78 A      0.984*        5.857
    80 T      0.669         4.029
    89 K      0.990**       5.894
    90 A      0.968*        5.765
    92 T      0.669         4.029
    97 R      0.501         3.048

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)

            Pr(w>1)     post mean +- SE for w

    66 A      0.864         5.566 +- 2.800
    68 P      0.933         5.974 +- 2.516
    69 L      0.956*        6.131 +- 2.415
    73 V      0.976*        6.257 +- 2.305
    76 K      0.936         6.002 +- 2.509
    77 Y      0.895         5.728 +- 2.675
    78 A      0.930         5.985 +- 2.544
    80 T      0.618         3.981 +- 3.254
    89 K      0.945         6.059 +- 2.467
    90 A      0.867         5.540 +- 2.764
    92 T      0.618         3.981 +- 3.254

>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTA
TSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAAT
PLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYTAPAPVVTATSSQVIA
RNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLAAPLAAPLAAPLAY
SSPLAYSAPLSYAAAPAPLLIoooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=149 

C1              MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
C2              MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
C3              MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
C4              MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
                *** ***.*.:*****************:*****             :**

C1              APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
C2              APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
C3              APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
C4              APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
                **************************** *  **. :*   *:**:**:.

C1              AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
C2              AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
C3              AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
C4              AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
                *   *:*:** *********************:**              




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  135 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  135 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2488]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [2488]--->[2229]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.208 Mb, Max= 30.411 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo

FORMAT of file /tmp/tmp1440418097538211609aln Not Supported[FATAL:T-COFFEE]
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:149 S:89 BS:149
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.35 C1	 C2	 95.35
TOP	    1    0	 95.35 C2	 C1	 95.35
BOT	    0    2	 95.35 C1	 C3	 95.35
TOP	    2    0	 95.35 C3	 C1	 95.35
BOT	    0    3	 81.89 C1	 C4	 81.89
TOP	    3    0	 81.89 C4	 C1	 81.89
BOT	    1    2	 97.04 C2	 C3	 97.04
TOP	    2    1	 97.04 C3	 C2	 97.04
BOT	    1    3	 81.82 C2	 C4	 81.82
TOP	    3    1	 81.82 C4	 C2	 81.82
BOT	    2    3	 82.64 C3	 C4	 82.64
TOP	    3    2	 82.64 C4	 C3	 82.64
AVG	 0	 C1	  *	 90.86
AVG	 1	 C2	  *	 91.40
AVG	 2	 C3	  *	 91.68
AVG	 3	 C4	  *	 82.12
TOT	 TOT	  *	 89.01
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC
C2              ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
C3              ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
C4              ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC
                **********.*** ** **  * ** *  .*******************

C1              CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
C2              CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
C3              CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
C4              CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT
                ********************* **  * ** ***:******* *******

C1              AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C2              ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C3              ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C4              AC---------------------------------------ACTGCTCCT
                **                                       .******* 

C1              GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA
C2              GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
C3              GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
C4              GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA
                *****************.************** *********** *****

C1              TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
C2              TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG
C3              TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
C4              TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG
                ***.************** ************** *  ** ..: : ** *

C1              CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG
C2              CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
C3              CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
C4              CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT
                ** *:    **** ..  .   ****.********.*******: *.*  

C1              GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC
C2              GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC
C3              GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC
C4              GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC
                ** ..      *** .***** *******:*   ****************

C1              TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC
C2              ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
C3              ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
C4              GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC
                 ***** *********************** *************** ***

C1              TCATC------------------------------------------
C2              TCATC------------------------------------------
C3              TCATC------------------------------------------
C4              TCATC------------------------------------------
                *****                                          



>C1
ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG
GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC
TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C2
ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG
CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC
ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C3
ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC
ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C4
ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT
AC---------------------------------------ACTGCTCCT
GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA
TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG
CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT
GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC
GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC
TCATC------------------------------------------
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYooooooSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYoooooooooooooTAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
APoLAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 447 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480111724
      Setting output file names to "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 959365650
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9304270436
      Seed = 1177419686
      Swapseed = 1480111724
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 25 unique site patterns
      Division 2 has 19 unique site patterns
      Division 3 has 33 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1043.858344 -- -26.620141
         Chain 2 -- -1043.106005 -- -26.620141
         Chain 3 -- -1043.858344 -- -26.620141
         Chain 4 -- -1043.106005 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1043.858344 -- -26.620141
         Chain 2 -- -1043.106005 -- -26.620141
         Chain 3 -- -1019.873051 -- -26.620141
         Chain 4 -- -1043.106005 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1043.858] (-1043.106) (-1043.858) (-1043.106) * [-1043.858] (-1043.106) (-1019.873) (-1043.106) 
        500 -- (-911.357) [-908.058] (-905.959) (-907.199) * (-910.720) [-910.150] (-897.476) (-902.731) -- 0:00:00
       1000 -- (-896.578) (-900.751) [-897.406] (-898.907) * (-901.378) (-908.613) (-892.982) [-892.962] -- 0:00:00
       1500 -- [-890.704] (-894.488) (-898.893) (-890.291) * (-902.080) (-898.299) (-890.089) [-890.443] -- 0:00:00
       2000 -- (-890.971) (-888.918) [-897.468] (-892.637) * (-896.904) [-889.807] (-889.236) (-892.706) -- 0:00:00
       2500 -- (-892.157) [-895.701] (-894.155) (-892.364) * (-900.795) (-892.550) (-891.458) [-889.345] -- 0:00:00
       3000 -- [-892.786] (-894.602) (-892.891) (-891.720) * (-901.307) (-894.178) (-892.664) [-893.636] -- 0:00:00
       3500 -- (-892.934) (-890.036) (-890.542) [-889.764] * [-892.139] (-892.830) (-895.223) (-894.182) -- 0:04:44
       4000 -- (-898.397) (-889.582) (-890.974) [-892.548] * (-891.026) (-890.961) [-892.130] (-891.889) -- 0:04:09
       4500 -- [-895.615] (-892.791) (-895.937) (-896.387) * [-896.389] (-897.418) (-891.345) (-891.894) -- 0:03:41
       5000 -- [-894.348] (-889.416) (-892.866) (-888.086) * (-892.021) (-891.916) (-891.237) [-895.462] -- 0:03:19

      Average standard deviation of split frequencies: 0.078567

       5500 -- [-891.318] (-895.283) (-890.305) (-890.195) * (-889.502) (-893.491) (-890.971) [-891.820] -- 0:03:00
       6000 -- [-889.577] (-892.156) (-889.913) (-892.791) * (-888.274) (-896.298) [-896.062] (-892.399) -- 0:02:45
       6500 -- (-887.814) (-891.665) [-894.818] (-897.383) * (-891.952) [-896.695] (-894.613) (-890.999) -- 0:02:32
       7000 -- (-890.824) (-892.247) (-898.357) [-899.606] * [-890.587] (-899.053) (-891.022) (-891.708) -- 0:02:21
       7500 -- (-894.104) (-891.395) [-889.663] (-904.184) * (-892.418) (-893.019) (-888.502) [-895.467] -- 0:02:12
       8000 -- (-895.381) (-897.562) [-892.908] (-894.485) * (-899.617) [-892.987] (-889.980) (-901.577) -- 0:02:04
       8500 -- [-897.337] (-892.526) (-894.785) (-898.871) * (-891.703) [-893.728] (-894.007) (-894.384) -- 0:01:56
       9000 -- (-891.434) (-893.522) [-891.482] (-891.126) * [-891.519] (-890.032) (-891.251) (-896.333) -- 0:01:50
       9500 -- (-891.051) (-893.722) [-893.971] (-893.527) * [-891.926] (-894.590) (-894.093) (-892.695) -- 0:01:44
      10000 -- [-892.692] (-890.891) (-894.602) (-893.562) * [-891.633] (-896.424) (-898.231) (-893.029) -- 0:01:39

      Average standard deviation of split frequencies: 0.044194

      10500 -- [-894.048] (-895.332) (-892.699) (-893.792) * (-893.717) (-893.584) [-890.432] (-891.463) -- 0:01:34
      11000 -- (-889.215) [-890.292] (-900.933) (-891.019) * (-888.386) (-889.702) (-897.953) [-888.114] -- 0:02:59
      11500 -- (-888.921) (-896.219) [-894.354] (-894.815) * (-892.675) [-891.788] (-894.736) (-890.141) -- 0:02:51
      12000 -- [-889.862] (-887.547) (-895.801) (-893.636) * [-892.173] (-892.107) (-891.978) (-897.445) -- 0:02:44
      12500 -- (-892.692) (-895.395) [-890.765] (-894.551) * (-890.289) [-890.039] (-892.499) (-891.628) -- 0:02:38
      13000 -- [-893.417] (-896.011) (-891.345) (-889.126) * (-889.192) (-890.758) [-891.690] (-893.349) -- 0:02:31
      13500 -- (-895.722) (-891.209) [-889.764] (-893.722) * (-887.430) (-892.053) [-888.004] (-891.277) -- 0:02:26
      14000 -- [-891.161] (-889.666) (-894.307) (-901.781) * (-897.946) [-902.908] (-888.032) (-888.878) -- 0:02:20
      14500 -- (-895.416) [-889.290] (-892.154) (-891.784) * (-892.799) (-890.684) [-888.877] (-897.015) -- 0:02:15
      15000 -- (-890.522) [-890.177] (-896.567) (-892.785) * (-890.159) (-894.592) [-892.394] (-896.592) -- 0:02:11

      Average standard deviation of split frequencies: 0.058926

      15500 -- [-892.297] (-892.048) (-895.976) (-897.439) * (-891.362) (-892.485) [-888.981] (-894.792) -- 0:02:07
      16000 -- (-887.316) (-899.658) [-894.445] (-898.821) * (-889.245) (-897.817) [-888.548] (-892.301) -- 0:02:03
      16500 -- [-888.980] (-896.040) (-894.961) (-892.465) * [-893.725] (-894.395) (-889.612) (-891.508) -- 0:01:59
      17000 -- [-890.981] (-893.134) (-891.751) (-891.346) * (-893.780) [-891.471] (-895.008) (-890.625) -- 0:01:55
      17500 -- (-892.453) (-895.765) (-895.004) [-891.371] * [-891.306] (-890.533) (-891.872) (-891.168) -- 0:01:52
      18000 -- (-889.243) [-892.396] (-896.469) (-889.174) * [-892.944] (-891.752) (-893.424) (-891.861) -- 0:02:43
      18500 -- (-891.376) (-893.329) (-893.598) [-891.190] * [-890.936] (-888.470) (-892.966) (-899.232) -- 0:02:39
      19000 -- (-890.975) (-892.056) (-898.671) [-888.841] * (-892.759) [-888.386] (-890.186) (-891.322) -- 0:02:34
      19500 -- (-891.928) (-894.977) (-898.003) [-893.687] * (-889.089) [-894.689] (-897.748) (-890.903) -- 0:02:30
      20000 -- (-890.813) (-896.343) (-893.456) [-891.331] * (-892.647) (-896.062) (-889.503) [-886.453] -- 0:02:27

      Average standard deviation of split frequencies: 0.114049

      20500 -- (-893.656) [-894.954] (-894.342) (-890.417) * (-891.846) (-894.727) (-888.307) [-888.824] -- 0:02:23
      21000 -- (-893.146) (-895.718) (-895.865) [-892.532] * (-898.376) [-888.072] (-892.467) (-893.624) -- 0:02:19
      21500 -- (-892.623) (-894.155) (-897.066) [-889.214] * (-888.728) (-889.126) [-893.766] (-898.790) -- 0:02:16
      22000 -- (-890.360) (-895.375) [-893.898] (-890.984) * (-889.536) [-890.630] (-897.159) (-888.983) -- 0:02:13
      22500 -- (-891.371) [-893.751] (-895.109) (-891.042) * (-890.606) [-888.762] (-892.288) (-890.379) -- 0:02:10
      23000 -- (-890.348) (-895.563) (-897.906) [-892.268] * (-897.069) (-892.777) [-891.683] (-890.562) -- 0:02:07
      23500 -- (-892.663) [-891.403] (-891.773) (-888.861) * (-890.521) (-893.427) (-892.609) [-890.327] -- 0:02:04
      24000 -- (-891.406) (-894.127) [-890.552] (-893.931) * [-891.931] (-895.721) (-889.205) (-892.190) -- 0:02:02
      24500 -- (-890.603) [-894.365] (-893.472) (-895.080) * (-892.898) (-895.345) [-893.407] (-891.549) -- 0:01:59
      25000 -- (-888.559) (-893.996) [-893.901] (-890.189) * (-889.393) (-891.238) (-889.704) [-890.397] -- 0:02:36

      Average standard deviation of split frequencies: 0.090655

      25500 -- (-892.723) [-892.688] (-893.079) (-891.547) * (-892.204) [-892.086] (-889.001) (-891.946) -- 0:02:32
      26000 -- (-889.229) (-894.090) (-893.805) [-890.593] * (-890.609) [-891.903] (-890.416) (-891.897) -- 0:02:29
      26500 -- (-890.748) [-891.728] (-890.316) (-892.960) * [-893.485] (-893.089) (-891.197) (-889.329) -- 0:02:26
      27000 -- (-889.730) [-893.787] (-893.910) (-897.351) * [-888.339] (-894.416) (-892.726) (-888.605) -- 0:02:24
      27500 -- [-890.714] (-898.581) (-889.573) (-899.894) * (-892.643) (-897.188) (-896.108) [-892.054] -- 0:02:21
      28000 -- (-890.660) (-897.916) [-891.335] (-901.140) * [-892.422] (-889.967) (-890.301) (-893.756) -- 0:02:18
      28500 -- [-894.105] (-897.833) (-888.213) (-895.052) * (-896.001) [-888.806] (-889.698) (-892.847) -- 0:02:16
      29000 -- (-896.828) [-894.850] (-893.789) (-893.342) * (-891.480) (-892.295) [-894.356] (-895.678) -- 0:02:13
      29500 -- (-893.988) (-900.026) (-889.389) [-896.265] * (-893.696) [-889.442] (-891.613) (-895.968) -- 0:02:11
      30000 -- (-889.790) (-893.271) (-893.631) [-893.185] * (-889.769) [-890.198] (-893.552) (-898.525) -- 0:02:09

      Average standard deviation of split frequencies: 0.107603

      30500 -- (-894.677) (-894.921) (-898.419) [-898.365] * (-889.773) [-891.514] (-897.380) (-896.787) -- 0:02:07
      31000 -- (-893.492) [-895.379] (-893.212) (-894.244) * (-889.001) (-891.604) (-898.783) [-892.262] -- 0:02:05
      31500 -- (-891.710) (-894.610) (-892.177) [-893.351] * (-892.132) [-890.915] (-891.513) (-903.102) -- 0:02:02
      32000 -- (-893.520) (-892.864) [-891.333] (-894.527) * (-891.584) (-890.089) [-888.610] (-903.028) -- 0:02:31
      32500 -- (-889.824) (-895.406) (-890.928) [-892.255] * [-889.971] (-889.656) (-890.511) (-904.225) -- 0:02:28
      33000 -- (-889.239) (-894.773) [-890.825] (-892.070) * (-890.188) [-891.421] (-891.807) (-893.642) -- 0:02:26
      33500 -- (-892.250) (-896.904) [-892.005] (-897.165) * (-892.334) [-890.730] (-893.494) (-892.683) -- 0:02:24
      34000 -- (-892.443) (-893.623) (-897.284) [-889.786] * [-892.836] (-896.875) (-892.530) (-894.056) -- 0:02:22
      34500 -- (-891.979) (-894.164) [-889.580] (-906.433) * (-889.131) (-895.106) (-893.854) [-886.976] -- 0:02:19
      35000 -- (-892.910) [-896.731] (-891.412) (-896.640) * (-892.294) [-893.346] (-890.785) (-895.456) -- 0:02:17

      Average standard deviation of split frequencies: 0.091662

      35500 -- (-888.871) [-888.761] (-892.901) (-891.145) * (-894.553) (-894.836) [-893.137] (-890.945) -- 0:02:15
      36000 -- [-887.153] (-889.197) (-895.897) (-892.943) * (-893.308) [-890.998] (-890.878) (-890.656) -- 0:02:13
      36500 -- (-889.532) (-892.262) (-892.055) [-890.529] * [-890.467] (-891.522) (-893.470) (-893.158) -- 0:02:11
      37000 -- [-891.630] (-888.920) (-891.233) (-892.683) * (-898.111) [-893.972] (-893.217) (-895.191) -- 0:02:10
      37500 -- [-897.847] (-891.913) (-894.581) (-889.615) * (-892.352) (-894.390) [-894.856] (-894.594) -- 0:02:08
      38000 -- (-896.380) (-888.792) [-895.651] (-889.114) * (-890.607) (-892.815) (-895.007) [-898.484] -- 0:02:06
      38500 -- (-891.598) [-891.179] (-891.244) (-895.321) * (-891.277) (-897.779) [-893.729] (-896.513) -- 0:02:04
      39000 -- (-893.903) (-889.032) [-891.655] (-893.212) * [-892.244] (-896.469) (-893.827) (-893.120) -- 0:02:27
      39500 -- (-893.507) (-891.545) (-894.252) [-889.248] * (-891.555) (-890.498) (-893.828) [-892.105] -- 0:02:25
      40000 -- (-895.898) (-890.420) (-893.102) [-891.410] * (-891.824) [-888.040] (-894.417) (-891.470) -- 0:02:24

      Average standard deviation of split frequencies: 0.092735

      40500 -- (-902.870) (-890.525) (-903.786) [-889.832] * [-891.579] (-891.828) (-890.546) (-895.868) -- 0:02:22
      41000 -- (-895.202) (-891.416) [-888.086] (-891.948) * (-889.158) [-893.929] (-893.154) (-893.185) -- 0:02:20
      41500 -- (-890.917) (-890.882) [-890.745] (-890.091) * [-891.907] (-891.010) (-895.040) (-893.780) -- 0:02:18
      42000 -- (-895.481) [-891.198] (-894.361) (-889.241) * (-890.668) (-895.427) [-890.563] (-893.577) -- 0:02:16
      42500 -- (-896.189) (-889.514) [-891.338] (-892.420) * [-892.326] (-895.554) (-892.875) (-892.753) -- 0:02:15
      43000 -- (-900.388) [-890.391] (-893.772) (-890.925) * (-894.153) (-888.988) [-889.318] (-894.312) -- 0:02:13
      43500 -- (-890.108) (-889.414) [-895.592] (-891.273) * (-889.970) (-888.810) [-889.464] (-896.287) -- 0:02:11
      44000 -- [-890.066] (-887.899) (-891.976) (-889.657) * (-890.128) [-890.725] (-888.295) (-894.352) -- 0:02:10
      44500 -- [-895.064] (-889.888) (-893.643) (-890.441) * [-888.728] (-892.542) (-896.476) (-893.429) -- 0:02:08
      45000 -- (-894.704) (-893.118) (-904.665) [-893.839] * (-894.010) (-890.398) [-891.380] (-891.741) -- 0:02:07

      Average standard deviation of split frequencies: 0.087107

      45500 -- (-890.819) (-893.346) (-889.872) [-890.307] * (-894.558) [-892.516] (-890.673) (-897.306) -- 0:02:05
      46000 -- (-900.924) (-890.820) (-898.494) [-889.628] * (-898.754) (-897.477) (-895.620) [-892.789] -- 0:02:04
      46500 -- (-892.630) [-893.183] (-892.963) (-895.422) * (-897.977) (-891.825) [-889.251] (-893.986) -- 0:02:23
      47000 -- (-891.099) (-892.789) [-890.251] (-892.149) * (-895.360) (-893.389) [-893.767] (-889.645) -- 0:02:21
      47500 -- [-893.440] (-888.187) (-890.264) (-891.343) * (-895.195) (-894.278) (-892.846) [-891.785] -- 0:02:20
      48000 -- (-891.618) (-896.895) [-893.636] (-892.330) * (-891.266) (-895.548) [-891.265] (-892.354) -- 0:02:18
      48500 -- (-893.897) (-894.950) (-891.452) [-889.027] * (-889.872) [-890.660] (-890.259) (-891.355) -- 0:02:17
      49000 -- (-894.189) (-889.907) (-890.652) [-890.563] * [-892.028] (-888.435) (-898.070) (-897.805) -- 0:02:15
      49500 -- [-890.108] (-895.024) (-892.452) (-890.369) * (-888.736) (-894.515) (-896.458) [-898.968] -- 0:02:14
      50000 -- (-895.587) (-888.977) [-888.493] (-892.371) * (-887.258) [-890.122] (-903.441) (-898.152) -- 0:02:13

      Average standard deviation of split frequencies: 0.079084

      50500 -- (-887.633) [-890.769] (-893.158) (-893.081) * (-893.055) [-890.947] (-895.713) (-896.519) -- 0:02:11
      51000 -- (-888.028) (-890.407) (-896.784) [-890.760] * [-888.542] (-891.725) (-891.851) (-892.484) -- 0:02:10
      51500 -- [-890.281] (-894.132) (-892.573) (-893.166) * (-888.838) [-891.705] (-903.610) (-892.481) -- 0:02:08
      52000 -- (-899.320) (-892.518) (-893.771) [-893.772] * (-890.171) [-891.279] (-903.669) (-892.853) -- 0:02:07
      52500 -- [-892.566] (-889.405) (-889.169) (-895.236) * [-890.989] (-888.127) (-896.887) (-894.863) -- 0:02:06
      53000 -- (-890.546) (-889.239) [-893.570] (-892.862) * (-886.759) [-891.434] (-898.289) (-891.792) -- 0:02:05
      53500 -- [-894.636] (-896.568) (-891.755) (-893.422) * (-887.599) (-887.981) [-890.541] (-893.132) -- 0:02:21
      54000 -- [-887.763] (-897.317) (-893.080) (-893.410) * (-897.511) (-894.530) (-892.057) [-897.733] -- 0:02:20
      54500 -- (-894.564) (-897.859) (-890.565) [-890.784] * (-886.993) [-889.334] (-892.390) (-895.409) -- 0:02:18
      55000 -- [-888.566] (-891.443) (-895.063) (-890.400) * (-895.453) [-891.004] (-890.124) (-895.696) -- 0:02:17

      Average standard deviation of split frequencies: 0.075761

      55500 -- (-890.166) [-887.455] (-896.159) (-893.336) * (-888.879) [-890.014] (-896.408) (-901.164) -- 0:02:16
      56000 -- [-895.580] (-893.386) (-894.441) (-902.384) * [-894.715] (-894.048) (-891.904) (-901.040) -- 0:02:14
      56500 -- (-895.357) (-894.003) [-891.217] (-891.687) * (-890.913) (-896.103) (-892.820) [-888.702] -- 0:02:13
      57000 -- [-889.691] (-894.968) (-899.185) (-888.855) * (-887.850) (-897.075) [-891.451] (-892.642) -- 0:02:12
      57500 -- (-895.286) (-894.591) [-895.877] (-895.374) * (-893.521) (-895.173) (-892.513) [-891.231] -- 0:02:11
      58000 -- (-893.787) [-890.164] (-894.436) (-891.943) * (-895.662) (-897.968) [-890.126] (-891.178) -- 0:02:09
      58500 -- (-888.355) (-890.782) (-892.901) [-894.335] * [-887.911] (-890.965) (-889.177) (-892.575) -- 0:02:08
      59000 -- (-888.758) [-895.080] (-895.184) (-895.539) * (-888.566) (-890.029) [-887.379] (-893.628) -- 0:02:07
      59500 -- [-888.346] (-891.717) (-897.390) (-889.083) * [-888.117] (-895.593) (-889.114) (-895.379) -- 0:02:06
      60000 -- (-893.197) [-891.236] (-892.142) (-890.540) * (-891.987) [-889.662] (-893.754) (-895.751) -- 0:02:05

      Average standard deviation of split frequencies: 0.062163

      60500 -- (-889.248) (-893.893) [-897.747] (-898.203) * [-889.875] (-894.846) (-892.271) (-892.486) -- 0:02:19
      61000 -- (-897.947) (-890.959) [-895.452] (-895.679) * (-892.425) (-898.070) (-896.447) [-892.201] -- 0:02:18
      61500 -- [-890.215] (-889.341) (-890.034) (-891.573) * (-892.808) [-890.851] (-893.748) (-893.200) -- 0:02:17
      62000 -- (-892.300) (-888.688) [-895.129] (-889.713) * (-895.965) [-890.834] (-895.948) (-893.489) -- 0:02:16
      62500 -- (-893.735) (-893.914) [-890.293] (-890.595) * (-893.964) [-891.105] (-892.332) (-889.025) -- 0:02:15
      63000 -- [-892.483] (-890.998) (-890.963) (-893.011) * (-896.495) (-894.929) [-892.250] (-892.224) -- 0:02:13
      63500 -- (-893.427) [-894.968] (-891.993) (-891.908) * [-897.313] (-898.002) (-893.618) (-891.192) -- 0:02:12
      64000 -- (-893.129) [-891.467] (-890.112) (-894.877) * (-903.093) [-896.007] (-895.496) (-889.180) -- 0:02:11
      64500 -- (-891.314) [-890.042] (-892.959) (-889.127) * (-902.464) (-897.007) (-893.878) [-888.586] -- 0:02:10
      65000 -- (-891.363) (-894.495) (-892.953) [-891.275] * (-901.384) (-898.817) (-897.227) [-898.350] -- 0:02:09

      Average standard deviation of split frequencies: 0.049997

      65500 -- [-890.246] (-891.414) (-895.926) (-891.269) * (-892.864) (-893.879) (-891.136) [-889.427] -- 0:02:08
      66000 -- (-891.531) [-897.377] (-892.630) (-896.931) * (-888.912) [-891.421] (-895.616) (-888.010) -- 0:02:07
      66500 -- [-891.040] (-889.370) (-901.030) (-890.861) * (-891.756) (-892.434) (-894.956) [-889.689] -- 0:02:06
      67000 -- [-887.762] (-891.197) (-891.775) (-894.224) * (-890.992) (-890.078) (-889.645) [-891.793] -- 0:02:05
      67500 -- (-891.374) [-892.416] (-892.204) (-892.493) * (-891.498) (-897.160) [-893.730] (-897.356) -- 0:02:18
      68000 -- (-891.149) (-892.572) [-889.672] (-898.473) * (-892.580) [-889.333] (-892.101) (-892.548) -- 0:02:17
      68500 -- [-890.270] (-893.915) (-892.583) (-891.470) * (-890.020) (-889.609) (-891.619) [-894.567] -- 0:02:15
      69000 -- (-891.098) (-895.007) [-898.345] (-892.929) * [-892.025] (-889.766) (-891.195) (-895.737) -- 0:02:14
      69500 -- (-890.583) (-896.610) (-891.511) [-891.686] * (-892.242) (-894.315) [-890.090] (-898.604) -- 0:02:13
      70000 -- (-892.842) [-891.256] (-893.192) (-905.774) * (-904.731) (-891.991) (-887.651) [-895.633] -- 0:02:12

      Average standard deviation of split frequencies: 0.033354

      70500 -- (-891.174) (-891.600) [-891.006] (-894.931) * (-897.505) (-892.247) (-887.871) [-893.438] -- 0:02:11
      71000 -- (-892.206) (-893.844) (-890.833) [-887.488] * (-898.324) [-896.128] (-893.358) (-896.641) -- 0:02:10
      71500 -- (-892.165) (-894.422) [-888.752] (-895.142) * (-899.044) [-892.906] (-891.497) (-891.470) -- 0:02:09
      72000 -- [-890.628] (-892.988) (-892.703) (-893.308) * (-896.128) (-891.579) [-893.949] (-890.345) -- 0:02:08
      72500 -- (-897.186) [-888.505] (-893.260) (-896.088) * (-890.307) (-893.806) (-889.261) [-891.606] -- 0:02:07
      73000 -- [-892.548] (-891.029) (-898.456) (-895.873) * [-898.361] (-889.679) (-890.527) (-888.067) -- 0:02:06
      73500 -- [-893.192] (-894.096) (-892.051) (-893.832) * (-891.937) [-889.909] (-889.471) (-893.534) -- 0:02:06
      74000 -- (-891.398) [-893.293] (-891.409) (-895.784) * (-892.734) (-887.840) [-892.967] (-891.692) -- 0:02:05
      74500 -- (-891.759) (-889.433) [-890.385] (-897.900) * (-890.931) (-887.179) [-888.498] (-895.255) -- 0:02:16
      75000 -- (-894.374) (-888.294) [-894.937] (-894.107) * (-889.623) (-890.138) [-887.928] (-891.399) -- 0:02:15

      Average standard deviation of split frequencies: 0.037216

      75500 -- (-896.254) [-893.766] (-895.395) (-895.450) * (-891.511) (-890.323) [-891.048] (-892.235) -- 0:02:14
      76000 -- (-899.443) [-890.969] (-895.105) (-894.352) * (-893.534) [-889.577] (-889.478) (-895.558) -- 0:02:13
      76500 -- [-894.386] (-888.456) (-894.850) (-889.695) * [-889.330] (-893.298) (-890.734) (-891.504) -- 0:02:12
      77000 -- [-891.827] (-889.123) (-893.834) (-890.195) * [-893.135] (-895.482) (-890.183) (-889.685) -- 0:02:11
      77500 -- [-890.732] (-892.461) (-891.726) (-891.789) * (-892.258) (-897.189) (-891.641) [-892.818] -- 0:02:10
      78000 -- (-890.415) [-892.140] (-895.755) (-891.469) * [-891.139] (-893.921) (-895.132) (-893.230) -- 0:02:10
      78500 -- (-897.024) (-890.415) (-892.944) [-888.706] * [-891.815] (-892.524) (-896.310) (-898.406) -- 0:02:09
      79000 -- (-890.908) (-889.358) (-896.170) [-889.427] * (-887.348) (-896.555) [-890.069] (-893.471) -- 0:02:08
      79500 -- (-891.592) [-891.414] (-895.343) (-891.689) * (-890.478) (-892.515) [-893.718] (-890.856) -- 0:02:07
      80000 -- (-891.129) (-892.449) (-892.857) [-890.421] * [-890.125] (-895.790) (-896.466) (-896.765) -- 0:02:06

      Average standard deviation of split frequencies: 0.040907

      80500 -- (-893.268) (-894.308) (-893.974) [-887.581] * (-889.189) [-894.180] (-889.771) (-891.436) -- 0:02:05
      81000 -- (-894.550) (-896.778) [-891.691] (-890.253) * (-892.867) (-897.144) (-892.615) [-889.069] -- 0:02:04
      81500 -- (-893.158) (-891.457) (-890.983) [-897.114] * [-889.201] (-890.059) (-887.661) (-890.245) -- 0:02:15
      82000 -- (-891.483) [-894.023] (-889.619) (-892.303) * [-891.364] (-893.542) (-890.891) (-893.279) -- 0:02:14
      82500 -- [-889.234] (-889.782) (-892.160) (-888.648) * [-892.451] (-891.213) (-894.603) (-894.879) -- 0:02:13
      83000 -- (-891.619) (-893.507) (-893.007) [-887.735] * (-891.521) [-892.575] (-895.867) (-892.833) -- 0:02:12
      83500 -- [-891.884] (-891.520) (-892.133) (-891.466) * [-890.782] (-889.980) (-892.733) (-894.292) -- 0:02:11
      84000 -- (-893.100) (-887.569) (-894.957) [-890.310] * (-890.080) (-892.837) [-894.958] (-891.148) -- 0:02:10
      84500 -- (-891.797) (-890.343) (-888.782) [-890.626] * (-897.777) [-888.766] (-893.362) (-893.062) -- 0:02:10
      85000 -- [-890.348] (-891.810) (-888.030) (-892.742) * [-890.137] (-889.163) (-887.903) (-891.013) -- 0:02:09

      Average standard deviation of split frequencies: 0.032889

      85500 -- (-892.383) [-887.755] (-894.918) (-893.487) * (-891.329) [-888.703] (-893.088) (-892.094) -- 0:02:08
      86000 -- (-891.896) [-892.568] (-893.195) (-894.746) * (-891.282) (-889.819) [-890.684] (-902.139) -- 0:02:07
      86500 -- (-889.720) (-892.570) [-898.422] (-893.635) * (-889.141) [-888.505] (-896.196) (-891.388) -- 0:02:06
      87000 -- [-889.718] (-891.913) (-894.901) (-896.544) * [-888.661] (-891.355) (-892.437) (-896.338) -- 0:02:05
      87500 -- [-891.049] (-892.586) (-894.456) (-890.229) * [-892.334] (-890.112) (-892.174) (-888.306) -- 0:02:05
      88000 -- (-887.359) (-894.653) (-896.290) [-893.466] * (-892.544) [-892.096] (-891.878) (-892.832) -- 0:02:04
      88500 -- [-891.360] (-892.590) (-893.966) (-892.488) * (-890.778) (-894.052) [-891.734] (-897.853) -- 0:02:03
      89000 -- (-891.757) (-890.145) (-898.007) [-889.343] * (-893.051) (-893.736) (-889.287) [-895.958] -- 0:02:13
      89500 -- (-893.557) (-887.215) (-892.637) [-893.491] * (-888.639) [-887.844] (-894.652) (-900.424) -- 0:02:12
      90000 -- [-896.849] (-894.070) (-897.579) (-891.870) * [-889.413] (-892.249) (-892.800) (-890.902) -- 0:02:11

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-893.267) [-888.738] (-903.168) (-892.191) * (-894.251) (-889.131) (-895.744) [-893.804] -- 0:02:10
      91000 -- (-892.054) [-889.405] (-894.201) (-892.512) * (-891.797) (-890.435) (-898.161) [-892.883] -- 0:02:09
      91500 -- [-898.049] (-893.172) (-900.124) (-896.155) * (-888.999) (-896.389) (-893.622) [-896.293] -- 0:02:09
      92000 -- [-894.447] (-889.985) (-895.917) (-892.288) * (-895.506) [-887.712] (-891.337) (-895.913) -- 0:02:08
      92500 -- (-896.487) (-892.505) [-891.011] (-892.411) * (-888.492) (-892.470) [-895.898] (-896.173) -- 0:02:07
      93000 -- (-890.064) (-892.429) (-892.869) [-895.745] * (-892.411) (-894.392) (-891.866) [-892.472] -- 0:02:06
      93500 -- (-891.860) [-887.802] (-891.842) (-895.842) * (-893.379) (-898.814) (-890.611) [-888.923] -- 0:02:06
      94000 -- [-893.775] (-888.654) (-890.571) (-893.122) * [-889.469] (-890.373) (-894.548) (-889.383) -- 0:02:05
      94500 -- (-891.163) (-891.905) (-890.898) [-895.585] * (-891.842) [-888.633] (-895.473) (-890.994) -- 0:02:04
      95000 -- (-887.050) (-891.490) [-895.775] (-892.443) * (-895.252) (-888.509) [-888.473] (-890.537) -- 0:02:03

      Average standard deviation of split frequencies: 0.034373

      95500 -- (-891.338) [-890.629] (-889.905) (-889.561) * (-889.733) [-890.251] (-889.786) (-896.888) -- 0:02:03
      96000 -- (-893.870) (-892.425) [-891.318] (-891.491) * (-889.486) (-895.136) [-892.474] (-891.422) -- 0:02:11
      96500 -- [-893.500] (-891.308) (-892.193) (-896.189) * [-891.860] (-891.363) (-890.988) (-891.513) -- 0:02:11
      97000 -- (-894.501) [-889.247] (-889.608) (-892.786) * (-893.633) [-894.928] (-894.945) (-901.075) -- 0:02:10
      97500 -- (-889.846) (-891.362) [-891.198] (-891.824) * (-892.467) (-889.424) [-892.906] (-894.326) -- 0:02:09
      98000 -- (-896.247) [-892.953] (-895.330) (-891.915) * (-893.422) (-889.923) (-892.189) [-888.318] -- 0:02:08
      98500 -- (-891.259) (-891.194) (-894.099) [-893.289] * (-890.156) (-890.935) [-888.533] (-890.788) -- 0:02:08
      99000 -- (-888.280) [-887.974] (-897.850) (-896.326) * (-888.946) (-894.183) (-891.204) [-888.272] -- 0:02:07
      99500 -- (-896.806) (-892.401) [-896.384] (-900.865) * (-895.001) (-890.191) (-895.001) [-893.050] -- 0:02:06
      100000 -- (-892.754) [-888.108] (-895.677) (-891.952) * (-890.470) [-889.590] (-888.886) (-889.022) -- 0:02:05

      Average standard deviation of split frequencies: 0.032780

      100500 -- (-890.657) [-891.479] (-894.556) (-898.863) * (-889.342) [-890.301] (-893.083) (-890.732) -- 0:02:05
      101000 -- (-894.976) [-894.136] (-891.182) (-898.751) * (-894.194) [-891.240] (-893.675) (-891.184) -- 0:02:04
      101500 -- (-890.807) [-896.007] (-888.526) (-895.625) * (-898.213) (-889.094) (-891.030) [-891.565] -- 0:02:03
      102000 -- (-894.257) [-892.799] (-891.023) (-890.393) * (-898.658) [-891.703] (-889.372) (-891.915) -- 0:02:03
      102500 -- [-889.784] (-890.028) (-888.258) (-888.808) * (-887.861) (-895.615) [-889.382] (-892.600) -- 0:02:02
      103000 -- (-890.165) [-890.260] (-895.164) (-888.486) * (-901.761) (-894.676) [-891.175] (-893.475) -- 0:02:10
      103500 -- [-888.559] (-888.832) (-890.608) (-888.526) * [-893.834] (-891.718) (-893.668) (-893.637) -- 0:02:09
      104000 -- (-891.709) (-891.793) (-890.310) [-890.628] * (-888.756) (-890.798) (-898.263) [-888.220] -- 0:02:09
      104500 -- (-890.623) [-887.903] (-894.139) (-892.866) * (-893.487) (-892.401) (-891.913) [-892.843] -- 0:02:08
      105000 -- (-890.666) [-891.528] (-895.168) (-892.866) * [-889.878] (-894.599) (-890.609) (-893.883) -- 0:02:07

      Average standard deviation of split frequencies: 0.031130

      105500 -- (-888.768) [-890.080] (-901.461) (-888.324) * (-889.879) (-892.548) [-894.650] (-895.394) -- 0:02:07
      106000 -- (-895.968) [-888.359] (-903.750) (-895.034) * (-892.118) (-890.503) (-896.453) [-890.638] -- 0:02:06
      106500 -- (-893.046) (-890.654) (-891.174) [-894.567] * [-890.623] (-892.215) (-898.213) (-894.242) -- 0:02:05
      107000 -- [-889.247] (-890.100) (-894.124) (-890.900) * [-888.432] (-893.105) (-890.452) (-895.041) -- 0:02:05
      107500 -- (-890.583) (-888.651) [-891.389] (-894.065) * (-906.601) (-889.441) (-890.768) [-894.431] -- 0:02:04
      108000 -- (-891.773) [-893.355] (-893.184) (-890.204) * (-894.682) (-895.523) (-894.437) [-889.955] -- 0:02:03
      108500 -- (-890.720) [-892.300] (-896.955) (-893.720) * (-896.829) (-893.664) [-892.226] (-893.916) -- 0:02:03
      109000 -- (-892.702) (-894.635) [-890.256] (-892.169) * [-893.362] (-887.624) (-891.102) (-892.273) -- 0:02:02
      109500 -- (-891.460) [-891.831] (-895.879) (-893.127) * [-892.521] (-888.700) (-894.019) (-896.420) -- 0:02:01
      110000 -- (-891.799) (-891.047) [-895.163] (-903.159) * [-896.051] (-891.122) (-891.587) (-896.948) -- 0:02:09

      Average standard deviation of split frequencies: 0.029818

      110500 -- (-894.347) [-892.920] (-894.215) (-899.341) * (-896.890) (-893.083) (-889.768) [-891.192] -- 0:02:08
      111000 -- (-891.287) (-891.524) (-897.492) [-890.944] * (-895.425) [-889.357] (-899.449) (-886.726) -- 0:02:08
      111500 -- [-889.846] (-890.419) (-892.249) (-891.435) * (-891.772) [-889.387] (-896.745) (-891.596) -- 0:02:07
      112000 -- [-896.472] (-889.389) (-890.365) (-894.166) * (-890.312) [-889.807] (-898.890) (-890.773) -- 0:02:06
      112500 -- (-903.425) [-891.940] (-894.332) (-892.699) * [-889.131] (-890.705) (-892.783) (-894.515) -- 0:02:06
      113000 -- [-893.462] (-892.560) (-896.313) (-891.936) * (-897.092) (-889.027) (-894.123) [-889.114] -- 0:02:05
      113500 -- [-888.204] (-891.929) (-894.636) (-890.886) * (-890.809) (-895.722) (-889.976) [-889.358] -- 0:02:04
      114000 -- (-889.247) [-890.024] (-891.893) (-889.813) * [-893.762] (-894.663) (-888.246) (-888.825) -- 0:02:04
      114500 -- (-893.865) (-891.347) (-896.892) [-894.724] * (-897.965) (-894.640) [-887.220] (-892.250) -- 0:02:03
      115000 -- (-891.752) [-889.167] (-893.045) (-892.988) * [-893.992] (-893.572) (-889.177) (-892.611) -- 0:02:03

      Average standard deviation of split frequencies: 0.024383

      115500 -- (-897.851) [-890.090] (-895.993) (-888.799) * (-888.966) (-896.051) (-892.208) [-889.927] -- 0:02:02
      116000 -- (-890.859) (-892.060) [-893.724] (-891.844) * [-891.996] (-888.413) (-890.144) (-888.660) -- 0:02:01
      116500 -- (-889.330) (-893.374) [-893.742] (-893.874) * [-889.619] (-891.607) (-890.408) (-891.949) -- 0:02:01
      117000 -- (-892.822) (-892.341) (-894.991) [-895.042] * [-891.694] (-898.095) (-895.126) (-892.947) -- 0:02:08
      117500 -- (-892.755) (-890.010) [-892.896] (-901.899) * (-893.797) [-892.510] (-895.647) (-893.239) -- 0:02:07
      118000 -- (-894.146) [-891.486] (-892.150) (-891.769) * [-892.117] (-893.587) (-893.449) (-895.492) -- 0:02:07
      118500 -- (-896.683) [-889.542] (-890.831) (-892.837) * [-892.207] (-892.010) (-891.362) (-895.246) -- 0:02:06
      119000 -- (-894.114) [-893.635] (-890.217) (-895.110) * (-894.367) (-890.000) (-888.740) [-894.493] -- 0:02:05
      119500 -- (-890.742) (-889.568) [-895.025] (-894.175) * (-891.042) [-895.010] (-889.435) (-895.456) -- 0:02:05
      120000 -- (-893.459) [-888.812] (-896.942) (-898.559) * (-891.233) (-894.110) (-889.105) [-893.761] -- 0:02:04

      Average standard deviation of split frequencies: 0.023440

      120500 -- [-894.676] (-890.779) (-894.053) (-890.591) * (-891.545) (-890.176) [-887.992] (-893.327) -- 0:02:04
      121000 -- (-892.518) (-890.909) [-890.445] (-886.533) * (-893.705) [-887.317] (-895.859) (-894.096) -- 0:02:03
      121500 -- (-891.033) (-895.226) (-893.138) [-888.556] * (-895.186) (-891.280) [-888.982] (-887.595) -- 0:02:02
      122000 -- (-892.083) [-890.160] (-890.216) (-892.528) * (-889.345) [-892.893] (-893.788) (-891.267) -- 0:02:02
      122500 -- (-897.591) [-888.954] (-890.805) (-892.533) * [-889.622] (-896.640) (-892.403) (-891.874) -- 0:02:01
      123000 -- (-895.934) (-887.626) (-888.432) [-890.152] * [-889.769] (-898.768) (-894.472) (-895.347) -- 0:02:01
      123500 -- [-890.894] (-889.119) (-890.328) (-897.225) * [-890.291] (-896.279) (-892.659) (-890.320) -- 0:02:00
      124000 -- (-892.330) (-890.394) [-890.689] (-890.438) * [-892.337] (-889.810) (-898.904) (-892.794) -- 0:02:07
      124500 -- (-894.228) (-892.906) [-890.026] (-890.765) * (-892.372) (-896.840) (-893.628) [-895.014] -- 0:02:06
      125000 -- [-892.599] (-892.957) (-895.968) (-890.345) * [-897.744] (-893.051) (-893.936) (-891.075) -- 0:02:06

      Average standard deviation of split frequencies: 0.026189

      125500 -- [-892.566] (-887.000) (-897.664) (-891.565) * (-889.952) (-896.407) [-890.940] (-891.966) -- 0:02:05
      126000 -- (-894.786) (-891.907) [-894.605] (-895.285) * (-889.143) [-893.337] (-897.246) (-893.155) -- 0:02:04
      126500 -- (-893.084) [-891.886] (-896.021) (-892.669) * [-890.338] (-892.860) (-900.812) (-890.928) -- 0:02:04
      127000 -- (-891.565) (-897.207) [-890.177] (-889.857) * (-892.259) [-889.345] (-895.642) (-890.632) -- 0:02:03
      127500 -- (-892.784) (-896.101) [-889.990] (-894.999) * (-890.293) (-893.679) (-894.689) [-892.292] -- 0:02:03
      128000 -- [-892.109] (-896.367) (-896.740) (-893.340) * [-890.359] (-892.118) (-897.202) (-894.651) -- 0:02:02
      128500 -- (-890.622) [-892.322] (-888.679) (-889.594) * (-894.626) [-893.141] (-895.031) (-888.797) -- 0:02:02
      129000 -- (-892.546) [-888.395] (-892.851) (-893.669) * (-891.283) [-888.167] (-889.690) (-890.355) -- 0:02:01
      129500 -- [-890.219] (-890.777) (-892.728) (-889.851) * (-892.281) (-892.481) [-892.578] (-893.305) -- 0:02:00
      130000 -- (-890.401) (-891.199) [-892.122] (-896.759) * [-890.698] (-890.245) (-888.348) (-890.010) -- 0:02:00

      Average standard deviation of split frequencies: 0.025254

      130500 -- [-890.994] (-889.710) (-894.257) (-893.964) * (-892.789) (-892.172) [-889.962] (-892.821) -- 0:01:59
      131000 -- (-888.064) [-891.311] (-892.377) (-899.629) * (-896.133) (-891.641) [-895.196] (-891.763) -- 0:02:06
      131500 -- (-891.330) (-890.358) [-893.221] (-894.782) * (-894.439) (-891.879) (-890.630) [-890.531] -- 0:02:05
      132000 -- [-892.438] (-886.705) (-893.560) (-892.542) * (-895.171) (-897.835) [-892.998] (-887.653) -- 0:02:04
      132500 -- (-895.873) (-890.468) [-888.775] (-894.817) * [-895.875] (-888.776) (-899.165) (-890.824) -- 0:02:04
      133000 -- (-891.070) [-888.181] (-895.296) (-897.308) * (-894.116) (-892.748) [-892.331] (-892.792) -- 0:02:03
      133500 -- [-890.929] (-887.609) (-893.371) (-890.773) * (-895.578) [-901.038] (-898.408) (-892.289) -- 0:02:03
      134000 -- [-890.114] (-891.515) (-893.193) (-887.804) * (-896.963) [-890.150] (-898.964) (-892.691) -- 0:02:02
      134500 -- (-888.096) (-888.990) (-892.976) [-888.714] * (-890.726) (-894.136) (-897.249) [-891.675] -- 0:02:02
      135000 -- (-890.001) (-890.425) (-890.502) [-891.055] * (-891.595) [-890.494] (-894.691) (-890.059) -- 0:02:01

      Average standard deviation of split frequencies: 0.020797

      135500 -- (-893.999) [-887.983] (-892.340) (-888.335) * (-893.964) [-893.724] (-899.756) (-890.169) -- 0:02:01
      136000 -- (-889.583) (-892.626) [-889.979] (-898.428) * (-893.102) [-889.461] (-897.356) (-888.249) -- 0:02:00
      136500 -- [-891.724] (-887.594) (-895.675) (-893.083) * (-889.232) (-892.041) (-895.003) [-892.752] -- 0:02:00
      137000 -- (-888.210) [-889.381] (-893.894) (-896.552) * (-888.922) (-892.139) (-902.416) [-892.830] -- 0:01:59
      137500 -- (-893.690) (-891.522) [-894.473] (-890.566) * (-893.364) (-893.862) (-898.711) [-890.607] -- 0:01:59
      138000 -- (-901.031) (-891.519) [-889.642] (-888.873) * (-891.241) (-895.615) (-896.041) [-894.884] -- 0:02:04
      138500 -- (-894.478) [-893.349] (-889.529) (-892.568) * [-897.187] (-893.269) (-894.094) (-892.718) -- 0:02:04
      139000 -- (-893.235) (-893.207) [-891.536] (-892.337) * [-892.896] (-888.070) (-897.147) (-893.249) -- 0:02:03
      139500 -- (-892.282) [-894.538] (-890.542) (-890.543) * (-890.366) [-889.259] (-900.162) (-892.725) -- 0:02:03
      140000 -- (-889.562) (-891.236) [-889.643] (-891.964) * [-890.918] (-890.004) (-900.228) (-892.318) -- 0:02:02

      Average standard deviation of split frequencies: 0.020107

      140500 -- [-888.514] (-898.224) (-891.429) (-893.147) * (-894.993) [-895.037] (-903.772) (-897.571) -- 0:02:02
      141000 -- [-891.942] (-894.379) (-892.197) (-888.645) * [-892.779] (-892.017) (-893.175) (-889.885) -- 0:02:01
      141500 -- (-890.821) (-892.041) (-897.095) [-895.847] * [-894.756] (-891.404) (-894.693) (-891.452) -- 0:02:01
      142000 -- (-890.536) (-894.516) [-892.828] (-889.920) * [-888.516] (-892.532) (-903.245) (-892.622) -- 0:02:00
      142500 -- (-895.451) [-894.427] (-895.466) (-889.476) * (-892.857) (-893.119) (-900.891) [-889.203] -- 0:02:00
      143000 -- (-896.710) [-892.495] (-893.696) (-894.856) * (-890.913) (-890.570) (-893.441) [-889.686] -- 0:01:59
      143500 -- (-897.289) [-893.050] (-890.550) (-887.528) * [-894.147] (-891.933) (-893.965) (-890.665) -- 0:01:59
      144000 -- (-908.747) (-896.174) (-886.713) [-890.376] * [-890.815] (-892.790) (-896.018) (-893.523) -- 0:01:58
      144500 -- (-897.848) (-892.833) [-891.295] (-894.903) * (-893.110) (-891.755) [-893.567] (-893.124) -- 0:01:58
      145000 -- (-892.408) (-895.331) (-892.180) [-888.739] * (-889.338) (-899.513) (-891.900) [-895.334] -- 0:02:03

      Average standard deviation of split frequencies: 0.025830

      145500 -- (-890.269) (-888.473) (-889.629) [-888.532] * (-890.402) (-891.804) (-896.998) [-892.255] -- 0:02:03
      146000 -- (-894.293) (-891.430) (-889.746) [-892.522] * (-893.032) (-895.977) (-894.745) [-892.534] -- 0:02:02
      146500 -- (-896.124) [-891.875] (-894.207) (-891.469) * [-889.392] (-892.942) (-892.165) (-892.706) -- 0:02:02
      147000 -- (-898.275) (-889.496) (-889.034) [-890.435] * (-890.405) (-890.404) [-890.337] (-891.265) -- 0:02:01
      147500 -- (-889.043) [-891.892] (-891.285) (-895.165) * (-889.093) (-894.764) [-886.817] (-891.536) -- 0:02:01
      148000 -- (-892.760) (-891.623) [-887.566] (-891.092) * (-892.651) (-895.005) [-892.890] (-895.782) -- 0:02:00
      148500 -- [-899.330] (-893.677) (-894.714) (-895.457) * [-892.483] (-897.303) (-893.186) (-889.800) -- 0:02:00
      149000 -- (-890.903) [-889.821] (-895.776) (-892.705) * (-891.992) (-895.804) [-891.120] (-892.370) -- 0:01:59
      149500 -- (-895.328) (-891.961) [-892.380] (-894.183) * (-892.642) [-897.604] (-889.450) (-890.484) -- 0:01:59
      150000 -- (-893.854) (-896.855) [-890.098] (-892.376) * (-890.535) [-896.974] (-893.068) (-894.113) -- 0:01:58

      Average standard deviation of split frequencies: 0.028159

      150500 -- (-895.284) (-892.986) (-891.215) [-894.510] * (-891.817) (-900.524) (-895.738) [-891.179] -- 0:01:58
      151000 -- (-894.872) (-895.048) [-890.205] (-889.232) * (-888.618) (-893.202) (-893.702) [-893.330] -- 0:01:58
      151500 -- (-892.261) (-892.468) (-891.184) [-895.969] * (-891.206) (-893.873) (-894.234) [-889.754] -- 0:01:57
      152000 -- (-889.449) (-892.221) (-888.916) [-895.363] * (-895.398) [-891.840] (-896.308) (-892.948) -- 0:01:57
      152500 -- [-891.355] (-889.702) (-889.542) (-890.365) * (-893.470) (-894.642) (-895.810) [-892.215] -- 0:02:02
      153000 -- (-892.758) (-893.778) [-889.582] (-891.410) * (-892.187) (-892.571) (-892.152) [-888.676] -- 0:02:01
      153500 -- (-896.276) (-890.164) (-887.636) [-889.055] * (-890.910) (-896.103) [-891.281] (-892.948) -- 0:02:01
      154000 -- (-891.991) (-902.641) (-889.567) [-891.009] * (-894.642) (-891.951) (-895.017) [-893.594] -- 0:02:00
      154500 -- [-892.837] (-896.002) (-891.579) (-896.016) * (-896.914) [-892.706] (-895.876) (-895.226) -- 0:02:00
      155000 -- (-893.400) (-895.781) (-893.600) [-896.237] * (-892.627) (-891.037) [-892.314] (-890.446) -- 0:01:59

      Average standard deviation of split frequencies: 0.024175

      155500 -- (-889.101) [-893.545] (-892.154) (-898.088) * [-892.450] (-887.915) (-893.570) (-891.984) -- 0:01:59
      156000 -- (-890.691) (-888.664) (-894.189) [-888.880] * (-888.937) (-893.972) [-893.109] (-889.339) -- 0:01:59
      156500 -- [-893.550] (-893.395) (-890.917) (-894.949) * (-888.585) [-890.454] (-891.897) (-892.557) -- 0:01:58
      157000 -- (-891.345) (-895.154) (-889.738) [-891.697] * (-891.063) [-889.678] (-893.220) (-893.375) -- 0:01:58
      157500 -- (-892.200) (-893.167) (-888.698) [-888.587] * (-896.022) (-889.627) (-890.123) [-891.228] -- 0:01:57
      158000 -- [-891.362] (-891.815) (-889.399) (-895.116) * (-897.570) (-888.420) (-895.456) [-891.708] -- 0:01:57
      158500 -- [-891.778] (-890.305) (-892.291) (-893.342) * (-906.554) [-891.537] (-892.240) (-893.313) -- 0:01:56
      159000 -- (-893.179) (-889.593) [-891.471] (-890.976) * (-898.278) (-892.427) [-890.820] (-893.353) -- 0:01:56
      159500 -- [-890.032] (-892.224) (-891.832) (-892.379) * [-889.492] (-891.474) (-891.425) (-890.307) -- 0:02:01
      160000 -- [-896.571] (-893.716) (-892.812) (-891.457) * (-894.284) (-890.998) [-891.209] (-897.722) -- 0:02:00

      Average standard deviation of split frequencies: 0.020538

      160500 -- (-891.798) (-894.235) (-889.524) [-889.439] * (-891.661) (-893.189) (-889.718) [-894.026] -- 0:02:00
      161000 -- (-888.562) [-892.212] (-888.531) (-890.215) * (-890.696) (-892.029) (-890.089) [-897.411] -- 0:01:59
      161500 -- (-896.069) (-890.429) [-892.377] (-889.913) * (-888.398) (-892.716) (-889.551) [-890.417] -- 0:01:59
      162000 -- (-902.683) (-891.558) [-889.188] (-892.378) * (-891.023) [-893.941] (-899.119) (-891.593) -- 0:01:58
      162500 -- (-899.011) (-900.862) [-890.562] (-896.116) * (-890.682) [-897.017] (-890.548) (-890.065) -- 0:01:58
      163000 -- [-896.506] (-892.740) (-889.475) (-891.156) * (-897.440) [-893.876] (-886.639) (-894.219) -- 0:01:58
      163500 -- (-894.337) (-888.453) [-896.551] (-888.872) * (-893.430) (-891.331) (-890.901) [-890.595] -- 0:01:57
      164000 -- (-891.546) (-889.412) (-894.482) [-889.192] * (-892.624) (-899.629) (-889.872) [-891.114] -- 0:01:57
      164500 -- (-890.937) (-892.126) [-889.920] (-891.877) * (-892.714) (-894.753) [-888.900] (-891.859) -- 0:01:56
      165000 -- (-895.306) [-890.168] (-890.459) (-890.048) * (-893.359) [-890.466] (-898.318) (-889.354) -- 0:01:56

      Average standard deviation of split frequencies: 0.019879

      165500 -- (-898.349) (-891.607) (-889.957) [-889.088] * (-891.220) (-892.595) (-894.088) [-889.790] -- 0:01:55
      166000 -- (-894.938) [-891.564] (-892.095) (-890.999) * (-891.594) [-888.742] (-895.568) (-893.708) -- 0:01:55
      166500 -- (-894.576) [-888.795] (-888.140) (-894.911) * (-892.994) [-891.144] (-890.174) (-893.553) -- 0:02:00
      167000 -- (-896.924) (-889.118) [-892.440] (-894.493) * (-894.079) (-896.084) (-890.338) [-888.121] -- 0:01:59
      167500 -- (-895.763) [-892.820] (-889.351) (-892.473) * (-893.729) [-892.199] (-892.366) (-896.445) -- 0:01:59
      168000 -- (-896.411) (-895.654) [-894.176] (-888.910) * (-888.593) (-889.127) [-887.690] (-893.202) -- 0:01:58
      168500 -- (-892.965) (-892.108) [-894.630] (-894.006) * (-893.264) [-893.510] (-891.727) (-894.855) -- 0:01:58
      169000 -- [-893.399] (-890.004) (-890.179) (-896.149) * (-893.584) (-888.682) (-888.908) [-894.157] -- 0:01:58
      169500 -- (-891.543) (-894.735) [-892.430] (-889.578) * (-892.336) [-893.935] (-891.400) (-892.072) -- 0:01:57
      170000 -- (-890.805) [-894.396] (-891.772) (-890.614) * [-890.915] (-896.370) (-890.777) (-889.817) -- 0:01:57

      Average standard deviation of split frequencies: 0.016573

      170500 -- (-894.795) (-894.258) [-895.970] (-894.343) * (-891.955) (-897.694) [-895.239] (-891.967) -- 0:01:56
      171000 -- [-892.115] (-889.638) (-890.116) (-889.096) * (-889.324) (-891.880) (-891.760) [-890.758] -- 0:01:56
      171500 -- [-892.243] (-895.579) (-890.399) (-889.317) * (-889.331) (-892.654) [-888.377] (-893.931) -- 0:01:55
      172000 -- (-892.412) [-893.412] (-891.735) (-890.541) * (-890.183) [-891.445] (-890.101) (-890.017) -- 0:01:55
      172500 -- (-895.421) (-896.658) (-895.476) [-889.148] * (-892.034) (-891.839) [-890.727] (-894.285) -- 0:01:55
      173000 -- (-898.533) (-891.665) (-891.729) [-891.275] * [-893.504] (-892.254) (-888.265) (-892.113) -- 0:01:54
      173500 -- [-891.434] (-894.906) (-896.509) (-892.172) * (-891.656) (-891.890) (-889.975) [-892.000] -- 0:01:59
      174000 -- (-893.400) (-899.010) (-891.898) [-893.102] * [-888.109] (-889.678) (-889.721) (-889.237) -- 0:01:58
      174500 -- [-894.324] (-895.273) (-894.886) (-898.367) * (-891.992) [-891.498] (-887.944) (-887.370) -- 0:01:58
      175000 -- (-891.894) [-896.241] (-896.178) (-898.818) * (-896.061) (-895.687) (-894.700) [-890.447] -- 0:01:57

      Average standard deviation of split frequencies: 0.018749

      175500 -- (-890.592) [-893.956] (-890.257) (-892.210) * (-890.723) (-898.017) (-889.054) [-890.644] -- 0:01:57
      176000 -- [-891.907] (-892.589) (-890.653) (-891.607) * [-888.840] (-894.491) (-888.929) (-890.127) -- 0:01:57
      176500 -- (-889.143) [-897.266] (-898.043) (-893.104) * (-894.772) (-897.244) [-889.593] (-889.622) -- 0:01:56
      177000 -- (-890.287) (-894.444) (-894.773) [-897.431] * (-889.897) (-899.314) [-890.713] (-892.826) -- 0:01:56
      177500 -- (-892.027) (-894.414) (-892.890) [-892.509] * (-889.863) (-895.180) [-893.256] (-894.471) -- 0:01:55
      178000 -- [-889.827] (-892.549) (-894.470) (-891.636) * (-889.037) (-890.405) (-891.946) [-890.683] -- 0:01:55
      178500 -- (-890.140) (-892.636) (-891.810) [-890.279] * (-895.490) (-889.079) (-890.740) [-891.055] -- 0:01:55
      179000 -- (-892.795) (-891.949) (-890.148) [-892.006] * (-893.231) (-893.886) (-896.357) [-897.587] -- 0:01:54
      179500 -- (-897.294) (-893.512) (-896.898) [-889.858] * (-895.044) (-892.530) (-897.196) [-901.085] -- 0:01:54
      180000 -- (-891.836) (-892.652) [-894.027] (-892.206) * (-892.892) [-896.152] (-897.941) (-887.918) -- 0:01:53

      Average standard deviation of split frequencies: 0.015656

      180500 -- [-888.389] (-898.390) (-894.925) (-893.494) * (-893.121) (-891.418) (-894.268) [-890.200] -- 0:01:58
      181000 -- (-887.757) (-893.631) (-895.246) [-893.592] * (-894.164) [-891.571] (-889.450) (-888.715) -- 0:01:57
      181500 -- [-888.280] (-894.369) (-895.528) (-891.090) * (-893.567) [-891.405] (-898.887) (-889.991) -- 0:01:57
      182000 -- (-893.381) (-891.179) (-899.642) [-891.910] * [-894.855] (-891.800) (-892.369) (-897.833) -- 0:01:56
      182500 -- [-891.129] (-892.824) (-896.110) (-889.803) * (-892.403) (-893.741) (-890.967) [-891.436] -- 0:01:56
      183000 -- (-891.451) [-893.604] (-902.476) (-891.338) * (-901.528) (-893.908) [-893.804] (-889.361) -- 0:01:56
      183500 -- (-889.742) (-892.625) [-892.904] (-890.793) * (-902.696) [-892.279] (-893.517) (-892.820) -- 0:01:55
      184000 -- (-888.994) (-896.914) [-892.087] (-892.932) * (-895.704) (-888.830) (-892.968) [-890.652] -- 0:01:55
      184500 -- (-894.679) (-896.059) (-893.184) [-892.016] * (-895.500) (-893.346) [-891.355] (-892.308) -- 0:01:54
      185000 -- (-891.256) (-897.962) [-895.162] (-892.382) * [-894.464] (-890.317) (-889.844) (-891.890) -- 0:01:54

      Average standard deviation of split frequencies: 0.015207

      185500 -- (-887.759) [-891.010] (-889.262) (-891.422) * (-890.489) (-893.400) [-889.344] (-891.264) -- 0:01:54
      186000 -- (-887.638) [-895.016] (-900.235) (-893.286) * (-892.352) (-891.174) (-891.729) [-890.595] -- 0:01:53
      186500 -- [-890.427] (-891.856) (-895.262) (-896.211) * (-895.395) [-893.506] (-892.431) (-896.235) -- 0:01:53
      187000 -- (-889.042) (-893.530) (-901.189) [-890.710] * (-890.188) (-898.802) (-891.466) [-893.835] -- 0:01:53
      187500 -- (-894.476) [-890.219] (-893.052) (-894.421) * [-897.502] (-888.531) (-887.738) (-890.275) -- 0:01:57
      188000 -- [-894.315] (-898.173) (-896.385) (-895.898) * (-898.216) (-893.213) [-889.122] (-889.561) -- 0:01:56
      188500 -- [-890.583] (-896.965) (-890.332) (-894.151) * [-894.888] (-890.158) (-890.499) (-892.148) -- 0:01:56
      189000 -- (-889.457) [-890.150] (-890.499) (-897.838) * (-895.561) [-888.971] (-889.382) (-893.403) -- 0:01:55
      189500 -- (-890.324) (-888.288) (-892.013) [-898.894] * [-892.859] (-899.440) (-901.051) (-888.037) -- 0:01:55
      190000 -- (-889.754) (-893.711) [-889.296] (-891.866) * (-887.937) (-893.929) (-897.111) [-890.509] -- 0:01:55

      Average standard deviation of split frequencies: 0.012362

      190500 -- (-887.999) (-891.375) [-894.195] (-892.370) * (-890.592) (-895.413) (-893.351) [-886.814] -- 0:01:54
      191000 -- (-891.886) (-889.973) [-893.202] (-891.331) * (-900.320) (-892.675) (-894.197) [-890.834] -- 0:01:54
      191500 -- (-892.525) (-893.895) (-894.422) [-890.365] * (-894.998) (-890.901) [-891.950] (-889.437) -- 0:01:53
      192000 -- (-892.118) [-888.297] (-889.142) (-894.711) * (-892.426) [-888.479] (-890.666) (-893.023) -- 0:01:53
      192500 -- [-896.513] (-890.999) (-889.725) (-894.632) * (-891.255) [-886.542] (-891.820) (-900.006) -- 0:01:53
      193000 -- (-891.410) (-895.371) [-892.199] (-895.128) * (-894.731) [-889.459] (-891.872) (-897.747) -- 0:01:52
      193500 -- (-890.705) (-895.778) [-888.253] (-900.143) * (-893.769) [-888.066] (-894.157) (-895.476) -- 0:01:52
      194000 -- (-889.754) (-897.522) [-890.634] (-893.280) * (-894.627) (-889.888) [-891.630] (-893.525) -- 0:01:52
      194500 -- [-891.890] (-891.660) (-894.249) (-900.190) * (-891.324) (-888.859) [-891.316] (-896.342) -- 0:01:51
      195000 -- (-886.724) (-893.890) (-889.275) [-890.679] * [-894.908] (-890.938) (-891.564) (-894.546) -- 0:01:55

      Average standard deviation of split frequencies: 0.014431

      195500 -- (-892.781) [-891.209] (-891.910) (-889.793) * [-891.767] (-895.099) (-894.987) (-893.609) -- 0:01:55
      196000 -- [-890.863] (-892.225) (-895.581) (-890.443) * (-890.826) (-889.844) [-890.840] (-890.998) -- 0:01:54
      196500 -- (-896.974) (-890.490) (-891.252) [-887.620] * (-890.436) (-893.181) [-892.104] (-890.849) -- 0:01:54
      197000 -- [-890.576] (-896.717) (-891.532) (-888.868) * (-893.173) [-890.512] (-890.022) (-887.074) -- 0:01:54
      197500 -- (-890.393) [-893.850] (-891.394) (-891.995) * (-888.072) [-890.365] (-890.485) (-893.486) -- 0:01:53
      198000 -- (-894.049) (-892.146) (-892.990) [-899.719] * [-892.160] (-889.474) (-890.868) (-895.131) -- 0:01:53
      198500 -- (-892.318) (-896.121) (-894.672) [-892.282] * (-895.420) (-896.565) (-892.174) [-888.935] -- 0:01:53
      199000 -- (-892.279) [-889.195] (-893.783) (-897.264) * (-890.534) (-891.916) [-888.349] (-896.614) -- 0:01:52
      199500 -- (-896.625) [-887.587] (-896.817) (-889.993) * [-890.089] (-894.399) (-891.168) (-901.147) -- 0:01:52
      200000 -- (-892.627) [-893.540] (-889.453) (-886.867) * (-896.179) (-893.588) (-889.661) [-894.943] -- 0:01:51

      Average standard deviation of split frequencies: 0.014095

      200500 -- (-894.229) [-891.989] (-895.418) (-892.755) * [-887.451] (-890.003) (-889.842) (-894.237) -- 0:01:51
      201000 -- (-901.576) (-891.508) [-894.074] (-896.228) * (-888.507) [-888.433] (-891.950) (-892.790) -- 0:01:51
      201500 -- [-890.284] (-894.651) (-895.485) (-894.751) * (-893.657) (-890.348) [-893.776] (-889.681) -- 0:01:50
      202000 -- (-888.123) (-895.309) [-890.488] (-890.164) * [-896.099] (-889.003) (-888.585) (-895.577) -- 0:01:54
      202500 -- (-889.230) [-891.280] (-896.388) (-891.501) * (-891.819) [-889.848] (-891.677) (-887.008) -- 0:01:54
      203000 -- [-889.186] (-896.965) (-894.356) (-890.034) * (-894.254) (-890.466) (-895.190) [-890.500] -- 0:01:53
      203500 -- (-893.429) [-892.526] (-891.332) (-892.080) * (-892.876) (-897.344) [-891.623] (-893.898) -- 0:01:53
      204000 -- (-893.001) (-894.827) [-890.674] (-891.571) * (-893.571) [-890.495] (-891.946) (-895.398) -- 0:01:53
      204500 -- (-895.946) (-894.674) (-889.366) [-890.819] * [-895.224] (-890.035) (-893.104) (-894.674) -- 0:01:52
      205000 -- (-894.624) (-897.132) [-890.317] (-894.031) * (-894.626) (-891.976) [-890.231] (-892.751) -- 0:01:52

      Average standard deviation of split frequencies: 0.011442

      205500 -- [-890.102] (-894.978) (-888.278) (-894.188) * [-890.172] (-893.245) (-889.870) (-895.314) -- 0:01:52
      206000 -- [-892.944] (-889.357) (-892.111) (-890.431) * (-887.722) (-897.779) (-891.266) [-894.542] -- 0:01:51
      206500 -- (-891.142) [-890.224] (-897.947) (-890.635) * (-891.247) (-894.979) [-898.391] (-894.464) -- 0:01:51
      207000 -- (-890.838) [-892.331] (-897.735) (-889.575) * (-897.971) (-899.623) [-892.353] (-898.787) -- 0:01:51
      207500 -- (-894.313) [-888.814] (-893.104) (-889.824) * [-893.574] (-897.085) (-893.582) (-891.150) -- 0:01:50
      208000 -- [-893.757] (-892.406) (-892.070) (-890.028) * [-890.072] (-894.547) (-892.799) (-893.443) -- 0:01:50
      208500 -- (-895.419) (-893.674) [-892.213] (-891.210) * [-889.443] (-894.303) (-890.525) (-889.504) -- 0:01:50
      209000 -- [-900.274] (-892.092) (-895.869) (-893.877) * (-895.082) (-889.911) [-891.959] (-899.183) -- 0:01:53
      209500 -- [-896.578] (-889.227) (-894.162) (-895.617) * [-891.964] (-890.029) (-894.101) (-893.095) -- 0:01:53
      210000 -- (-893.546) (-886.992) [-891.824] (-894.517) * (-893.650) (-892.096) (-890.366) [-894.234] -- 0:01:52

      Average standard deviation of split frequencies: 0.008951

      210500 -- (-897.419) (-894.934) (-894.687) [-890.135] * [-888.859] (-895.509) (-897.305) (-889.909) -- 0:01:52
      211000 -- [-893.162] (-890.963) (-891.287) (-891.788) * [-891.145] (-891.328) (-897.268) (-894.328) -- 0:01:52
      211500 -- (-889.714) [-891.411] (-891.010) (-894.444) * (-888.726) [-888.746] (-901.629) (-896.363) -- 0:01:51
      212000 -- [-894.008] (-899.496) (-898.915) (-888.885) * (-890.870) (-891.299) [-893.937] (-891.750) -- 0:01:51
      212500 -- [-890.978] (-894.047) (-892.639) (-888.711) * (-892.691) [-891.262] (-896.588) (-893.931) -- 0:01:51
      213000 -- (-893.670) (-895.187) [-889.075] (-888.453) * [-889.226] (-890.352) (-893.066) (-894.652) -- 0:01:50
      213500 -- [-891.665] (-891.395) (-887.524) (-890.889) * [-891.807] (-888.089) (-898.210) (-893.377) -- 0:01:50
      214000 -- (-890.271) (-893.935) [-887.165] (-889.883) * (-894.974) (-892.058) (-897.135) [-892.406] -- 0:01:50
      214500 -- [-891.443] (-896.826) (-894.139) (-897.217) * [-890.225] (-890.448) (-894.531) (-889.068) -- 0:01:49
      215000 -- (-896.120) (-893.159) [-894.145] (-897.760) * (-889.999) (-891.730) (-898.487) [-889.706] -- 0:01:49

      Average standard deviation of split frequencies: 0.008730

      215500 -- (-894.953) (-897.774) (-888.762) [-893.954] * [-889.644] (-893.833) (-900.752) (-894.529) -- 0:01:49
      216000 -- [-890.895] (-893.782) (-893.342) (-890.574) * [-889.622] (-889.074) (-895.208) (-895.162) -- 0:01:52
      216500 -- (-895.798) (-890.538) [-890.005] (-891.427) * (-893.330) (-895.406) (-899.613) [-891.054] -- 0:01:52
      217000 -- (-892.248) [-890.950] (-890.207) (-890.737) * (-888.453) [-889.317] (-897.744) (-894.597) -- 0:01:51
      217500 -- (-894.588) (-890.356) (-894.739) [-890.097] * (-890.286) (-890.846) (-890.618) [-889.939] -- 0:01:51
      218000 -- (-898.622) (-894.865) [-890.425] (-889.160) * (-889.252) [-894.976] (-891.671) (-891.808) -- 0:01:51
      218500 -- (-891.272) (-889.755) [-890.679] (-890.214) * (-894.654) [-890.773] (-898.866) (-891.292) -- 0:01:50
      219000 -- (-892.939) [-891.167] (-890.751) (-889.906) * (-890.321) (-892.739) [-896.370] (-896.176) -- 0:01:50
      219500 -- (-895.057) (-890.702) (-889.891) [-891.810] * (-889.873) (-890.372) (-893.086) [-891.593] -- 0:01:50
      220000 -- (-891.070) (-896.231) [-890.281] (-889.388) * (-899.419) (-891.209) (-893.631) [-889.547] -- 0:01:49

      Average standard deviation of split frequencies: 0.008545

      220500 -- (-894.245) (-891.897) (-890.422) [-890.174] * (-892.571) [-889.074] (-891.557) (-890.695) -- 0:01:49
      221000 -- [-892.600] (-896.376) (-891.617) (-893.618) * (-893.359) [-888.446] (-893.976) (-892.296) -- 0:01:49
      221500 -- (-891.404) [-891.041] (-887.757) (-896.982) * (-891.896) (-894.069) (-895.311) [-891.017] -- 0:01:48
      222000 -- (-896.765) (-888.880) [-891.750] (-899.990) * (-888.113) [-889.602] (-898.704) (-896.132) -- 0:01:48
      222500 -- (-895.985) (-893.427) [-889.989] (-894.170) * (-888.094) (-893.223) [-890.391] (-890.912) -- 0:01:48
      223000 -- (-896.566) (-890.433) (-892.259) [-893.631] * (-893.026) (-891.825) (-891.851) [-893.173] -- 0:01:51
      223500 -- (-889.852) (-893.452) [-890.067] (-892.135) * (-891.257) (-899.475) [-901.911] (-893.277) -- 0:01:51
      224000 -- (-888.625) [-893.059] (-897.132) (-889.086) * (-891.384) (-893.322) [-889.687] (-892.519) -- 0:01:50
      224500 -- (-898.443) (-889.545) [-895.910] (-890.715) * (-891.463) (-890.780) [-888.907] (-889.747) -- 0:01:50
      225000 -- (-892.132) (-891.707) (-891.024) [-889.935] * (-887.591) [-891.236] (-887.822) (-891.757) -- 0:01:50

      Average standard deviation of split frequencies: 0.006258

      225500 -- (-898.232) (-893.268) (-891.357) [-890.122] * (-893.421) [-889.360] (-887.744) (-897.423) -- 0:01:49
      226000 -- (-893.044) (-888.266) [-895.857] (-889.992) * (-894.161) [-894.958] (-891.290) (-905.052) -- 0:01:49
      226500 -- [-888.634] (-892.081) (-893.963) (-891.235) * [-894.221] (-894.915) (-895.793) (-894.910) -- 0:01:49
      227000 -- (-890.249) (-891.379) (-893.945) [-892.681] * (-892.688) [-895.644] (-890.353) (-900.345) -- 0:01:48
      227500 -- (-896.123) [-895.396] (-889.239) (-892.659) * (-894.033) (-891.633) [-890.952] (-898.508) -- 0:01:48
      228000 -- (-890.350) (-891.869) [-892.095] (-895.871) * [-888.876] (-889.598) (-903.470) (-909.310) -- 0:01:48
      228500 -- (-891.495) (-896.777) [-888.476] (-898.325) * [-889.623] (-892.138) (-896.022) (-897.857) -- 0:01:48
      229000 -- (-891.210) [-896.157] (-891.957) (-894.585) * [-888.774] (-891.994) (-895.056) (-894.108) -- 0:01:47
      229500 -- (-890.420) [-894.908] (-896.336) (-891.907) * (-886.871) (-889.058) (-897.673) [-895.938] -- 0:01:47
      230000 -- (-898.409) [-894.779] (-892.111) (-891.198) * [-890.221] (-890.793) (-893.793) (-893.439) -- 0:01:50

      Average standard deviation of split frequencies: 0.008175

      230500 -- [-896.212] (-895.310) (-897.321) (-892.789) * (-889.962) (-891.213) [-895.702] (-893.748) -- 0:01:50
      231000 -- [-893.582] (-895.799) (-895.107) (-893.000) * [-888.441] (-891.144) (-890.535) (-893.044) -- 0:01:49
      231500 -- (-892.942) (-891.136) (-895.924) [-892.063] * [-895.487] (-891.088) (-888.252) (-895.641) -- 0:01:49
      232000 -- (-894.326) [-887.160] (-900.423) (-891.560) * [-888.560] (-899.105) (-888.387) (-894.281) -- 0:01:49
      232500 -- (-897.359) (-891.212) (-895.203) [-894.794] * (-894.598) (-900.831) (-892.768) [-896.433] -- 0:01:48
      233000 -- [-888.948] (-893.922) (-900.419) (-894.141) * (-892.185) (-892.686) (-889.074) [-891.950] -- 0:01:48
      233500 -- [-896.128] (-892.574) (-895.701) (-890.404) * (-887.756) (-895.799) [-889.070] (-893.535) -- 0:01:48
      234000 -- (-886.628) [-890.415] (-895.645) (-891.335) * (-893.057) (-896.415) [-892.361] (-890.388) -- 0:01:48
      234500 -- [-889.356] (-895.476) (-896.540) (-895.529) * [-892.183] (-894.623) (-889.736) (-891.119) -- 0:01:47
      235000 -- [-892.318] (-890.026) (-893.079) (-892.299) * (-891.931) (-888.257) (-892.114) [-892.958] -- 0:01:47

      Average standard deviation of split frequencies: 0.005992

      235500 -- (-898.629) [-895.632] (-894.969) (-891.788) * (-893.462) (-891.610) [-892.814] (-889.120) -- 0:01:47
      236000 -- [-889.634] (-890.238) (-889.101) (-890.161) * (-895.088) [-889.381] (-891.139) (-890.164) -- 0:01:46
      236500 -- (-893.578) [-889.386] (-889.195) (-887.352) * [-892.341] (-891.539) (-891.739) (-892.355) -- 0:01:46
      237000 -- (-889.157) (-890.089) [-890.570] (-894.893) * (-891.165) (-889.336) (-892.026) [-887.717] -- 0:01:46
      237500 -- [-893.112] (-889.217) (-892.636) (-890.153) * (-887.783) [-894.579] (-891.892) (-891.769) -- 0:01:49
      238000 -- (-892.992) (-889.342) [-888.714] (-901.889) * [-890.208] (-892.608) (-889.736) (-890.184) -- 0:01:48
      238500 -- (-889.206) (-888.237) [-892.122] (-893.631) * [-888.500] (-892.947) (-888.962) (-896.997) -- 0:01:48
      239000 -- (-891.631) (-889.378) [-886.700] (-889.287) * (-891.455) [-894.394] (-888.691) (-890.420) -- 0:01:48
      239500 -- (-893.488) (-888.907) [-889.444] (-893.005) * [-891.404] (-890.401) (-890.760) (-892.956) -- 0:01:47
      240000 -- (-893.696) (-894.793) (-891.645) [-893.327] * (-888.823) [-890.115] (-889.615) (-897.883) -- 0:01:47

      Average standard deviation of split frequencies: 0.007835

      240500 -- (-897.929) (-893.478) (-890.145) [-896.801] * (-890.919) [-891.226] (-890.690) (-892.965) -- 0:01:47
      241000 -- (-896.446) (-892.474) [-889.428] (-890.124) * (-888.602) (-892.862) [-891.955] (-888.067) -- 0:01:47
      241500 -- (-897.408) (-888.442) [-888.687] (-892.627) * [-891.292] (-893.501) (-892.108) (-888.154) -- 0:01:46
      242000 -- [-898.087] (-890.506) (-893.857) (-898.350) * (-892.214) (-896.525) (-891.022) [-890.457] -- 0:01:46
      242500 -- [-891.007] (-890.239) (-891.257) (-897.801) * (-890.007) (-888.531) [-887.565] (-888.337) -- 0:01:46
      243000 -- [-891.214] (-888.908) (-889.457) (-893.086) * (-889.783) [-890.529] (-890.544) (-889.941) -- 0:01:45
      243500 -- (-893.817) [-892.408] (-892.670) (-891.162) * [-894.541] (-888.776) (-891.831) (-894.865) -- 0:01:45
      244000 -- (-890.694) [-890.084] (-898.017) (-893.199) * (-891.059) (-891.977) [-888.825] (-893.360) -- 0:01:45
      244500 -- (-888.059) (-892.637) (-891.691) [-891.208] * [-890.465] (-896.768) (-888.835) (-892.243) -- 0:01:48
      245000 -- (-891.170) (-890.784) (-891.641) [-893.536] * (-888.861) [-892.873] (-891.497) (-896.860) -- 0:01:47

      Average standard deviation of split frequencies: 0.007665

      245500 -- (-889.937) (-895.256) [-890.180] (-895.012) * (-892.210) (-893.952) [-894.916] (-893.895) -- 0:01:47
      246000 -- (-892.759) [-890.254] (-891.283) (-893.142) * (-894.165) (-895.602) (-892.525) [-889.733] -- 0:01:47
      246500 -- (-891.276) [-890.052] (-898.595) (-892.252) * [-891.474] (-889.663) (-891.724) (-888.765) -- 0:01:46
      247000 -- [-896.877] (-895.760) (-889.166) (-896.222) * (-890.622) [-892.293] (-893.872) (-893.463) -- 0:01:46
      247500 -- (-894.247) (-896.072) [-891.582] (-893.578) * (-888.634) [-894.145] (-894.560) (-898.282) -- 0:01:46
      248000 -- (-889.920) (-888.195) [-891.872] (-891.071) * (-889.353) (-894.376) [-892.835] (-900.064) -- 0:01:46
      248500 -- (-893.400) (-891.769) (-890.684) [-892.029] * (-889.187) [-890.536] (-889.557) (-891.009) -- 0:01:45
      249000 -- (-890.942) [-890.612] (-894.690) (-890.200) * [-890.944] (-889.796) (-892.424) (-891.811) -- 0:01:45
      249500 -- (-897.514) (-890.870) (-890.621) [-886.462] * (-890.205) (-894.418) (-894.743) [-889.250] -- 0:01:45
      250000 -- (-890.840) (-888.427) (-895.868) [-889.188] * (-890.300) (-901.007) (-897.926) [-890.028] -- 0:01:44

      Average standard deviation of split frequencies: 0.005642

      250500 -- (-893.177) (-886.798) (-891.923) [-892.608] * [-891.063] (-896.138) (-894.332) (-893.774) -- 0:01:44
      251000 -- (-886.860) (-896.270) [-888.751] (-891.252) * (-897.374) [-891.100] (-894.618) (-890.902) -- 0:01:44
      251500 -- (-892.601) [-890.157] (-892.032) (-896.230) * [-889.224] (-893.853) (-892.669) (-893.418) -- 0:01:47
      252000 -- (-889.803) (-889.358) [-887.093] (-893.802) * [-889.633] (-895.029) (-891.787) (-890.104) -- 0:01:46
      252500 -- (-889.244) (-892.758) (-891.373) [-892.958] * [-891.113] (-896.790) (-893.504) (-890.111) -- 0:01:46
      253000 -- [-897.438] (-898.812) (-896.074) (-890.136) * (-889.765) (-895.866) (-889.855) [-888.612] -- 0:01:46
      253500 -- (-896.213) (-898.298) [-896.462] (-892.591) * (-891.077) (-894.127) [-889.518] (-894.238) -- 0:01:46
      254000 -- [-889.802] (-891.506) (-892.185) (-895.058) * (-887.647) (-893.661) (-887.001) [-890.641] -- 0:01:45
      254500 -- (-891.232) (-890.659) [-888.853] (-892.954) * (-893.776) (-901.864) (-898.238) [-893.786] -- 0:01:45
      255000 -- (-897.351) (-892.707) [-888.899] (-892.441) * [-888.801] (-899.622) (-894.193) (-893.809) -- 0:01:45

      Average standard deviation of split frequencies: 0.009207

      255500 -- (-888.456) (-889.237) [-887.689] (-892.066) * (-892.371) (-892.755) [-891.919] (-899.926) -- 0:01:44
      256000 -- (-890.612) (-893.804) (-891.749) [-888.987] * (-894.715) (-891.842) [-891.158] (-892.820) -- 0:01:44
      256500 -- (-895.030) (-891.417) (-890.874) [-895.097] * (-894.815) [-893.164] (-893.300) (-889.034) -- 0:01:44
      257000 -- (-890.206) (-887.738) [-891.846] (-898.772) * (-887.733) [-903.768] (-890.715) (-896.163) -- 0:01:44
      257500 -- [-891.674] (-887.303) (-892.761) (-899.601) * (-891.661) (-895.619) [-896.756] (-896.379) -- 0:01:43
      258000 -- (-889.696) (-890.758) [-888.806] (-897.180) * (-892.947) (-895.727) (-890.500) [-888.210] -- 0:01:43
      258500 -- [-891.885] (-894.120) (-890.067) (-893.127) * (-890.213) [-894.290] (-888.019) (-895.974) -- 0:01:46
      259000 -- (-893.846) (-897.505) [-891.700] (-894.424) * (-893.140) (-896.198) [-888.629] (-897.121) -- 0:01:45
      259500 -- (-892.302) [-890.092] (-893.672) (-890.184) * (-893.378) (-893.957) [-891.618] (-892.719) -- 0:01:45
      260000 -- (-895.152) (-889.799) (-894.424) [-891.457] * (-886.763) (-888.734) [-891.974] (-890.757) -- 0:01:45

      Average standard deviation of split frequencies: 0.007234

      260500 -- (-891.709) [-888.235] (-893.315) (-889.955) * [-892.960] (-888.588) (-892.612) (-892.831) -- 0:01:45
      261000 -- [-894.436] (-890.894) (-895.372) (-895.564) * (-890.759) (-889.517) [-888.321] (-892.629) -- 0:01:44
      261500 -- (-891.793) (-889.981) [-892.683] (-893.229) * (-895.007) (-895.193) (-889.034) [-901.452] -- 0:01:44
      262000 -- [-901.004] (-887.205) (-894.536) (-895.241) * (-894.731) (-893.082) [-890.695] (-892.292) -- 0:01:44
      262500 -- (-900.705) (-899.372) [-890.774] (-893.869) * (-887.324) [-895.873] (-896.144) (-893.442) -- 0:01:43
      263000 -- [-892.975] (-889.585) (-890.910) (-890.785) * [-893.212] (-893.477) (-891.460) (-891.142) -- 0:01:43
      263500 -- [-890.273] (-890.584) (-887.979) (-899.051) * (-891.625) (-891.005) [-891.814] (-893.078) -- 0:01:43
      264000 -- (-889.444) [-890.561] (-891.100) (-894.343) * (-887.826) (-894.414) (-890.792) [-888.410] -- 0:01:43
      264500 -- [-890.594] (-888.528) (-892.550) (-890.278) * [-888.864] (-889.331) (-895.930) (-892.776) -- 0:01:42
      265000 -- (-894.087) (-892.491) [-891.718] (-890.993) * (-891.442) [-891.557] (-895.772) (-893.249) -- 0:01:42

      Average standard deviation of split frequencies: 0.007089

      265500 -- (-894.705) (-890.556) (-889.859) [-891.044] * (-895.392) [-891.005] (-892.407) (-892.315) -- 0:01:45
      266000 -- [-894.509] (-886.900) (-889.605) (-892.915) * (-893.448) (-901.866) [-893.075] (-896.235) -- 0:01:44
      266500 -- (-889.925) (-892.418) (-890.730) [-889.948] * (-889.425) (-892.078) (-894.193) [-893.553] -- 0:01:44
      267000 -- (-899.322) (-891.855) [-889.830] (-889.246) * (-890.311) (-895.216) [-891.593] (-899.080) -- 0:01:44
      267500 -- (-894.707) (-895.783) (-887.404) [-888.692] * [-889.106] (-893.712) (-899.812) (-890.891) -- 0:01:44
      268000 -- (-892.798) [-899.641] (-889.429) (-889.725) * (-888.540) (-894.109) (-889.597) [-892.171] -- 0:01:43
      268500 -- (-894.145) (-894.015) [-891.773] (-891.698) * (-897.685) (-895.095) (-889.439) [-891.803] -- 0:01:43
      269000 -- (-887.097) [-889.600] (-890.736) (-888.085) * (-895.495) (-895.139) (-889.507) [-895.872] -- 0:01:43
      269500 -- [-893.536] (-895.408) (-894.844) (-890.566) * (-895.437) (-900.628) (-890.132) [-893.875] -- 0:01:43
      270000 -- (-893.553) (-888.786) (-892.435) [-896.126] * [-891.494] (-896.344) (-892.601) (-897.223) -- 0:01:42

      Average standard deviation of split frequencies: 0.006967

      270500 -- (-894.331) (-892.133) (-891.818) [-888.359] * [-891.489] (-895.313) (-892.868) (-895.835) -- 0:01:42
      271000 -- (-892.450) [-891.070] (-895.344) (-895.499) * (-890.972) (-897.634) (-893.021) [-894.654] -- 0:01:42
      271500 -- (-895.021) (-895.475) (-891.562) [-889.912] * [-889.361] (-895.713) (-893.623) (-896.690) -- 0:01:41
      272000 -- [-896.551] (-888.647) (-889.788) (-893.230) * [-886.658] (-890.114) (-891.935) (-896.369) -- 0:01:41
      272500 -- (-889.514) (-891.053) (-893.306) [-891.600] * [-892.903] (-892.954) (-893.345) (-892.766) -- 0:01:44
      273000 -- (-895.539) [-888.334] (-890.673) (-892.589) * (-893.510) (-890.134) [-890.926] (-894.798) -- 0:01:43
      273500 -- (-888.891) (-892.959) (-892.766) [-891.478] * (-894.327) (-891.006) (-893.808) [-887.129] -- 0:01:43
      274000 -- (-890.428) [-892.869] (-889.343) (-889.716) * (-890.419) [-893.116] (-893.962) (-897.145) -- 0:01:43
      274500 -- [-890.028] (-891.888) (-895.089) (-890.578) * (-903.837) (-893.356) (-890.153) [-894.487] -- 0:01:43
      275000 -- (-891.591) [-893.198] (-892.316) (-899.320) * (-899.220) [-892.399] (-892.606) (-889.444) -- 0:01:42

      Average standard deviation of split frequencies: 0.008540

      275500 -- (-890.928) [-892.139] (-891.733) (-895.180) * (-892.954) (-895.392) (-893.508) [-890.479] -- 0:01:42
      276000 -- [-890.559] (-895.218) (-891.773) (-891.394) * (-892.834) (-892.176) (-893.940) [-893.024] -- 0:01:42
      276500 -- (-891.434) [-896.388] (-889.828) (-890.711) * (-889.682) (-895.517) (-893.133) [-895.890] -- 0:01:42
      277000 -- [-893.769] (-891.947) (-893.983) (-892.306) * [-887.280] (-895.508) (-888.751) (-892.833) -- 0:01:41
      277500 -- (-891.806) (-895.878) (-894.853) [-892.661] * (-891.649) (-887.757) [-888.195] (-893.947) -- 0:01:41
      278000 -- [-892.558] (-891.757) (-891.581) (-895.610) * (-886.805) (-889.649) [-894.575] (-891.950) -- 0:01:41
      278500 -- (-888.949) (-893.965) [-890.038] (-891.639) * (-889.009) (-895.350) (-897.908) [-892.617] -- 0:01:41
      279000 -- [-891.077] (-888.679) (-891.550) (-892.030) * (-900.058) [-893.903] (-896.283) (-889.596) -- 0:01:40
      279500 -- (-892.183) [-888.973] (-891.168) (-892.738) * (-892.722) (-893.117) [-894.984] (-889.304) -- 0:01:43
      280000 -- (-897.363) (-887.577) (-889.021) [-888.053] * (-890.479) (-890.748) [-896.916] (-891.746) -- 0:01:42

      Average standard deviation of split frequencies: 0.006718

      280500 -- [-893.057] (-890.842) (-892.688) (-887.846) * (-890.778) [-894.567] (-893.514) (-889.578) -- 0:01:42
      281000 -- (-895.335) (-892.746) [-891.165] (-891.264) * [-892.156] (-894.114) (-889.344) (-893.072) -- 0:01:42
      281500 -- (-892.070) (-895.277) (-889.870) [-891.885] * [-889.135] (-891.089) (-891.221) (-893.555) -- 0:01:42
      282000 -- [-889.958] (-894.436) (-890.494) (-887.620) * (-891.812) [-888.277] (-889.887) (-898.327) -- 0:01:41
      282500 -- [-896.630] (-892.462) (-890.768) (-892.479) * [-888.445] (-891.285) (-889.127) (-895.908) -- 0:01:41
      283000 -- (-896.677) (-891.589) (-895.408) [-896.557] * (-891.726) (-890.318) [-892.527] (-894.057) -- 0:01:41
      283500 -- [-890.630] (-894.355) (-894.693) (-890.962) * [-891.883] (-898.289) (-894.420) (-897.653) -- 0:01:41
      284000 -- [-891.506] (-890.773) (-894.774) (-888.890) * [-889.994] (-894.251) (-896.598) (-890.827) -- 0:01:40
      284500 -- (-891.218) [-892.380] (-892.681) (-889.972) * [-893.220] (-892.694) (-890.772) (-891.193) -- 0:01:40
      285000 -- (-890.500) (-889.350) [-892.160] (-896.074) * (-889.642) (-892.510) (-892.317) [-890.992] -- 0:01:40

      Average standard deviation of split frequencies: 0.008241

      285500 -- (-893.538) [-891.842] (-894.989) (-890.787) * (-893.096) [-892.005] (-889.812) (-889.004) -- 0:01:40
      286000 -- (-889.135) (-887.530) [-894.020] (-893.434) * (-892.230) (-890.406) (-894.366) [-891.820] -- 0:01:39
      286500 -- (-895.754) (-896.188) [-888.164] (-889.342) * (-894.885) (-891.188) [-889.970] (-886.976) -- 0:01:42
      287000 -- [-894.506] (-893.289) (-888.357) (-888.569) * (-892.641) (-892.659) (-894.105) [-890.628] -- 0:01:41
      287500 -- (-902.592) (-894.522) (-895.848) [-890.467] * (-889.552) [-890.667] (-896.563) (-892.067) -- 0:01:41
      288000 -- (-892.356) (-894.564) (-898.756) [-893.312] * [-893.914] (-890.655) (-898.465) (-895.753) -- 0:01:41
      288500 -- [-890.255] (-896.838) (-894.950) (-900.408) * (-891.633) (-891.650) [-892.219] (-896.177) -- 0:01:41
      289000 -- (-889.461) (-892.870) [-894.963] (-889.114) * (-889.500) (-888.863) [-895.979] (-894.048) -- 0:01:40
      289500 -- [-891.300] (-887.179) (-892.519) (-894.652) * (-891.656) (-895.083) [-891.390] (-894.602) -- 0:01:40
      290000 -- (-887.621) (-893.550) [-891.446] (-889.974) * (-892.865) (-889.515) [-896.559] (-895.625) -- 0:01:40

      Average standard deviation of split frequencies: 0.006487

      290500 -- (-893.716) (-892.103) [-890.281] (-888.759) * [-889.096] (-889.126) (-897.262) (-892.651) -- 0:01:40
      291000 -- (-890.871) [-890.767] (-891.590) (-896.992) * [-890.471] (-890.533) (-896.952) (-896.090) -- 0:01:39
      291500 -- [-886.797] (-897.483) (-898.817) (-899.088) * [-888.895] (-894.934) (-889.797) (-894.046) -- 0:01:39
      292000 -- (-891.083) (-889.110) (-892.876) [-888.545] * (-897.591) [-890.967] (-891.894) (-895.153) -- 0:01:39
      292500 -- (-891.827) [-892.440] (-892.467) (-890.881) * (-893.113) (-891.350) [-896.474] (-890.869) -- 0:01:39
      293000 -- (-893.704) (-892.936) (-894.098) [-893.934] * [-892.718] (-894.244) (-892.707) (-891.835) -- 0:01:38
      293500 -- (-893.253) (-892.440) [-892.417] (-899.663) * (-890.286) [-889.571] (-895.461) (-897.924) -- 0:01:41
      294000 -- (-891.706) (-892.233) [-889.256] (-894.942) * [-891.916] (-889.719) (-894.798) (-897.062) -- 0:01:40
      294500 -- (-888.079) [-892.434] (-890.862) (-895.485) * (-890.740) (-889.631) (-896.843) [-893.085] -- 0:01:40
      295000 -- (-890.449) [-890.565] (-893.277) (-891.798) * (-891.727) (-900.820) (-890.852) [-888.811] -- 0:01:40

      Average standard deviation of split frequencies: 0.007963

      295500 -- (-890.127) (-897.202) [-894.701] (-890.086) * (-891.488) (-894.063) [-892.478] (-892.143) -- 0:01:40
      296000 -- (-893.581) (-895.102) (-892.430) [-890.367] * (-890.183) [-893.017] (-892.217) (-893.885) -- 0:01:39
      296500 -- (-893.966) (-894.361) [-888.889] (-888.946) * (-893.998) [-897.036] (-891.855) (-889.456) -- 0:01:39
      297000 -- [-889.719] (-893.670) (-892.661) (-892.440) * [-889.576] (-890.858) (-891.880) (-894.573) -- 0:01:39
      297500 -- (-892.223) (-890.976) [-889.967] (-893.578) * [-892.181] (-890.720) (-891.268) (-892.477) -- 0:01:39
      298000 -- (-893.951) (-890.435) [-895.670] (-892.831) * [-889.488] (-894.118) (-894.830) (-893.313) -- 0:01:38
      298500 -- (-890.500) (-888.104) [-888.682] (-890.806) * (-893.446) (-893.969) [-892.419] (-896.515) -- 0:01:38
      299000 -- (-895.471) (-889.983) [-890.587] (-888.825) * [-892.341] (-897.481) (-892.596) (-896.607) -- 0:01:38
      299500 -- (-889.647) (-893.342) (-887.692) [-891.129] * (-897.638) [-892.332] (-891.442) (-898.192) -- 0:01:38
      300000 -- [-895.421] (-890.014) (-887.127) (-897.203) * (-891.392) [-890.850] (-896.713) (-890.424) -- 0:01:37

      Average standard deviation of split frequencies: 0.004704

      300500 -- [-888.793] (-892.679) (-891.787) (-897.263) * (-892.686) (-889.901) [-893.976] (-891.110) -- 0:01:40
      301000 -- [-892.102] (-890.150) (-897.731) (-894.917) * (-895.446) [-892.054] (-894.768) (-893.331) -- 0:01:39
      301500 -- (-892.822) (-895.191) (-890.367) [-890.176] * (-898.139) [-891.244] (-897.090) (-892.429) -- 0:01:39
      302000 -- (-891.111) (-889.838) [-889.348] (-892.434) * (-896.224) (-893.048) (-890.607) [-890.981] -- 0:01:39
      302500 -- [-891.243] (-890.572) (-889.943) (-893.238) * (-888.135) (-893.848) [-890.753] (-891.043) -- 0:01:39
      303000 -- (-896.551) [-891.622] (-898.338) (-897.171) * (-897.858) [-893.054] (-892.158) (-888.557) -- 0:01:38
      303500 -- (-892.389) (-899.617) (-889.072) [-892.426] * (-893.512) (-890.475) (-896.535) [-890.801] -- 0:01:38
      304000 -- [-893.110] (-892.332) (-894.881) (-892.823) * (-895.452) [-889.173] (-893.695) (-889.097) -- 0:01:38
      304500 -- (-892.072) (-897.550) (-896.366) [-891.445] * [-890.338] (-890.873) (-895.188) (-893.854) -- 0:01:38
      305000 -- (-892.362) [-892.257] (-897.430) (-893.728) * (-892.498) (-890.848) [-892.818] (-891.640) -- 0:01:37

      Average standard deviation of split frequencies: 0.004622

      305500 -- (-890.429) [-888.116] (-895.669) (-892.001) * (-891.526) (-891.220) (-889.249) [-898.289] -- 0:01:37
      306000 -- [-890.973] (-892.908) (-893.520) (-898.247) * (-892.504) [-891.852] (-896.589) (-889.782) -- 0:01:37
      306500 -- (-891.065) [-890.899] (-896.750) (-894.097) * (-893.704) (-893.667) (-895.912) [-891.517] -- 0:01:37
      307000 -- (-893.218) (-892.662) (-892.086) [-892.528] * (-890.712) [-889.707] (-894.398) (-891.234) -- 0:01:37
      307500 -- (-891.193) [-890.623] (-891.351) (-891.106) * (-891.193) (-892.002) (-895.229) [-888.315] -- 0:01:39
      308000 -- (-893.156) [-890.203] (-897.872) (-893.110) * [-891.685] (-896.982) (-891.268) (-891.180) -- 0:01:38
      308500 -- (-892.381) (-889.577) [-891.533] (-897.408) * (-894.857) (-892.231) [-893.094] (-890.224) -- 0:01:38
      309000 -- (-893.880) [-891.169] (-892.090) (-891.711) * (-889.225) (-889.463) (-893.637) [-891.946] -- 0:01:38
      309500 -- (-894.607) [-892.549] (-892.171) (-899.746) * (-889.774) [-893.113] (-887.618) (-896.828) -- 0:01:38
      310000 -- (-892.649) [-890.814] (-893.633) (-906.479) * (-890.854) (-891.677) (-889.505) [-893.767] -- 0:01:37

      Average standard deviation of split frequencies: 0.001517

      310500 -- (-886.636) (-890.726) [-892.926] (-898.850) * (-889.155) (-890.239) [-890.482] (-894.673) -- 0:01:37
      311000 -- (-890.774) [-892.292] (-893.067) (-891.630) * (-891.257) (-895.938) [-890.824] (-888.938) -- 0:01:37
      311500 -- (-896.512) (-891.208) [-893.303] (-894.387) * (-894.303) (-899.115) (-894.016) [-894.619] -- 0:01:37
      312000 -- [-890.660] (-892.112) (-888.228) (-893.685) * [-887.961] (-892.123) (-891.150) (-892.606) -- 0:01:37
      312500 -- (-893.175) [-889.091] (-892.137) (-890.403) * (-890.485) (-890.123) (-889.878) [-890.874] -- 0:01:36
      313000 -- (-889.343) (-893.044) (-891.339) [-891.760] * [-892.764] (-890.057) (-889.844) (-893.060) -- 0:01:36
      313500 -- (-890.856) (-889.394) (-889.764) [-889.858] * (-895.171) [-890.931] (-894.994) (-890.712) -- 0:01:36
      314000 -- [-888.184] (-893.793) (-889.310) (-893.702) * (-900.407) [-892.606] (-887.507) (-892.352) -- 0:01:36
      314500 -- (-890.630) (-889.086) [-890.009] (-893.846) * (-901.472) (-888.279) (-893.376) [-890.463] -- 0:01:38
      315000 -- (-900.303) [-893.951] (-894.316) (-890.882) * (-895.489) (-891.181) (-893.706) [-891.030] -- 0:01:37

      Average standard deviation of split frequencies: 0.001492

      315500 -- (-893.337) [-895.174] (-889.379) (-889.779) * (-895.762) [-891.657] (-896.394) (-892.053) -- 0:01:37
      316000 -- [-890.815] (-894.544) (-892.455) (-893.451) * (-889.370) (-891.316) (-890.003) [-891.887] -- 0:01:37
      316500 -- (-888.680) (-890.318) [-895.644] (-893.693) * (-892.081) [-888.941] (-890.268) (-892.973) -- 0:01:37
      317000 -- (-888.734) [-893.005] (-891.151) (-892.746) * (-894.176) [-892.348] (-890.522) (-887.799) -- 0:01:36
      317500 -- (-891.187) [-893.444] (-894.944) (-889.607) * (-891.348) (-891.852) [-892.597] (-892.751) -- 0:01:36
      318000 -- (-891.670) (-897.007) [-892.624] (-893.264) * (-889.071) (-894.383) [-891.532] (-892.766) -- 0:01:36
      318500 -- (-891.271) (-893.325) (-889.229) [-889.910] * (-891.297) [-890.983] (-890.416) (-890.885) -- 0:01:36
      319000 -- (-893.670) [-894.576] (-889.831) (-891.619) * [-893.080] (-891.596) (-894.119) (-891.089) -- 0:01:36
      319500 -- [-894.577] (-890.486) (-888.194) (-895.100) * (-890.892) [-889.651] (-895.161) (-893.356) -- 0:01:35
      320000 -- (-899.090) [-895.217] (-887.342) (-891.949) * (-893.528) [-892.305] (-890.853) (-894.944) -- 0:01:35

      Average standard deviation of split frequencies: 0.001470

      320500 -- (-891.350) (-890.022) (-889.640) [-897.259] * (-897.924) (-891.956) [-890.060] (-890.328) -- 0:01:35
      321000 -- [-892.149] (-888.259) (-891.367) (-891.902) * (-895.023) (-892.256) [-888.161] (-893.231) -- 0:01:35
      321500 -- (-896.259) (-893.562) (-889.408) [-889.630] * (-895.230) (-886.994) [-891.663] (-890.576) -- 0:01:37
      322000 -- [-889.206] (-894.171) (-888.636) (-890.373) * (-889.877) [-894.169] (-888.929) (-890.969) -- 0:01:36
      322500 -- (-890.510) (-895.729) [-891.245] (-889.677) * (-888.324) (-894.725) [-888.239] (-890.561) -- 0:01:36
      323000 -- [-893.655] (-897.385) (-889.331) (-892.952) * (-896.538) [-893.482] (-890.422) (-892.729) -- 0:01:36
      323500 -- (-891.130) [-891.002] (-888.410) (-887.586) * (-891.397) [-891.644] (-895.794) (-894.144) -- 0:01:36
      324000 -- (-894.841) (-893.349) [-891.956] (-892.058) * (-893.081) (-893.668) [-892.258] (-887.633) -- 0:01:35
      324500 -- (-892.662) (-889.398) (-890.150) [-888.167] * (-907.349) (-897.447) [-893.923] (-890.369) -- 0:01:35
      325000 -- (-894.642) (-891.868) [-891.907] (-894.743) * (-893.610) (-896.829) (-891.490) [-888.932] -- 0:01:35

      Average standard deviation of split frequencies: 0.002892

      325500 -- (-896.774) [-890.483] (-889.332) (-894.532) * (-893.801) [-893.827] (-894.404) (-895.134) -- 0:01:35
      326000 -- (-892.684) [-893.510] (-888.695) (-892.523) * (-898.127) (-894.832) (-888.869) [-888.773] -- 0:01:35
      326500 -- (-889.806) (-891.032) (-891.236) [-889.635] * (-891.979) (-895.198) (-887.325) [-895.840] -- 0:01:34
      327000 -- (-890.762) [-888.750] (-891.224) (-891.333) * (-893.642) [-889.114] (-892.051) (-893.833) -- 0:01:34
      327500 -- (-889.138) (-895.508) [-889.552] (-890.878) * (-894.273) (-892.016) [-888.899] (-893.039) -- 0:01:34
      328000 -- (-891.067) [-890.376] (-891.399) (-894.127) * (-889.734) [-889.729] (-892.400) (-892.219) -- 0:01:34
      328500 -- (-892.142) (-892.681) [-890.793] (-892.572) * [-888.034] (-892.237) (-890.363) (-891.490) -- 0:01:36
      329000 -- [-892.834] (-890.661) (-895.400) (-891.018) * (-892.902) (-889.808) (-894.566) [-887.511] -- 0:01:35
      329500 -- (-893.041) (-893.611) [-890.831] (-891.089) * [-892.901] (-888.745) (-892.794) (-891.841) -- 0:01:35
      330000 -- (-896.169) (-892.480) [-896.535] (-894.223) * (-893.902) (-895.529) (-894.927) [-894.172] -- 0:01:35

      Average standard deviation of split frequencies: 0.004277

      330500 -- (-891.955) (-897.685) [-893.866] (-892.616) * (-890.419) (-891.397) (-894.443) [-899.015] -- 0:01:35
      331000 -- (-890.478) (-891.218) [-894.296] (-894.636) * (-894.129) (-893.601) (-892.536) [-896.032] -- 0:01:34
      331500 -- (-891.173) [-891.403] (-895.430) (-893.593) * (-895.551) (-895.187) [-890.993] (-893.646) -- 0:01:34
      332000 -- (-892.016) [-894.652] (-894.727) (-893.783) * (-899.013) (-893.319) [-894.010] (-893.692) -- 0:01:34
      332500 -- (-892.266) (-891.913) [-893.273] (-890.669) * (-897.511) (-889.646) (-892.284) [-897.605] -- 0:01:34
      333000 -- (-892.596) (-891.028) (-899.126) [-895.480] * (-893.748) [-897.839] (-893.365) (-892.445) -- 0:01:34
      333500 -- (-891.615) (-893.059) [-893.888] (-889.705) * (-894.356) (-895.061) [-893.485] (-893.743) -- 0:01:33
      334000 -- [-890.031] (-904.044) (-900.914) (-895.461) * (-890.925) [-890.057] (-892.848) (-891.055) -- 0:01:33
      334500 -- [-892.231] (-889.287) (-892.840) (-896.740) * (-896.782) (-899.015) [-891.738] (-890.089) -- 0:01:33
      335000 -- [-890.928] (-892.272) (-890.108) (-894.857) * (-891.947) (-889.793) (-890.053) [-887.570] -- 0:01:33

      Average standard deviation of split frequencies: 0.004209

      335500 -- (-888.635) [-890.194] (-891.285) (-892.119) * [-893.390] (-892.554) (-891.646) (-892.050) -- 0:01:35
      336000 -- (-893.659) [-890.578] (-898.074) (-891.398) * (-892.137) (-895.016) (-888.935) [-890.817] -- 0:01:34
      336500 -- (-891.917) [-888.599] (-889.363) (-896.179) * (-892.001) [-890.156] (-894.300) (-891.607) -- 0:01:34
      337000 -- (-892.263) [-890.488] (-891.181) (-891.246) * (-897.038) [-889.712] (-898.255) (-890.971) -- 0:01:34
      337500 -- (-893.684) [-888.313] (-894.035) (-895.151) * [-888.343] (-892.294) (-892.772) (-890.602) -- 0:01:34
      338000 -- (-893.201) [-889.337] (-891.567) (-889.273) * (-895.866) (-893.033) [-889.796] (-888.124) -- 0:01:34
      338500 -- [-893.226] (-889.264) (-894.363) (-888.829) * [-890.464] (-889.213) (-888.471) (-890.243) -- 0:01:33
      339000 -- (-891.652) [-891.682] (-891.246) (-892.109) * (-894.995) (-892.323) (-889.750) [-888.186] -- 0:01:33
      339500 -- (-899.829) (-889.867) [-889.710] (-889.345) * (-892.175) (-891.157) (-892.524) [-890.026] -- 0:01:33
      340000 -- (-896.051) (-891.571) (-897.034) [-886.676] * (-891.861) (-893.272) [-896.128] (-891.580) -- 0:01:33

      Average standard deviation of split frequencies: 0.008303

      340500 -- (-890.891) [-889.452] (-889.364) (-892.439) * (-891.924) (-890.240) [-892.110] (-891.723) -- 0:01:32
      341000 -- (-892.784) [-888.280] (-890.564) (-891.818) * [-893.156] (-893.030) (-891.933) (-890.488) -- 0:01:32
      341500 -- (-895.233) (-888.575) (-891.346) [-893.092] * (-896.813) [-888.481] (-885.318) (-890.781) -- 0:01:32
      342000 -- (-892.129) [-891.845] (-897.414) (-889.860) * (-898.688) (-892.054) (-891.278) [-893.523] -- 0:01:32
      342500 -- (-892.033) (-897.764) (-890.331) [-891.782] * (-893.955) [-894.963] (-893.780) (-894.192) -- 0:01:32
      343000 -- (-902.260) (-890.642) [-892.011] (-888.202) * [-891.804] (-888.550) (-892.672) (-890.576) -- 0:01:33
      343500 -- (-894.711) [-889.587] (-894.102) (-895.756) * (-894.259) (-894.071) [-894.146] (-894.008) -- 0:01:33
      344000 -- (-890.069) (-895.237) (-894.202) [-894.949] * (-895.222) (-897.093) (-900.183) [-891.063] -- 0:01:33
      344500 -- (-891.270) [-889.545] (-896.486) (-896.986) * (-896.250) (-899.789) [-892.991] (-890.595) -- 0:01:33
      345000 -- [-892.362] (-896.709) (-891.262) (-894.506) * (-890.150) (-900.635) (-894.173) [-894.096] -- 0:01:33

      Average standard deviation of split frequencies: 0.008175

      345500 -- (-891.470) (-895.770) [-895.771] (-894.591) * (-894.715) (-900.153) [-897.932] (-895.624) -- 0:01:32
      346000 -- (-894.189) (-900.251) (-895.664) [-891.594] * (-890.060) (-901.997) (-893.668) [-889.978] -- 0:01:32
      346500 -- (-891.615) (-893.255) [-892.416] (-894.190) * (-890.539) [-894.238] (-893.462) (-892.882) -- 0:01:32
      347000 -- [-900.437] (-893.905) (-896.053) (-890.613) * (-890.061) (-894.417) [-893.670] (-896.877) -- 0:01:32
      347500 -- (-893.158) [-890.572] (-891.599) (-891.758) * (-899.400) (-896.742) [-900.281] (-894.114) -- 0:01:32
      348000 -- (-894.142) (-892.158) (-890.158) [-892.838] * (-891.938) [-889.227] (-893.212) (-894.270) -- 0:01:31
      348500 -- (-889.632) [-892.940] (-890.625) (-891.256) * (-895.458) (-892.877) (-890.065) [-896.518] -- 0:01:31
      349000 -- (-889.583) (-890.475) (-895.512) [-890.532] * (-890.134) (-891.789) [-890.332] (-895.713) -- 0:01:31
      349500 -- [-891.435] (-887.274) (-895.494) (-891.107) * (-892.676) [-892.977] (-888.959) (-892.746) -- 0:01:33
      350000 -- (-891.048) (-888.621) (-890.232) [-892.090] * (-892.437) (-897.337) (-892.806) [-892.377] -- 0:01:32

      Average standard deviation of split frequencies: 0.009410

      350500 -- (-895.474) (-890.594) [-892.045] (-890.585) * (-891.850) (-891.682) (-890.924) [-890.186] -- 0:01:32
      351000 -- (-893.445) (-895.061) [-891.884] (-899.057) * [-889.041] (-892.203) (-896.654) (-891.873) -- 0:01:32
      351500 -- [-891.900] (-898.895) (-894.639) (-892.650) * (-892.144) (-893.080) [-890.566] (-900.513) -- 0:01:32
      352000 -- (-899.241) [-892.262] (-895.312) (-895.922) * (-889.781) (-893.605) [-888.478] (-891.942) -- 0:01:32
      352500 -- (-894.564) (-893.849) [-893.376] (-899.211) * [-893.083] (-898.996) (-896.541) (-892.447) -- 0:01:31
      353000 -- (-891.345) [-889.452] (-889.161) (-893.782) * [-890.867] (-893.842) (-890.175) (-894.148) -- 0:01:31
      353500 -- [-889.575] (-891.506) (-898.501) (-891.388) * (-897.588) [-890.187] (-889.914) (-899.126) -- 0:01:31
      354000 -- (-890.442) (-891.183) [-894.300] (-888.853) * (-892.913) (-893.117) [-889.376] (-896.176) -- 0:01:31
      354500 -- [-890.908] (-889.616) (-888.678) (-892.481) * [-890.246] (-892.425) (-900.832) (-891.787) -- 0:01:31
      355000 -- (-893.294) (-893.160) [-892.141] (-892.264) * [-894.514] (-895.067) (-888.533) (-893.585) -- 0:01:30

      Average standard deviation of split frequencies: 0.009269

      355500 -- (-890.198) (-896.341) [-893.633] (-894.128) * (-892.871) (-891.763) [-889.208] (-892.588) -- 0:01:30
      356000 -- (-889.829) [-892.226] (-894.141) (-893.839) * (-891.285) (-888.803) [-891.309] (-892.415) -- 0:01:30
      356500 -- (-892.899) [-891.747] (-894.091) (-892.741) * (-896.130) (-892.775) [-891.766] (-895.731) -- 0:01:30
      357000 -- (-888.289) (-895.936) [-887.549] (-891.381) * (-892.200) [-891.061] (-891.458) (-898.365) -- 0:01:31
      357500 -- [-897.163] (-896.457) (-891.330) (-895.769) * [-891.493] (-895.595) (-891.177) (-895.269) -- 0:01:31
      358000 -- (-891.993) (-890.368) (-894.213) [-888.474] * (-898.352) [-891.292] (-889.709) (-896.359) -- 0:01:31
      358500 -- (-889.087) (-898.310) (-891.728) [-892.155] * [-890.370] (-893.339) (-889.658) (-896.542) -- 0:01:31
      359000 -- (-892.459) (-899.271) [-891.828] (-891.943) * [-894.754] (-893.627) (-892.419) (-891.339) -- 0:01:31
      359500 -- (-901.857) (-897.970) (-900.540) [-891.717] * (-890.342) [-893.675] (-893.360) (-894.154) -- 0:01:30
      360000 -- (-893.859) (-892.485) (-895.436) [-887.240] * (-888.303) [-887.508] (-895.789) (-889.557) -- 0:01:30

      Average standard deviation of split frequencies: 0.007842

      360500 -- (-893.631) [-894.695] (-893.992) (-892.118) * (-890.621) (-891.390) [-892.694] (-892.037) -- 0:01:30
      361000 -- (-894.852) (-892.690) (-897.137) [-897.958] * (-892.859) (-901.871) [-893.941] (-897.952) -- 0:01:30
      361500 -- (-889.660) (-895.933) [-895.668] (-898.475) * [-891.897] (-897.090) (-896.937) (-894.501) -- 0:01:30
      362000 -- (-898.467) (-893.529) (-899.019) [-893.464] * [-895.670] (-891.045) (-890.631) (-890.130) -- 0:01:29
      362500 -- (-893.146) (-889.166) [-895.058] (-893.254) * (-892.895) (-896.616) [-891.803] (-892.326) -- 0:01:29
      363000 -- [-896.446] (-894.569) (-893.737) (-893.438) * [-888.163] (-888.582) (-892.889) (-890.785) -- 0:01:29
      363500 -- [-888.484] (-890.450) (-898.271) (-890.785) * [-894.680] (-899.427) (-896.756) (-892.794) -- 0:01:29
      364000 -- (-894.898) (-897.574) [-889.571] (-890.662) * [-887.638] (-891.896) (-894.681) (-890.855) -- 0:01:30
      364500 -- [-893.042] (-897.702) (-892.341) (-892.319) * [-895.773] (-893.297) (-891.754) (-887.612) -- 0:01:30
      365000 -- (-892.894) (-891.364) (-888.303) [-896.919] * (-891.416) [-894.671] (-889.930) (-892.973) -- 0:01:30

      Average standard deviation of split frequencies: 0.007728

      365500 -- (-892.061) (-894.383) (-888.751) [-893.933] * [-897.082] (-896.009) (-893.737) (-892.719) -- 0:01:30
      366000 -- (-889.616) (-892.271) [-889.438] (-891.676) * (-894.688) (-894.454) (-896.483) [-889.406] -- 0:01:30
      366500 -- (-892.753) (-896.866) [-893.128] (-894.719) * [-888.892] (-892.939) (-892.779) (-889.004) -- 0:01:29
      367000 -- (-890.937) (-893.674) (-896.535) [-893.273] * [-888.710] (-892.214) (-892.932) (-889.961) -- 0:01:29
      367500 -- (-893.427) [-890.991] (-891.702) (-891.991) * [-890.172] (-888.148) (-888.530) (-895.020) -- 0:01:29
      368000 -- (-894.348) (-887.745) (-892.708) [-893.451] * (-890.532) (-891.099) [-893.570] (-899.112) -- 0:01:29
      368500 -- [-889.691] (-891.975) (-899.205) (-891.106) * [-890.922] (-892.715) (-891.021) (-896.207) -- 0:01:29
      369000 -- [-892.356] (-890.072) (-893.216) (-889.487) * [-892.663] (-894.809) (-891.120) (-888.651) -- 0:01:28
      369500 -- [-898.518] (-890.575) (-898.601) (-891.002) * [-891.623] (-891.164) (-888.864) (-892.867) -- 0:01:28
      370000 -- (-892.206) (-894.623) [-892.888] (-889.747) * (-890.191) [-889.298] (-889.514) (-895.856) -- 0:01:28

      Average standard deviation of split frequencies: 0.006359

      370500 -- (-891.355) [-891.367] (-896.851) (-889.831) * (-887.673) (-895.311) (-894.629) [-889.635] -- 0:01:28
      371000 -- [-887.734] (-890.263) (-897.027) (-890.378) * (-889.879) [-893.903] (-892.032) (-887.218) -- 0:01:29
      371500 -- [-891.473] (-892.012) (-897.119) (-892.206) * [-892.015] (-893.427) (-891.828) (-894.151) -- 0:01:29
      372000 -- (-898.753) (-891.151) (-888.777) [-890.891] * (-895.522) [-895.637] (-892.144) (-890.532) -- 0:01:29
      372500 -- (-888.735) (-898.535) [-888.661] (-891.076) * (-892.861) (-896.782) (-894.782) [-891.867] -- 0:01:29
      373000 -- (-887.505) [-891.657] (-898.352) (-889.176) * (-895.063) (-892.478) [-892.313] (-891.170) -- 0:01:29
      373500 -- (-891.356) [-893.736] (-895.652) (-887.425) * (-888.022) (-892.633) [-892.549] (-888.626) -- 0:01:28
      374000 -- (-893.355) [-897.515] (-893.851) (-898.170) * (-890.563) (-898.341) [-894.681] (-892.844) -- 0:01:28
      374500 -- (-888.531) [-889.537] (-889.775) (-890.412) * [-893.240] (-892.837) (-894.746) (-889.731) -- 0:01:28
      375000 -- (-898.435) (-888.947) (-889.693) [-889.031] * (-894.002) (-890.817) [-888.509] (-896.506) -- 0:01:28

      Average standard deviation of split frequencies: 0.005015

      375500 -- (-889.252) [-891.619] (-895.708) (-890.795) * (-900.464) [-896.137] (-891.592) (-895.199) -- 0:01:28
      376000 -- (-895.014) (-895.522) (-889.322) [-895.266] * [-890.375] (-899.520) (-890.163) (-897.737) -- 0:01:27
      376500 -- (-892.571) [-892.161] (-896.848) (-893.611) * (-893.894) (-895.442) [-890.653] (-891.491) -- 0:01:27
      377000 -- (-897.381) (-890.022) [-892.223] (-896.433) * (-893.557) [-892.597] (-890.631) (-890.737) -- 0:01:27
      377500 -- (-892.017) [-891.407] (-892.454) (-891.195) * [-891.732] (-891.761) (-895.150) (-891.271) -- 0:01:27
      378000 -- [-889.844] (-894.130) (-893.581) (-887.987) * (-892.702) [-890.785] (-889.069) (-889.699) -- 0:01:28
      378500 -- (-892.386) (-893.075) [-897.210] (-894.969) * (-893.982) (-889.950) (-888.410) [-893.513] -- 0:01:28
      379000 -- (-890.154) [-892.784] (-889.029) (-892.169) * (-892.295) (-891.135) [-889.114] (-894.349) -- 0:01:28
      379500 -- (-889.338) [-891.763] (-894.220) (-891.415) * (-889.190) (-889.252) (-891.571) [-891.222] -- 0:01:28
      380000 -- (-895.667) (-892.486) (-890.868) [-892.971] * (-890.923) (-890.769) (-893.426) [-891.703] -- 0:01:28

      Average standard deviation of split frequencies: 0.003715

      380500 -- [-891.563] (-892.437) (-892.312) (-891.005) * [-894.574] (-889.895) (-891.184) (-890.027) -- 0:01:27
      381000 -- (-891.583) (-888.260) (-890.022) [-895.203] * (-894.547) (-892.749) (-891.514) [-886.779] -- 0:01:27
      381500 -- (-889.166) [-889.839] (-892.205) (-887.796) * (-900.506) [-892.988] (-890.657) (-892.616) -- 0:01:27
      382000 -- (-890.499) (-892.494) [-891.979] (-892.763) * (-894.208) [-890.053] (-892.487) (-898.480) -- 0:01:27
      382500 -- (-889.668) (-888.694) [-890.450] (-895.711) * (-894.257) (-892.479) (-895.580) [-897.103] -- 0:01:27
      383000 -- [-893.145] (-890.676) (-899.385) (-892.333) * [-894.191] (-893.894) (-889.968) (-891.366) -- 0:01:26
      383500 -- (-893.818) (-888.647) [-894.686] (-896.087) * (-890.143) (-891.319) [-894.491] (-894.060) -- 0:01:26
      384000 -- [-890.565] (-891.119) (-887.320) (-899.131) * [-888.743] (-896.502) (-891.517) (-893.304) -- 0:01:26
      384500 -- (-895.612) [-891.044] (-889.710) (-890.891) * (-890.548) (-894.467) (-890.282) [-892.791] -- 0:01:26
      385000 -- (-896.148) (-895.919) [-887.559] (-889.927) * [-889.544] (-897.183) (-893.981) (-892.703) -- 0:01:27

      Average standard deviation of split frequencies: 0.003664

      385500 -- (-893.035) [-892.891] (-886.935) (-889.681) * (-892.664) (-891.942) [-890.670] (-890.936) -- 0:01:27
      386000 -- (-896.921) (-894.305) [-890.473] (-895.864) * [-889.232] (-893.427) (-897.990) (-896.173) -- 0:01:27
      386500 -- [-891.298] (-887.894) (-893.387) (-892.349) * (-892.472) (-889.518) [-895.150] (-889.445) -- 0:01:27
      387000 -- (-893.386) [-894.760] (-894.576) (-893.996) * [-889.148] (-891.262) (-893.056) (-892.605) -- 0:01:27
      387500 -- (-887.639) (-896.346) [-892.067] (-892.298) * [-892.308] (-892.730) (-895.338) (-891.179) -- 0:01:26
      388000 -- (-889.488) (-897.022) [-893.893] (-896.227) * (-889.746) (-889.941) [-893.092] (-894.107) -- 0:01:26
      388500 -- (-889.568) (-888.505) [-901.149] (-895.216) * [-891.903] (-889.725) (-890.957) (-893.453) -- 0:01:26
      389000 -- (-896.548) [-889.726] (-891.847) (-892.251) * (-896.236) (-892.196) (-890.411) [-890.204] -- 0:01:26
      389500 -- (-890.626) (-895.000) [-891.644] (-889.972) * (-901.229) (-895.184) (-895.655) [-888.853] -- 0:01:26
      390000 -- (-887.572) (-891.584) (-896.673) [-889.865] * (-898.380) [-892.446] (-892.204) (-891.999) -- 0:01:26

      Average standard deviation of split frequencies: 0.003620

      390500 -- (-897.631) (-893.269) [-892.794] (-893.818) * (-900.673) [-892.338] (-894.944) (-891.567) -- 0:01:25
      391000 -- (-896.968) (-890.965) [-896.118] (-895.951) * (-897.824) [-889.687] (-889.205) (-890.805) -- 0:01:25
      391500 -- (-893.550) (-887.470) [-889.720] (-888.139) * (-898.129) [-890.247] (-889.147) (-893.197) -- 0:01:25
      392000 -- (-893.043) (-890.428) [-900.794] (-896.712) * (-892.272) (-893.229) [-888.882] (-891.116) -- 0:01:26
      392500 -- (-900.065) [-890.953] (-895.579) (-894.060) * (-899.849) (-890.714) (-890.951) [-891.105] -- 0:01:26
      393000 -- (-899.250) (-894.662) (-892.140) [-892.890] * (-898.702) (-895.545) [-893.410] (-892.710) -- 0:01:26
      393500 -- (-889.683) (-898.325) [-893.459] (-892.274) * (-900.414) (-894.867) [-893.915] (-887.207) -- 0:01:26
      394000 -- (-890.850) [-896.424] (-894.111) (-896.733) * (-902.037) (-894.449) (-898.201) [-891.817] -- 0:01:26
      394500 -- (-891.107) [-889.267] (-897.932) (-891.381) * (-891.821) (-892.350) (-890.078) [-890.172] -- 0:01:25
      395000 -- (-894.461) (-890.336) (-894.173) [-888.426] * (-894.003) [-900.606] (-893.308) (-888.947) -- 0:01:25

      Average standard deviation of split frequencies: 0.004762

      395500 -- (-893.316) (-890.265) [-888.601] (-891.942) * [-900.063] (-894.694) (-897.732) (-887.188) -- 0:01:25
      396000 -- (-895.461) (-892.526) [-890.617] (-894.688) * [-894.962] (-897.092) (-900.199) (-892.593) -- 0:01:25
      396500 -- [-890.392] (-895.355) (-887.324) (-894.602) * (-889.428) [-897.248] (-898.505) (-894.269) -- 0:01:25
      397000 -- (-891.259) (-889.614) [-887.543] (-898.338) * [-890.074] (-892.035) (-891.574) (-890.235) -- 0:01:25
      397500 -- [-892.156] (-892.866) (-889.840) (-895.549) * (-891.071) (-892.585) (-891.619) [-888.769] -- 0:01:24
      398000 -- [-890.122] (-897.435) (-892.221) (-898.195) * [-892.451] (-891.586) (-892.898) (-901.866) -- 0:01:24
      398500 -- (-890.344) (-896.057) [-887.730] (-900.290) * (-890.624) (-890.930) (-895.170) [-894.736] -- 0:01:24
      399000 -- (-887.719) (-894.744) [-892.590] (-897.044) * (-890.186) [-891.687] (-894.337) (-889.800) -- 0:01:25
      399500 -- [-893.011] (-892.670) (-890.362) (-898.506) * (-891.678) [-888.484] (-892.084) (-892.099) -- 0:01:25
      400000 -- (-893.736) (-888.355) [-895.147] (-896.098) * (-893.723) (-894.628) [-891.626] (-890.511) -- 0:01:25

      Average standard deviation of split frequencies: 0.003530

      400500 -- [-890.508] (-894.483) (-895.116) (-890.497) * [-891.105] (-893.157) (-892.189) (-894.758) -- 0:01:25
      401000 -- (-887.068) (-891.089) (-892.943) [-890.326] * [-892.788] (-893.811) (-894.978) (-889.643) -- 0:01:25
      401500 -- (-893.572) [-889.264] (-892.373) (-899.134) * (-892.027) (-892.561) [-894.015] (-891.804) -- 0:01:24
      402000 -- [-888.006] (-889.755) (-893.814) (-890.107) * [-889.492] (-891.477) (-892.262) (-895.370) -- 0:01:24
      402500 -- (-891.111) (-892.395) (-893.236) [-889.432] * [-890.769] (-890.600) (-892.286) (-890.680) -- 0:01:24
      403000 -- (-895.717) [-889.247] (-890.461) (-889.504) * (-899.017) (-899.520) (-891.288) [-888.358] -- 0:01:24
      403500 -- (-893.663) [-887.528] (-890.737) (-894.062) * (-889.453) [-890.025] (-892.848) (-890.665) -- 0:01:24
      404000 -- (-890.453) [-891.414] (-890.508) (-892.043) * (-890.957) (-895.012) (-892.109) [-888.964] -- 0:01:24
      404500 -- (-890.812) [-890.107] (-893.483) (-893.361) * (-898.308) [-887.994] (-890.686) (-890.684) -- 0:01:23
      405000 -- (-893.168) [-892.574] (-892.982) (-888.728) * (-892.945) [-888.653] (-890.489) (-889.806) -- 0:01:23

      Average standard deviation of split frequencies: 0.003483

      405500 -- (-892.674) (-892.855) [-896.910] (-897.834) * (-893.819) (-888.976) (-893.347) [-891.047] -- 0:01:23
      406000 -- (-893.344) (-891.104) (-891.360) [-892.054] * [-894.074] (-892.730) (-893.844) (-894.382) -- 0:01:24
      406500 -- (-898.971) (-889.320) [-889.195] (-894.192) * (-892.900) (-889.957) [-894.476] (-899.085) -- 0:01:24
      407000 -- [-895.561] (-895.841) (-888.885) (-892.918) * (-892.617) (-889.800) [-893.197] (-897.680) -- 0:01:24
      407500 -- (-892.812) (-898.451) [-889.761] (-889.375) * [-889.773] (-891.693) (-890.007) (-890.987) -- 0:01:24
      408000 -- (-892.103) (-897.935) (-889.746) [-888.589] * (-892.043) (-892.716) (-890.988) [-889.574] -- 0:01:24
      408500 -- (-889.338) (-893.359) [-893.572] (-891.313) * (-893.626) [-889.095] (-891.875) (-890.323) -- 0:01:23
      409000 -- (-889.369) (-889.692) [-887.652] (-891.121) * [-895.082] (-895.945) (-893.248) (-892.510) -- 0:01:23
      409500 -- [-889.932] (-890.297) (-888.161) (-889.102) * (-892.165) (-891.392) [-892.998] (-887.367) -- 0:01:23
      410000 -- (-888.548) (-893.129) [-889.401] (-892.953) * (-889.849) (-895.023) (-888.298) [-890.423] -- 0:01:23

      Average standard deviation of split frequencies: 0.003444

      410500 -- (-889.234) [-890.284] (-893.777) (-890.279) * (-891.260) (-894.327) (-890.483) [-898.089] -- 0:01:23
      411000 -- (-890.630) (-890.075) [-891.141] (-897.461) * (-895.431) (-887.102) [-893.257] (-893.321) -- 0:01:23
      411500 -- (-890.738) (-889.474) [-890.110] (-891.566) * (-891.738) (-896.696) [-894.133] (-893.234) -- 0:01:22
      412000 -- (-891.052) (-894.506) (-888.319) [-889.958] * (-892.576) [-894.111] (-897.344) (-896.715) -- 0:01:22
      412500 -- [-892.516] (-889.125) (-891.795) (-891.186) * (-895.104) [-890.739] (-895.899) (-892.698) -- 0:01:22
      413000 -- (-893.303) [-891.279] (-890.343) (-890.891) * (-892.155) [-890.959] (-889.672) (-891.482) -- 0:01:23
      413500 -- (-892.551) [-889.289] (-888.236) (-896.078) * [-896.769] (-891.225) (-892.760) (-894.187) -- 0:01:23
      414000 -- (-894.386) [-888.357] (-890.776) (-893.004) * [-900.161] (-890.284) (-898.646) (-894.054) -- 0:01:23
      414500 -- (-896.060) (-894.354) [-893.813] (-894.789) * (-891.671) [-893.410] (-893.328) (-903.155) -- 0:01:23
      415000 -- (-892.678) (-891.675) (-892.014) [-893.341] * [-889.273] (-897.328) (-890.246) (-899.968) -- 0:01:23

      Average standard deviation of split frequencies: 0.001133

      415500 -- (-893.748) [-891.160] (-894.287) (-890.373) * (-892.682) (-891.175) (-893.455) [-892.306] -- 0:01:22
      416000 -- (-890.539) [-887.992] (-898.663) (-890.720) * (-888.667) (-891.820) (-890.762) [-896.050] -- 0:01:22
      416500 -- (-894.010) (-892.643) (-898.008) [-901.358] * (-896.931) (-897.455) (-894.135) [-894.460] -- 0:01:22
      417000 -- (-894.330) (-896.224) [-895.178] (-895.750) * (-891.658) (-894.754) (-897.073) [-896.379] -- 0:01:22
      417500 -- (-890.938) [-891.098] (-894.417) (-895.543) * [-891.729] (-892.056) (-896.279) (-891.287) -- 0:01:22
      418000 -- (-890.840) (-893.188) (-892.821) [-890.215] * (-896.114) [-890.617] (-902.043) (-895.698) -- 0:01:22
      418500 -- (-897.126) (-891.531) [-891.760] (-891.126) * (-897.974) (-890.065) (-895.649) [-887.920] -- 0:01:21
      419000 -- (-898.554) (-897.218) [-891.275] (-890.579) * (-895.464) [-889.870] (-893.049) (-891.263) -- 0:01:21
      419500 -- (-897.204) (-895.771) (-891.999) [-889.412] * (-898.083) [-898.962] (-894.366) (-893.446) -- 0:01:21
      420000 -- (-897.513) [-890.897] (-893.679) (-893.290) * (-895.636) (-895.451) [-890.152] (-890.799) -- 0:01:22

      Average standard deviation of split frequencies: 0.001121

      420500 -- (-893.141) (-893.841) (-892.241) [-891.018] * [-891.494] (-890.741) (-889.943) (-890.079) -- 0:01:22
      421000 -- (-890.981) (-888.505) [-892.226] (-894.282) * (-891.979) [-892.502] (-891.079) (-891.393) -- 0:01:22
      421500 -- (-893.473) (-891.030) (-890.400) [-890.657] * (-894.036) [-890.012] (-888.983) (-893.266) -- 0:01:22
      422000 -- (-889.864) (-888.093) [-891.572] (-899.372) * (-891.536) (-888.438) [-890.420] (-895.925) -- 0:01:22
      422500 -- (-893.263) [-892.291] (-894.007) (-899.798) * (-893.200) [-890.529] (-890.865) (-893.378) -- 0:01:22
      423000 -- (-895.256) (-890.112) (-889.055) [-891.816] * (-893.621) (-892.510) [-894.544] (-891.945) -- 0:01:21
      423500 -- (-892.274) [-889.874] (-894.725) (-888.733) * [-892.757] (-894.453) (-890.547) (-892.228) -- 0:01:21
      424000 -- (-890.887) (-898.521) [-897.241] (-888.801) * (-891.272) [-891.098] (-891.704) (-891.213) -- 0:01:21
      424500 -- (-893.441) (-888.855) (-891.755) [-890.019] * (-888.135) (-897.481) [-892.536] (-888.213) -- 0:01:21
      425000 -- (-891.097) (-890.325) [-892.996] (-891.596) * (-890.140) (-893.044) [-895.415] (-896.691) -- 0:01:21

      Average standard deviation of split frequencies: 0.001107

      425500 -- [-893.120] (-889.665) (-893.894) (-904.458) * (-890.142) [-895.831] (-893.022) (-891.793) -- 0:01:21
      426000 -- (-888.311) (-891.156) [-889.387] (-896.051) * (-892.193) [-895.262] (-890.695) (-890.551) -- 0:01:20
      426500 -- (-892.079) (-891.417) (-890.210) [-891.470] * (-895.170) (-889.843) (-895.279) [-892.901] -- 0:01:20
      427000 -- (-889.233) (-891.983) (-891.101) [-890.539] * [-891.789] (-890.896) (-892.527) (-893.606) -- 0:01:21
      427500 -- (-894.805) [-893.794] (-890.345) (-894.641) * (-892.631) (-891.787) (-894.356) [-887.847] -- 0:01:21
      428000 -- (-896.192) [-889.290] (-898.880) (-890.971) * (-891.585) (-889.925) [-890.441] (-889.081) -- 0:01:21
      428500 -- (-892.212) (-891.188) (-899.203) [-889.458] * (-893.523) (-894.137) (-891.016) [-891.005] -- 0:01:21
      429000 -- [-892.785] (-892.299) (-894.106) (-890.290) * (-892.934) (-896.624) (-896.253) [-889.127] -- 0:01:21
      429500 -- (-890.415) (-894.957) (-900.151) [-889.543] * (-891.847) [-893.379] (-890.273) (-889.113) -- 0:01:21
      430000 -- (-892.787) (-892.962) [-893.113] (-894.998) * (-889.067) [-890.163] (-886.826) (-893.100) -- 0:01:20

      Average standard deviation of split frequencies: 0.001095

      430500 -- (-889.270) [-890.685] (-891.199) (-890.926) * (-893.138) [-892.399] (-891.395) (-896.185) -- 0:01:20
      431000 -- (-895.917) (-893.021) (-890.436) [-891.373] * (-895.502) [-889.371] (-890.817) (-888.536) -- 0:01:20
      431500 -- (-894.339) (-897.093) [-887.504] (-890.190) * (-891.198) [-891.510] (-896.343) (-890.419) -- 0:01:20
      432000 -- (-894.544) (-897.734) [-892.274] (-893.907) * (-893.778) (-891.128) (-889.258) [-888.192] -- 0:01:20
      432500 -- (-889.915) (-900.620) (-896.840) [-889.836] * (-889.340) [-893.961] (-891.013) (-889.790) -- 0:01:20
      433000 -- (-893.903) [-893.354] (-892.695) (-890.809) * [-893.661] (-889.926) (-891.681) (-891.177) -- 0:01:19
      433500 -- (-899.622) (-899.207) [-889.337] (-891.689) * (-895.968) [-887.617] (-892.223) (-887.385) -- 0:01:19
      434000 -- [-891.158] (-898.901) (-892.387) (-892.561) * (-894.976) (-892.744) [-892.611] (-890.300) -- 0:01:20
      434500 -- (-894.670) (-898.614) [-887.981] (-893.812) * [-892.088] (-888.806) (-894.205) (-896.447) -- 0:01:20
      435000 -- (-893.683) (-900.308) (-894.746) [-891.374] * (-895.229) (-890.589) (-892.163) [-889.837] -- 0:01:20

      Average standard deviation of split frequencies: 0.002162

      435500 -- (-888.016) (-890.630) (-894.590) [-890.285] * (-896.073) (-894.731) [-889.621] (-892.925) -- 0:01:20
      436000 -- (-892.059) (-892.318) (-900.428) [-893.117] * (-895.409) [-894.074] (-892.152) (-889.203) -- 0:01:20
      436500 -- [-891.430] (-894.458) (-893.289) (-887.181) * (-893.293) (-889.115) (-894.300) [-891.813] -- 0:01:20
      437000 -- [-890.605] (-889.255) (-893.742) (-886.254) * (-895.886) [-890.957] (-889.553) (-891.873) -- 0:01:19
      437500 -- (-888.110) (-889.655) (-887.787) [-887.407] * [-896.594] (-893.010) (-889.555) (-892.810) -- 0:01:19
      438000 -- (-891.830) (-896.325) [-892.551] (-892.050) * (-889.187) (-895.198) [-889.195] (-889.112) -- 0:01:19
      438500 -- (-891.553) (-889.353) (-887.655) [-888.438] * [-893.526] (-894.582) (-890.418) (-889.771) -- 0:01:19
      439000 -- [-890.471] (-895.338) (-891.613) (-898.117) * (-891.200) [-891.474] (-895.300) (-891.557) -- 0:01:19
      439500 -- (-893.574) (-890.292) [-889.494] (-892.170) * (-891.598) [-894.069] (-889.748) (-891.677) -- 0:01:19
      440000 -- (-895.596) (-891.144) (-892.664) [-889.967] * [-891.577] (-892.459) (-891.791) (-893.115) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      440500 -- [-887.874] (-892.385) (-893.163) (-889.819) * (-889.497) (-890.138) [-892.782] (-893.501) -- 0:01:18
      441000 -- (-895.766) [-899.948] (-892.246) (-892.898) * (-890.149) [-893.042] (-898.961) (-889.398) -- 0:01:18
      441500 -- (-894.902) (-895.848) [-892.132] (-897.218) * [-887.814] (-892.030) (-894.892) (-894.028) -- 0:01:19
      442000 -- (-890.634) (-894.693) (-894.668) [-892.867] * (-890.495) (-894.126) [-888.593] (-889.017) -- 0:01:19
      442500 -- (-893.109) (-897.255) [-891.143] (-897.388) * [-890.391] (-889.379) (-889.675) (-896.795) -- 0:01:19
      443000 -- [-896.748] (-893.157) (-890.995) (-895.008) * (-891.386) (-900.509) (-893.711) [-892.750] -- 0:01:19
      443500 -- (-898.459) (-893.174) [-893.868] (-894.990) * [-890.352] (-901.532) (-893.873) (-886.916) -- 0:01:19
      444000 -- (-893.431) (-896.183) [-890.166] (-893.194) * (-890.904) (-894.947) (-891.870) [-889.854] -- 0:01:18
      444500 -- (-895.528) [-896.329] (-890.924) (-891.872) * (-894.191) [-892.416] (-891.889) (-895.501) -- 0:01:18
      445000 -- (-892.860) (-893.633) (-891.758) [-891.909] * (-889.414) [-892.735] (-894.759) (-889.258) -- 0:01:18

      Average standard deviation of split frequencies: 0.001057

      445500 -- (-894.079) (-895.567) [-888.713] (-887.676) * (-896.183) [-891.529] (-896.610) (-891.668) -- 0:01:18
      446000 -- [-891.994] (-894.656) (-890.929) (-889.383) * (-891.351) (-893.517) (-892.214) [-892.363] -- 0:01:18
      446500 -- (-899.580) [-897.009] (-890.865) (-890.149) * (-894.389) (-893.493) (-894.414) [-891.924] -- 0:01:18
      447000 -- (-895.485) [-889.802] (-889.279) (-897.862) * (-890.816) (-893.435) (-892.391) [-897.676] -- 0:01:17
      447500 -- (-892.726) (-889.160) [-892.904] (-894.203) * (-893.483) (-889.038) (-896.967) [-896.656] -- 0:01:17
      448000 -- (-891.868) (-893.042) [-894.221] (-891.401) * [-890.786] (-888.197) (-892.082) (-899.638) -- 0:01:17
      448500 -- (-891.660) (-894.102) [-891.459] (-895.855) * (-895.144) (-892.102) [-889.807] (-892.295) -- 0:01:18
      449000 -- [-890.465] (-898.337) (-898.777) (-893.296) * (-889.878) [-892.164] (-888.635) (-897.942) -- 0:01:18
      449500 -- (-893.793) (-894.076) (-895.175) [-890.252] * (-892.998) (-893.413) [-893.307] (-895.739) -- 0:01:18
      450000 -- (-889.725) (-896.663) (-890.884) [-890.339] * [-897.997] (-888.245) (-888.978) (-889.262) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      450500 -- [-889.150] (-892.654) (-888.526) (-893.642) * (-892.895) (-888.619) [-894.288] (-890.899) -- 0:01:18
      451000 -- (-893.412) (-890.729) (-891.650) [-890.001] * (-893.328) (-893.842) (-895.085) [-890.213] -- 0:01:17
      451500 -- (-891.706) (-887.820) (-889.553) [-886.462] * (-892.151) [-893.130] (-890.997) (-897.136) -- 0:01:17
      452000 -- (-889.105) (-894.052) [-892.011] (-890.336) * (-891.869) [-892.263] (-888.448) (-893.398) -- 0:01:17
      452500 -- (-893.844) (-890.349) [-893.901] (-891.512) * [-891.089] (-894.276) (-890.462) (-901.888) -- 0:01:17
      453000 -- (-893.595) (-893.661) (-891.118) [-890.503] * (-889.060) (-893.593) [-892.204] (-898.827) -- 0:01:17
      453500 -- (-891.480) [-889.315] (-896.345) (-889.369) * (-888.764) [-891.287] (-888.773) (-896.572) -- 0:01:17
      454000 -- (-894.916) [-894.439] (-898.103) (-889.662) * (-891.336) (-891.440) (-891.105) [-892.801] -- 0:01:16
      454500 -- [-892.437] (-897.210) (-895.322) (-892.611) * (-895.019) (-894.418) (-891.680) [-894.011] -- 0:01:16
      455000 -- (-891.771) (-891.859) (-894.551) [-890.922] * (-893.772) (-891.795) (-895.276) [-889.661] -- 0:01:17

      Average standard deviation of split frequencies: 0.002068

      455500 -- (-892.816) [-892.652] (-888.627) (-897.163) * (-890.446) [-891.541] (-897.329) (-897.330) -- 0:01:17
      456000 -- [-895.359] (-891.090) (-892.955) (-902.499) * (-892.028) [-889.423] (-897.186) (-897.315) -- 0:01:17
      456500 -- (-894.722) (-890.971) [-889.385] (-893.170) * (-890.104) (-890.483) [-893.059] (-888.020) -- 0:01:17
      457000 -- (-894.542) (-888.093) (-891.542) [-889.410] * [-894.835] (-900.350) (-890.520) (-891.031) -- 0:01:17
      457500 -- (-892.096) [-890.562] (-897.646) (-888.946) * (-890.154) (-893.780) [-894.912] (-894.768) -- 0:01:17
      458000 -- (-891.923) [-890.598] (-894.239) (-896.205) * [-890.489] (-894.634) (-890.706) (-893.040) -- 0:01:16
      458500 -- (-895.508) (-891.419) [-892.610] (-900.055) * (-894.199) [-891.282] (-892.015) (-891.491) -- 0:01:16
      459000 -- (-892.324) (-894.981) [-890.588] (-887.014) * [-893.360] (-896.529) (-891.317) (-891.382) -- 0:01:16
      459500 -- (-890.767) (-891.010) [-890.301] (-894.742) * (-897.467) [-893.646] (-892.751) (-902.189) -- 0:01:16
      460000 -- (-895.297) [-892.041] (-891.852) (-893.298) * [-890.388] (-889.534) (-890.877) (-896.217) -- 0:01:16

      Average standard deviation of split frequencies: 0.001023

      460500 -- (-892.275) [-896.341] (-892.952) (-893.592) * (-895.518) (-895.007) [-892.037] (-893.031) -- 0:01:16
      461000 -- [-889.812] (-888.682) (-896.255) (-896.347) * (-896.954) (-902.061) [-888.705] (-896.999) -- 0:01:15
      461500 -- [-900.412] (-888.556) (-893.312) (-890.735) * [-893.330] (-894.587) (-889.988) (-893.271) -- 0:01:15
      462000 -- (-888.727) [-888.898] (-895.564) (-895.378) * (-889.432) (-893.739) (-895.580) [-896.299] -- 0:01:15
      462500 -- (-891.738) (-892.667) [-890.611] (-891.023) * [-889.173] (-897.754) (-890.835) (-895.869) -- 0:01:16
      463000 -- (-892.356) [-893.800] (-893.121) (-894.649) * (-886.058) (-893.594) [-893.006] (-895.625) -- 0:01:16
      463500 -- [-891.025] (-899.233) (-891.132) (-893.285) * (-900.240) (-892.834) [-891.357] (-892.684) -- 0:01:16
      464000 -- (-895.075) (-894.117) (-892.877) [-888.780] * [-896.197] (-893.643) (-893.381) (-893.792) -- 0:01:16
      464500 -- (-893.980) (-893.969) [-891.648] (-888.793) * [-890.743] (-894.898) (-893.772) (-898.812) -- 0:01:16
      465000 -- [-891.562] (-893.156) (-894.531) (-889.831) * [-889.493] (-890.146) (-890.439) (-898.443) -- 0:01:15

      Average standard deviation of split frequencies: 0.001012

      465500 -- [-891.458] (-896.597) (-892.101) (-889.921) * (-889.899) [-892.216] (-892.338) (-895.704) -- 0:01:15
      466000 -- (-892.028) [-890.268] (-891.873) (-893.307) * (-890.090) (-892.151) [-893.872] (-894.554) -- 0:01:15
      466500 -- (-891.874) [-893.300] (-899.270) (-896.124) * [-891.587] (-891.356) (-895.890) (-892.471) -- 0:01:15
      467000 -- [-893.316] (-892.955) (-889.567) (-894.491) * [-889.043] (-889.046) (-891.468) (-893.242) -- 0:01:15
      467500 -- (-889.885) (-891.080) (-899.794) [-896.123] * [-900.213] (-889.322) (-889.399) (-892.250) -- 0:01:15
      468000 -- [-888.539] (-892.315) (-890.864) (-892.411) * (-895.667) [-892.870] (-889.125) (-896.835) -- 0:01:15
      468500 -- [-888.441] (-893.657) (-893.743) (-893.497) * (-889.230) (-893.013) (-889.928) [-892.932] -- 0:01:14
      469000 -- (-890.778) (-893.063) [-891.843] (-893.381) * (-888.519) (-896.471) (-893.327) [-893.622] -- 0:01:14
      469500 -- (-888.866) (-892.859) [-889.647] (-888.680) * (-892.274) (-892.937) (-890.847) [-887.258] -- 0:01:15
      470000 -- (-893.520) [-893.201] (-888.690) (-887.699) * (-892.103) [-890.580] (-889.555) (-899.215) -- 0:01:15

      Average standard deviation of split frequencies: 0.001002

      470500 -- [-890.205] (-891.627) (-894.771) (-889.686) * (-894.890) [-895.260] (-895.044) (-890.894) -- 0:01:15
      471000 -- [-891.741] (-894.303) (-891.723) (-893.521) * [-890.518] (-892.061) (-892.346) (-892.108) -- 0:01:15
      471500 -- (-891.801) (-891.337) (-894.953) [-893.764] * (-894.627) [-894.325] (-890.228) (-895.243) -- 0:01:15
      472000 -- [-891.620] (-897.259) (-893.628) (-896.411) * [-895.083] (-889.054) (-892.021) (-899.504) -- 0:01:14
      472500 -- (-901.744) (-893.579) (-892.604) [-893.352] * (-889.675) [-892.698] (-894.351) (-893.677) -- 0:01:14
      473000 -- (-892.006) (-892.664) (-887.868) [-898.507] * (-891.921) (-899.978) (-890.246) [-892.524] -- 0:01:14
      473500 -- [-891.881] (-895.481) (-894.472) (-896.572) * (-889.496) (-894.750) (-893.122) [-889.311] -- 0:01:14
      474000 -- (-889.504) [-887.966] (-894.070) (-895.245) * [-890.591] (-891.356) (-890.225) (-891.510) -- 0:01:14
      474500 -- (-895.563) (-894.295) (-898.321) [-899.580] * [-897.430] (-891.491) (-898.573) (-888.687) -- 0:01:14
      475000 -- (-893.830) (-890.572) (-894.302) [-891.120] * (-897.731) (-892.650) (-892.406) [-889.513] -- 0:01:14

      Average standard deviation of split frequencies: 0.000990

      475500 -- [-891.611] (-890.333) (-891.972) (-891.053) * [-894.091] (-890.364) (-894.395) (-897.430) -- 0:01:13
      476000 -- (-892.091) [-890.107] (-892.762) (-889.916) * (-890.813) (-890.103) [-890.801] (-903.119) -- 0:01:13
      476500 -- [-888.744] (-890.273) (-889.229) (-892.693) * (-899.864) (-891.193) [-893.253] (-888.542) -- 0:01:14
      477000 -- (-895.443) (-888.386) [-889.052] (-893.260) * (-891.930) (-890.256) [-891.468] (-890.277) -- 0:01:14
      477500 -- (-892.689) [-893.522] (-893.357) (-887.848) * (-893.386) [-893.384] (-892.477) (-891.979) -- 0:01:14
      478000 -- (-888.060) (-890.334) [-889.591] (-891.303) * [-893.818] (-890.080) (-890.575) (-894.973) -- 0:01:14
      478500 -- [-892.110] (-894.061) (-891.910) (-894.816) * (-900.310) (-892.053) [-891.546] (-895.084) -- 0:01:14
      479000 -- [-893.284] (-895.129) (-892.691) (-891.052) * (-897.457) [-891.539] (-890.444) (-891.358) -- 0:01:13
      479500 -- [-894.694] (-887.953) (-891.811) (-894.249) * (-893.468) (-891.642) [-895.106] (-891.110) -- 0:01:13
      480000 -- [-890.032] (-891.584) (-891.752) (-892.156) * (-892.204) [-888.718] (-891.382) (-892.014) -- 0:01:13

      Average standard deviation of split frequencies: 0.000981

      480500 -- (-895.964) (-889.572) (-896.996) [-892.518] * (-888.185) [-892.639] (-899.137) (-894.986) -- 0:01:13
      481000 -- (-894.358) (-893.577) [-890.292] (-890.603) * [-890.333] (-891.098) (-901.345) (-889.841) -- 0:01:13
      481500 -- [-887.717] (-894.669) (-889.524) (-893.624) * [-893.575] (-888.510) (-890.439) (-896.470) -- 0:01:13
      482000 -- (-893.993) [-889.490] (-890.058) (-895.443) * [-889.683] (-892.369) (-891.657) (-895.386) -- 0:01:13
      482500 -- (-892.744) [-888.704] (-894.795) (-890.257) * [-892.018] (-892.764) (-890.245) (-892.715) -- 0:01:12
      483000 -- (-889.881) [-890.710] (-893.253) (-896.811) * [-890.474] (-891.376) (-894.108) (-887.469) -- 0:01:12
      483500 -- (-894.546) (-889.957) [-891.307] (-893.700) * (-892.901) [-890.168] (-897.745) (-889.274) -- 0:01:13
      484000 -- (-888.820) [-890.887] (-892.261) (-887.877) * [-892.524] (-890.273) (-895.712) (-893.412) -- 0:01:13
      484500 -- (-896.952) (-891.836) (-892.151) [-889.955] * (-891.060) [-888.914] (-895.697) (-890.299) -- 0:01:13
      485000 -- (-891.075) [-890.625] (-895.076) (-889.019) * [-893.033] (-889.905) (-892.081) (-890.602) -- 0:01:13

      Average standard deviation of split frequencies: 0.000970

      485500 -- (-889.992) (-893.819) (-891.300) [-892.139] * (-889.275) (-892.838) (-890.811) [-889.336] -- 0:01:13
      486000 -- [-893.474] (-889.915) (-898.904) (-890.156) * (-894.707) [-891.003] (-892.556) (-892.159) -- 0:01:12
      486500 -- (-893.182) (-895.388) (-891.082) [-894.290] * (-893.853) (-891.670) (-896.287) [-890.393] -- 0:01:12
      487000 -- (-891.645) (-891.552) [-893.755] (-889.685) * [-892.035] (-896.062) (-890.785) (-891.735) -- 0:01:12
      487500 -- (-891.073) (-889.633) (-896.687) [-891.923] * (-890.233) (-893.595) (-891.419) [-894.745] -- 0:01:12
      488000 -- [-888.110] (-902.520) (-901.654) (-893.363) * (-892.529) (-894.384) (-890.136) [-892.381] -- 0:01:12
      488500 -- (-894.277) (-897.909) (-896.533) [-889.555] * (-889.786) [-894.054] (-888.479) (-889.760) -- 0:01:12
      489000 -- [-889.087] (-891.173) (-892.635) (-892.030) * (-892.591) (-890.160) (-889.932) [-891.182] -- 0:01:12
      489500 -- [-888.457] (-895.257) (-888.785) (-890.269) * (-888.956) (-890.819) [-888.250] (-902.414) -- 0:01:11
      490000 -- [-890.658] (-897.768) (-897.209) (-893.250) * (-898.425) (-894.168) (-895.062) [-899.736] -- 0:01:11

      Average standard deviation of split frequencies: 0.000961

      490500 -- [-891.590] (-894.255) (-889.973) (-889.417) * (-896.348) [-890.714] (-897.970) (-888.584) -- 0:01:12
      491000 -- [-889.335] (-890.837) (-888.836) (-892.192) * [-890.690] (-890.081) (-892.838) (-894.482) -- 0:01:12
      491500 -- [-887.089] (-892.987) (-891.494) (-891.318) * [-894.081] (-899.113) (-886.944) (-888.724) -- 0:01:12
      492000 -- (-893.240) [-890.753] (-892.366) (-897.128) * [-890.812] (-888.937) (-892.588) (-891.882) -- 0:01:12
      492500 -- (-890.794) [-891.893] (-891.165) (-894.232) * (-887.402) [-891.355] (-891.220) (-895.131) -- 0:01:12
      493000 -- (-889.028) (-897.231) [-891.179] (-896.337) * (-893.748) [-888.957] (-895.250) (-892.397) -- 0:01:11
      493500 -- (-888.019) [-895.780] (-896.503) (-891.143) * (-888.875) [-891.863] (-898.412) (-893.977) -- 0:01:11
      494000 -- [-893.492] (-888.410) (-893.162) (-889.307) * (-889.994) [-890.340] (-894.870) (-896.918) -- 0:01:11
      494500 -- [-889.102] (-894.875) (-892.621) (-891.536) * (-889.293) [-890.462] (-903.406) (-888.946) -- 0:01:11
      495000 -- (-892.861) (-887.186) (-895.025) [-888.439] * (-891.046) [-893.529] (-897.956) (-892.472) -- 0:01:11

      Average standard deviation of split frequencies: 0.001901

      495500 -- (-897.937) (-893.606) (-889.477) [-891.817] * [-892.994] (-895.033) (-898.390) (-890.300) -- 0:01:11
      496000 -- (-894.366) (-889.547) [-891.039] (-895.442) * [-890.242] (-896.655) (-895.847) (-891.829) -- 0:01:11
      496500 -- (-892.660) [-891.155] (-890.027) (-896.030) * (-894.925) (-891.993) (-892.775) [-888.048] -- 0:01:10
      497000 -- [-892.665] (-896.467) (-899.552) (-887.716) * (-895.529) [-891.371] (-890.953) (-893.489) -- 0:01:10
      497500 -- (-889.339) (-891.218) [-894.319] (-894.942) * [-892.918] (-893.718) (-891.157) (-891.876) -- 0:01:11
      498000 -- [-889.564] (-892.971) (-896.353) (-893.650) * (-892.246) [-893.719] (-894.752) (-893.252) -- 0:01:11
      498500 -- [-890.273] (-891.990) (-889.511) (-892.389) * (-890.489) (-888.650) (-898.774) [-890.814] -- 0:01:11
      499000 -- (-889.641) [-888.012] (-899.315) (-891.545) * [-891.983] (-893.260) (-891.738) (-893.712) -- 0:01:11
      499500 -- [-894.649] (-890.330) (-891.634) (-891.137) * [-889.978] (-889.880) (-889.747) (-896.580) -- 0:01:11
      500000 -- [-893.676] (-890.865) (-896.682) (-893.473) * [-890.048] (-895.159) (-890.953) (-891.399) -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      500500 -- (-893.018) [-890.304] (-894.835) (-902.150) * (-900.128) [-891.273] (-892.292) (-891.810) -- 0:01:10
      501000 -- (-897.169) [-890.652] (-895.648) (-891.398) * (-889.153) [-893.863] (-888.787) (-888.591) -- 0:01:10
      501500 -- (-890.886) [-889.769] (-890.563) (-889.808) * (-893.887) (-896.671) [-891.835] (-897.890) -- 0:01:10
      502000 -- (-892.322) (-893.199) (-891.094) [-892.115] * [-897.729] (-890.728) (-898.761) (-892.788) -- 0:01:10
      502500 -- (-901.179) [-889.236] (-894.870) (-890.046) * [-891.287] (-895.540) (-898.922) (-893.290) -- 0:01:10
      503000 -- (-893.834) (-890.403) [-892.515] (-898.161) * (-895.347) (-898.493) [-889.552] (-894.921) -- 0:01:10
      503500 -- (-890.706) (-889.937) [-891.023] (-890.879) * (-896.410) (-888.640) [-893.047] (-892.795) -- 0:01:10
      504000 -- (-889.655) (-889.315) [-895.763] (-897.075) * (-893.016) (-896.829) [-891.212] (-897.575) -- 0:01:09
      504500 -- (-893.967) (-893.479) [-894.036] (-897.917) * (-894.897) (-896.532) [-888.492] (-891.295) -- 0:01:10
      505000 -- (-896.728) [-889.185] (-890.777) (-889.383) * (-894.022) [-890.274] (-888.917) (-898.925) -- 0:01:10

      Average standard deviation of split frequencies: 0.000932

      505500 -- (-891.399) (-892.591) (-897.173) [-891.287] * [-891.630] (-886.833) (-894.557) (-889.878) -- 0:01:10
      506000 -- [-887.153] (-889.461) (-894.834) (-894.052) * (-889.778) [-891.898] (-892.852) (-895.205) -- 0:01:10
      506500 -- (-890.645) (-888.705) [-890.634] (-895.254) * (-889.744) [-891.483] (-890.874) (-894.247) -- 0:01:10
      507000 -- (-889.229) [-893.290] (-891.736) (-893.522) * [-890.398] (-891.036) (-897.102) (-896.871) -- 0:01:10
      507500 -- [-890.686] (-892.216) (-890.361) (-889.638) * (-886.797) (-894.860) [-893.047] (-899.201) -- 0:01:09
      508000 -- (-892.064) (-901.362) [-892.346] (-891.398) * [-887.991] (-897.697) (-887.026) (-898.562) -- 0:01:09
      508500 -- [-891.285] (-896.590) (-893.607) (-895.757) * (-889.761) [-892.214] (-888.831) (-897.645) -- 0:01:09
      509000 -- [-892.182] (-890.791) (-891.080) (-890.307) * (-895.235) (-891.895) [-887.415] (-899.182) -- 0:01:09
      509500 -- (-891.034) (-892.756) (-894.223) [-894.677] * (-892.764) [-892.269] (-890.502) (-897.974) -- 0:01:09
      510000 -- (-891.793) (-891.995) (-897.162) [-895.991] * (-888.137) [-892.658] (-887.911) (-894.080) -- 0:01:09

      Average standard deviation of split frequencies: 0.000923

      510500 -- (-898.800) (-898.038) [-898.369] (-901.958) * (-894.420) [-891.897] (-892.626) (-895.733) -- 0:01:09
      511000 -- [-899.746] (-894.440) (-894.730) (-903.171) * (-893.687) [-893.000] (-889.577) (-892.330) -- 0:01:08
      511500 -- (-891.566) [-895.225] (-890.365) (-888.980) * (-892.247) (-894.264) (-889.511) [-891.431] -- 0:01:09
      512000 -- (-889.338) (-894.697) [-891.229] (-900.345) * (-888.221) (-894.378) [-889.987] (-895.369) -- 0:01:09
      512500 -- [-889.769] (-894.978) (-890.814) (-896.055) * (-889.011) (-890.166) [-890.289] (-888.361) -- 0:01:09
      513000 -- (-889.486) (-890.538) [-890.250] (-890.984) * (-890.144) [-889.308] (-890.524) (-895.481) -- 0:01:09
      513500 -- [-897.367] (-893.581) (-887.661) (-894.194) * (-896.343) [-891.624] (-891.794) (-893.222) -- 0:01:09
      514000 -- [-892.194] (-892.527) (-893.015) (-893.168) * (-897.177) (-888.484) (-890.778) [-896.269] -- 0:01:09
      514500 -- [-890.842] (-896.904) (-889.356) (-892.262) * [-888.266] (-891.553) (-891.234) (-897.568) -- 0:01:08
      515000 -- (-890.545) (-895.916) (-895.711) [-892.655] * (-891.709) (-890.499) [-890.293] (-890.704) -- 0:01:08

      Average standard deviation of split frequencies: 0.000914

      515500 -- [-896.409] (-888.378) (-892.268) (-892.894) * (-892.365) (-895.696) [-896.083] (-888.819) -- 0:01:08
      516000 -- [-893.911] (-889.208) (-891.850) (-897.029) * (-896.311) (-892.396) (-889.953) [-890.265] -- 0:01:08
      516500 -- [-891.328] (-892.393) (-894.343) (-890.231) * (-897.473) (-898.935) (-896.764) [-892.024] -- 0:01:08
      517000 -- (-892.529) [-892.334] (-890.786) (-894.057) * (-891.192) [-886.557] (-893.952) (-889.649) -- 0:01:08
      517500 -- (-890.172) (-897.317) (-893.151) [-890.165] * (-890.041) [-890.328] (-898.346) (-892.167) -- 0:01:08
      518000 -- [-889.945] (-894.104) (-890.134) (-896.366) * (-889.591) (-889.913) (-891.688) [-890.311] -- 0:01:07
      518500 -- (-899.552) (-894.252) (-893.407) [-894.538] * (-888.384) (-899.143) [-895.063] (-892.879) -- 0:01:08
      519000 -- (-894.703) (-891.364) (-891.721) [-891.092] * [-888.058] (-894.203) (-892.447) (-890.309) -- 0:01:08
      519500 -- [-894.448] (-893.786) (-891.201) (-892.031) * [-891.284] (-896.939) (-889.666) (-891.085) -- 0:01:08
      520000 -- (-894.744) (-894.911) [-890.902] (-895.638) * (-888.684) (-893.486) [-890.296] (-891.095) -- 0:01:08

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-894.196) (-896.137) [-893.277] (-894.926) * (-887.718) (-894.552) [-888.744] (-889.535) -- 0:01:08
      521000 -- (-897.765) (-895.333) [-893.904] (-893.829) * [-890.222] (-893.261) (-887.799) (-894.177) -- 0:01:08
      521500 -- [-892.919] (-889.280) (-892.390) (-896.055) * [-889.427] (-891.420) (-894.213) (-892.217) -- 0:01:07
      522000 -- (-894.359) [-895.032] (-891.332) (-889.820) * (-889.923) (-888.201) [-890.966] (-887.726) -- 0:01:07
      522500 -- (-893.378) [-889.598] (-894.991) (-894.114) * (-890.128) (-889.664) [-889.917] (-896.353) -- 0:01:07
      523000 -- (-890.290) (-892.257) (-891.987) [-891.245] * (-900.145) (-893.947) [-888.949] (-890.562) -- 0:01:07
      523500 -- (-891.710) [-889.714] (-892.445) (-891.713) * (-898.473) (-891.722) (-893.230) [-893.867] -- 0:01:07
      524000 -- [-890.802] (-891.189) (-895.599) (-893.481) * (-893.540) [-890.223] (-898.482) (-890.604) -- 0:01:07
      524500 -- (-896.061) [-890.299] (-896.779) (-896.011) * (-890.285) [-888.790] (-891.915) (-894.770) -- 0:01:07
      525000 -- (-891.478) [-891.025] (-893.474) (-893.619) * [-890.671] (-892.930) (-892.482) (-897.021) -- 0:01:06

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-892.382) [-894.012] (-889.526) (-891.193) * (-890.420) (-890.113) [-889.440] (-896.610) -- 0:01:07
      526000 -- (-901.806) (-898.742) (-893.001) [-891.080] * (-890.808) [-889.187] (-896.022) (-902.127) -- 0:01:07
      526500 -- (-895.665) (-890.911) (-892.066) [-895.227] * (-889.751) (-889.903) [-889.924] (-901.775) -- 0:01:07
      527000 -- [-888.952] (-891.343) (-892.735) (-891.535) * (-895.044) (-890.679) (-888.500) [-892.455] -- 0:01:07
      527500 -- (-890.747) [-889.243] (-888.263) (-890.552) * [-892.439] (-889.459) (-886.543) (-895.749) -- 0:01:07
      528000 -- [-892.057] (-892.557) (-891.587) (-896.729) * [-888.845] (-892.158) (-888.875) (-895.533) -- 0:01:07
      528500 -- (-898.142) (-895.742) [-889.691] (-892.878) * (-891.541) (-888.156) [-890.789] (-889.422) -- 0:01:06
      529000 -- (-893.136) [-893.571] (-898.257) (-889.003) * [-893.374] (-889.073) (-891.041) (-897.910) -- 0:01:06
      529500 -- (-896.836) [-889.047] (-896.013) (-896.285) * (-887.673) (-890.252) [-894.828] (-901.990) -- 0:01:06
      530000 -- (-894.551) (-894.371) (-895.567) [-903.649] * (-895.123) (-890.124) [-887.606] (-895.815) -- 0:01:06

      Average standard deviation of split frequencies: 0.000000

      530500 -- [-892.462] (-896.297) (-890.829) (-898.206) * (-895.922) [-888.549] (-894.403) (-891.714) -- 0:01:06
      531000 -- (-894.544) (-894.643) (-892.347) [-901.630] * (-893.025) [-891.856] (-892.175) (-905.014) -- 0:01:06
      531500 -- [-890.491] (-892.947) (-891.284) (-897.305) * (-892.349) (-893.306) (-892.192) [-890.455] -- 0:01:06
      532000 -- (-895.093) (-895.672) [-897.424] (-893.560) * [-893.566] (-890.068) (-891.653) (-903.414) -- 0:01:05
      532500 -- (-895.585) [-889.854] (-892.738) (-891.770) * (-895.426) [-890.479] (-891.208) (-895.342) -- 0:01:05
      533000 -- [-893.385] (-892.900) (-895.020) (-890.156) * (-893.655) [-894.253] (-895.338) (-892.982) -- 0:01:06
      533500 -- (-889.027) (-898.593) [-891.853] (-891.057) * (-897.337) [-893.123] (-894.635) (-895.891) -- 0:01:06
      534000 -- (-889.323) [-890.003] (-894.529) (-893.979) * (-891.665) (-892.616) [-893.104] (-890.561) -- 0:01:06
      534500 -- (-890.597) (-891.294) (-896.003) [-896.088] * [-895.219] (-890.567) (-893.091) (-893.517) -- 0:01:06
      535000 -- [-890.314] (-890.471) (-896.758) (-895.749) * (-889.438) [-889.725] (-892.155) (-896.142) -- 0:01:06

      Average standard deviation of split frequencies: 0.000000

      535500 -- [-888.432] (-889.769) (-890.780) (-894.603) * (-897.470) [-887.855] (-892.361) (-893.365) -- 0:01:05
      536000 -- [-891.933] (-897.995) (-890.498) (-889.671) * (-890.834) (-890.867) [-893.230] (-893.515) -- 0:01:05
      536500 -- (-891.542) [-894.361] (-891.862) (-890.061) * [-891.711] (-895.536) (-892.548) (-892.970) -- 0:01:05
      537000 -- (-897.972) (-893.641) (-894.397) [-892.812] * (-895.015) (-896.443) (-893.006) [-889.192] -- 0:01:05
      537500 -- (-899.566) [-893.914] (-889.839) (-892.300) * (-892.486) (-898.158) [-889.661] (-901.028) -- 0:01:05
      538000 -- [-903.682] (-889.792) (-886.816) (-895.276) * (-889.583) (-889.271) (-890.318) [-895.395] -- 0:01:05
      538500 -- [-895.796] (-897.916) (-889.970) (-892.944) * [-891.650] (-890.539) (-894.636) (-892.236) -- 0:01:05
      539000 -- [-892.202] (-889.914) (-891.103) (-888.003) * [-899.147] (-890.867) (-890.788) (-896.117) -- 0:01:05
      539500 -- (-900.397) [-893.533] (-892.136) (-889.920) * [-892.826] (-890.049) (-893.912) (-893.456) -- 0:01:04
      540000 -- (-891.149) (-891.539) [-894.235] (-894.031) * (-895.152) (-889.597) (-890.825) [-889.057] -- 0:01:05

      Average standard deviation of split frequencies: 0.000872

      540500 -- [-890.882] (-894.616) (-891.344) (-898.122) * (-891.410) (-888.292) [-892.456] (-890.666) -- 0:01:05
      541000 -- [-888.587] (-889.021) (-892.412) (-889.118) * (-893.428) (-892.291) [-890.405] (-892.654) -- 0:01:05
      541500 -- [-895.370] (-887.909) (-890.781) (-893.945) * (-895.674) (-893.792) [-894.132] (-890.650) -- 0:01:05
      542000 -- (-892.761) (-886.826) [-890.357] (-890.134) * [-888.025] (-894.484) (-895.564) (-889.267) -- 0:01:05
      542500 -- [-890.529] (-889.403) (-890.844) (-896.388) * [-893.037] (-896.759) (-893.725) (-891.937) -- 0:01:04
      543000 -- (-888.828) (-894.102) [-889.905] (-893.398) * (-897.532) (-897.336) (-892.012) [-889.892] -- 0:01:04
      543500 -- (-895.274) (-893.732) [-889.619] (-889.352) * (-894.273) [-890.151] (-897.018) (-889.332) -- 0:01:04
      544000 -- (-896.986) (-902.383) [-886.936] (-891.552) * [-893.305] (-892.328) (-891.649) (-891.331) -- 0:01:04
      544500 -- (-893.720) [-892.980] (-894.270) (-896.425) * (-893.670) (-895.821) [-891.458] (-896.211) -- 0:01:04
      545000 -- (-894.597) [-889.862] (-891.422) (-894.570) * (-893.094) [-890.857] (-887.719) (-893.213) -- 0:01:04

      Average standard deviation of split frequencies: 0.000863

      545500 -- [-888.986] (-892.562) (-890.300) (-899.460) * [-894.313] (-890.944) (-890.814) (-891.859) -- 0:01:04
      546000 -- (-891.444) (-896.222) (-892.097) [-892.057] * (-893.447) (-893.328) (-894.258) [-895.579] -- 0:01:04
      546500 -- (-892.493) (-894.510) (-889.622) [-891.063] * (-897.031) [-894.356] (-894.880) (-892.406) -- 0:01:03
      547000 -- (-900.160) [-890.663] (-894.743) (-888.579) * (-891.729) (-892.044) [-889.013] (-897.997) -- 0:01:04
      547500 -- (-890.949) (-893.133) [-890.080] (-889.398) * [-890.250] (-897.798) (-893.732) (-889.768) -- 0:01:04
      548000 -- [-891.473] (-892.738) (-892.002) (-888.174) * [-889.756] (-893.189) (-889.132) (-890.037) -- 0:01:04
      548500 -- (-892.766) (-891.882) [-893.012] (-889.872) * [-895.544] (-900.615) (-891.815) (-891.677) -- 0:01:04
      549000 -- (-898.764) (-896.751) (-897.028) [-887.485] * [-891.857] (-889.306) (-892.323) (-892.759) -- 0:01:04
      549500 -- (-899.251) [-890.096] (-890.474) (-893.036) * (-894.316) [-889.575] (-889.047) (-890.394) -- 0:01:03
      550000 -- (-897.426) (-888.934) [-891.621] (-893.376) * (-891.540) [-893.072] (-893.202) (-895.125) -- 0:01:03

      Average standard deviation of split frequencies: 0.000856

      550500 -- [-891.617] (-895.792) (-887.850) (-899.028) * (-892.485) [-891.845] (-891.319) (-892.426) -- 0:01:03
      551000 -- [-891.546] (-888.895) (-890.404) (-891.487) * (-891.063) [-892.059] (-892.791) (-895.546) -- 0:01:03
      551500 -- (-901.878) [-892.165] (-892.706) (-894.971) * (-889.093) [-897.157] (-898.816) (-899.207) -- 0:01:03
      552000 -- [-889.281] (-892.806) (-894.593) (-893.836) * [-892.033] (-889.375) (-893.189) (-891.027) -- 0:01:03
      552500 -- (-891.638) [-889.248] (-889.590) (-899.440) * (-899.187) (-891.324) [-893.404] (-891.755) -- 0:01:03
      553000 -- [-890.502] (-895.202) (-888.223) (-894.514) * (-898.875) (-892.167) [-891.297] (-888.426) -- 0:01:03
      553500 -- (-894.250) [-894.798] (-891.158) (-896.002) * (-893.023) (-891.743) (-890.991) [-892.349] -- 0:01:02
      554000 -- [-890.711] (-894.359) (-893.785) (-895.015) * (-893.534) (-891.190) [-892.145] (-891.354) -- 0:01:03
      554500 -- (-893.475) (-889.676) [-891.214] (-891.016) * (-892.243) [-891.209] (-890.684) (-890.346) -- 0:01:03
      555000 -- [-894.848] (-889.295) (-889.020) (-890.827) * (-893.664) [-887.053] (-896.101) (-888.560) -- 0:01:03

      Average standard deviation of split frequencies: 0.000848

      555500 -- (-894.289) (-889.471) (-893.815) [-894.598] * [-890.633] (-890.980) (-890.104) (-887.710) -- 0:01:03
      556000 -- (-890.114) (-888.235) [-890.118] (-898.313) * (-893.572) (-894.030) (-890.456) [-892.741] -- 0:01:03
      556500 -- (-895.620) (-890.612) [-892.477] (-896.843) * [-889.714] (-888.902) (-896.568) (-897.538) -- 0:01:02
      557000 -- (-890.932) (-887.507) (-891.226) [-899.065] * (-889.873) [-892.770] (-893.372) (-894.483) -- 0:01:02
      557500 -- (-892.067) [-893.252] (-891.651) (-894.863) * [-888.028] (-895.933) (-893.297) (-893.316) -- 0:01:02
      558000 -- [-890.587] (-891.826) (-894.425) (-893.983) * (-890.222) [-890.447] (-892.763) (-891.329) -- 0:01:02
      558500 -- [-890.095] (-888.658) (-893.198) (-896.912) * [-895.634] (-895.817) (-898.206) (-894.476) -- 0:01:02
      559000 -- [-890.069] (-895.312) (-890.982) (-896.398) * (-889.854) [-894.638] (-895.237) (-890.384) -- 0:01:02
      559500 -- [-889.862] (-889.968) (-895.403) (-898.091) * [-887.593] (-896.793) (-890.507) (-891.146) -- 0:01:02
      560000 -- (-894.064) (-891.966) (-893.123) [-888.642] * (-896.925) (-896.372) [-893.808] (-897.670) -- 0:01:02

      Average standard deviation of split frequencies: 0.001682

      560500 -- (-888.779) (-898.280) [-890.452] (-897.275) * (-894.148) [-892.837] (-889.882) (-897.125) -- 0:01:02
      561000 -- (-889.640) [-895.962] (-889.093) (-892.124) * (-902.020) [-888.245] (-894.678) (-892.740) -- 0:01:02
      561500 -- [-898.027] (-892.199) (-888.416) (-891.309) * (-892.262) (-890.058) [-890.084] (-889.437) -- 0:01:02
      562000 -- (-893.062) (-895.688) [-894.556] (-891.754) * (-890.795) [-892.244] (-891.344) (-891.000) -- 0:01:02
      562500 -- [-889.020] (-899.470) (-891.044) (-892.358) * [-891.085] (-889.923) (-895.008) (-897.209) -- 0:01:02
      563000 -- (-890.189) (-892.721) (-891.356) [-890.966] * (-890.811) (-891.087) (-890.638) [-889.513] -- 0:01:02
      563500 -- (-895.343) [-895.008] (-896.366) (-891.951) * (-889.762) [-888.752] (-893.640) (-891.229) -- 0:01:01
      564000 -- (-889.801) (-890.893) (-889.397) [-889.320] * [-897.243] (-888.350) (-893.129) (-891.187) -- 0:01:01
      564500 -- (-892.787) (-892.507) (-890.691) [-892.090] * (-890.029) [-893.343] (-891.564) (-894.726) -- 0:01:01
      565000 -- (-891.078) (-892.281) (-891.201) [-894.780] * [-889.149] (-890.785) (-891.816) (-895.016) -- 0:01:01

      Average standard deviation of split frequencies: 0.002499

      565500 -- (-895.000) [-896.003] (-892.776) (-892.194) * (-892.188) [-889.271] (-891.565) (-893.461) -- 0:01:01
      566000 -- (-887.958) (-893.326) (-893.436) [-888.147] * (-894.016) (-889.555) (-891.632) [-895.801] -- 0:01:01
      566500 -- [-889.946] (-893.354) (-889.107) (-890.895) * (-892.015) [-890.998] (-891.951) (-891.115) -- 0:01:01
      567000 -- (-893.370) [-897.173] (-891.879) (-894.683) * [-887.437] (-893.177) (-894.136) (-893.036) -- 0:01:01
      567500 -- (-892.025) [-889.294] (-890.199) (-894.670) * (-900.058) (-890.943) (-893.155) [-892.806] -- 0:01:01
      568000 -- (-890.463) (-894.127) (-894.410) [-895.953] * (-890.758) [-896.363] (-893.755) (-894.043) -- 0:01:01
      568500 -- [-894.400] (-890.478) (-891.898) (-901.867) * [-892.690] (-893.093) (-899.572) (-892.850) -- 0:01:01
      569000 -- (-889.519) [-889.543] (-898.927) (-893.677) * (-891.548) [-895.934] (-894.435) (-896.314) -- 0:01:01
      569500 -- [-891.813] (-889.605) (-891.810) (-896.860) * (-888.777) [-890.045] (-890.669) (-889.343) -- 0:01:01
      570000 -- [-897.283] (-895.798) (-901.598) (-889.075) * [-888.663] (-890.148) (-894.972) (-890.370) -- 0:01:01

      Average standard deviation of split frequencies: 0.002478

      570500 -- (-892.472) (-888.378) (-895.622) [-888.338] * [-893.377] (-892.425) (-891.595) (-893.544) -- 0:01:00
      571000 -- (-888.079) [-889.192] (-898.118) (-892.704) * (-888.286) (-891.402) [-895.159] (-893.204) -- 0:01:00
      571500 -- (-888.625) (-891.854) (-900.839) [-888.443] * (-889.922) (-891.624) [-892.669] (-889.272) -- 0:01:00
      572000 -- [-890.795] (-893.386) (-898.661) (-895.554) * (-891.595) (-890.914) [-887.895] (-890.275) -- 0:01:00
      572500 -- (-896.062) (-893.161) (-894.527) [-894.116] * (-891.534) [-890.302] (-897.237) (-890.507) -- 0:01:00
      573000 -- (-897.753) (-896.454) (-895.837) [-888.283] * (-890.448) (-892.808) [-896.423] (-894.920) -- 0:01:00
      573500 -- (-892.673) [-891.083] (-897.081) (-894.371) * (-887.987) (-891.357) [-890.388] (-896.930) -- 0:01:00
      574000 -- (-889.796) [-888.575] (-897.436) (-898.398) * (-888.894) [-893.166] (-890.397) (-898.774) -- 0:01:00
      574500 -- (-893.353) [-891.722] (-893.120) (-894.914) * (-890.436) (-890.587) (-898.229) [-898.160] -- 0:01:00
      575000 -- (-895.119) (-888.581) (-890.381) [-890.170] * (-895.025) [-888.337] (-901.295) (-895.247) -- 0:01:00

      Average standard deviation of split frequencies: 0.001637

      575500 -- (-897.267) (-889.550) (-892.358) [-889.438] * [-889.990] (-892.525) (-895.043) (-891.863) -- 0:01:00
      576000 -- [-888.692] (-892.739) (-891.470) (-890.940) * (-893.909) (-887.405) [-893.398] (-893.428) -- 0:01:00
      576500 -- (-891.260) [-887.980] (-893.180) (-891.956) * [-887.966] (-888.320) (-892.004) (-890.630) -- 0:01:00
      577000 -- [-890.261] (-891.778) (-894.756) (-892.685) * (-900.052) (-888.735) [-891.800] (-891.875) -- 0:01:00
      577500 -- (-899.485) (-890.212) [-893.960] (-890.781) * (-894.717) [-890.799] (-896.076) (-889.494) -- 0:00:59
      578000 -- [-892.591] (-893.192) (-895.218) (-892.674) * (-891.822) (-890.438) [-891.101] (-892.711) -- 0:00:59
      578500 -- (-893.972) [-886.463] (-889.169) (-895.703) * (-895.601) [-891.609] (-890.622) (-896.529) -- 0:00:59
      579000 -- [-889.349] (-890.031) (-896.642) (-897.605) * (-891.155) (-893.001) [-888.788] (-898.480) -- 0:00:59
      579500 -- (-892.295) [-889.376] (-894.110) (-894.369) * [-891.885] (-894.809) (-895.266) (-891.498) -- 0:00:59
      580000 -- (-891.694) [-890.575] (-889.302) (-893.827) * [-901.922] (-899.490) (-891.470) (-891.595) -- 0:00:59

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-894.980) (-887.449) (-890.109) [-891.998] * (-892.188) (-890.688) (-891.416) [-892.544] -- 0:00:59
      581000 -- (-893.334) (-891.380) (-892.054) [-892.655] * (-898.085) [-893.093] (-891.707) (-892.756) -- 0:00:59
      581500 -- (-892.005) [-888.017] (-889.913) (-894.666) * (-898.928) (-889.504) (-889.040) [-888.080] -- 0:00:59
      582000 -- [-886.965] (-895.807) (-889.137) (-891.653) * [-891.899] (-893.129) (-894.487) (-888.315) -- 0:00:59
      582500 -- (-887.608) [-890.719] (-895.009) (-892.441) * (-896.926) (-892.315) (-892.654) [-894.383] -- 0:00:59
      583000 -- (-894.253) (-891.042) [-887.968] (-889.997) * (-897.749) (-895.900) (-901.205) [-893.278] -- 0:00:59
      583500 -- [-891.943] (-893.720) (-889.396) (-889.042) * (-891.781) [-892.746] (-894.241) (-894.079) -- 0:00:59
      584000 -- (-891.482) [-898.213] (-890.063) (-893.853) * (-892.082) (-888.723) (-898.631) [-893.623] -- 0:00:59
      584500 -- (-895.884) (-890.482) [-890.279] (-895.858) * (-891.925) (-891.700) [-892.135] (-891.863) -- 0:00:59
      585000 -- [-887.567] (-892.884) (-891.757) (-890.421) * [-889.980] (-893.972) (-890.359) (-894.903) -- 0:00:58

      Average standard deviation of split frequencies: 0.001609

      585500 -- (-890.198) (-889.279) [-893.312] (-891.503) * (-891.771) (-892.804) [-894.150] (-896.079) -- 0:00:58
      586000 -- (-894.457) (-901.695) (-893.778) [-887.133] * [-889.996] (-893.801) (-893.567) (-894.700) -- 0:00:58
      586500 -- (-896.337) [-896.319] (-888.388) (-895.338) * (-890.603) [-889.020] (-894.069) (-893.895) -- 0:00:58
      587000 -- (-892.547) [-899.541] (-886.021) (-891.857) * (-894.526) [-891.293] (-892.128) (-888.940) -- 0:00:58
      587500 -- (-893.659) (-895.757) [-894.501] (-896.209) * (-891.439) [-889.471] (-895.751) (-888.746) -- 0:00:58
      588000 -- (-890.098) (-894.420) [-889.703] (-889.343) * (-890.075) (-893.478) (-896.575) [-890.243] -- 0:00:58
      588500 -- (-891.181) (-892.700) [-888.054] (-890.200) * (-891.072) [-890.517] (-898.262) (-889.086) -- 0:00:58
      589000 -- (-890.600) [-892.120] (-890.091) (-895.250) * (-892.049) [-888.518] (-894.634) (-891.948) -- 0:00:58
      589500 -- [-889.191] (-890.706) (-901.672) (-892.773) * (-893.271) (-894.623) (-892.264) [-892.336] -- 0:00:58
      590000 -- [-894.931] (-893.486) (-892.684) (-891.955) * (-894.791) (-889.538) [-891.761] (-889.799) -- 0:00:58

      Average standard deviation of split frequencies: 0.002394

      590500 -- (-891.312) (-890.547) (-894.517) [-891.179] * (-892.407) [-894.041] (-889.629) (-891.871) -- 0:00:58
      591000 -- (-891.191) (-891.437) (-898.674) [-890.827] * (-897.012) (-903.586) [-897.425] (-898.142) -- 0:00:58
      591500 -- [-892.943] (-889.869) (-895.557) (-901.662) * (-900.984) [-891.420] (-895.323) (-888.385) -- 0:00:58
      592000 -- [-888.449] (-889.901) (-894.798) (-894.853) * (-891.443) (-889.180) [-889.747] (-896.395) -- 0:00:57
      592500 -- (-894.816) [-892.120] (-893.470) (-890.434) * (-892.976) (-891.090) [-893.082] (-894.807) -- 0:00:57
      593000 -- (-892.393) (-891.498) (-895.186) [-890.292] * [-891.002] (-896.895) (-889.937) (-889.780) -- 0:00:57
      593500 -- (-891.924) (-895.831) [-891.994] (-891.950) * (-893.461) [-891.540] (-887.938) (-888.991) -- 0:00:57
      594000 -- [-888.527] (-889.416) (-895.899) (-893.750) * (-892.970) (-893.338) [-891.543] (-894.439) -- 0:00:57
      594500 -- (-889.327) (-890.023) (-890.166) [-892.759] * (-890.419) (-899.839) [-896.100] (-894.343) -- 0:00:57
      595000 -- [-892.352] (-888.693) (-893.561) (-892.043) * [-889.319] (-898.589) (-891.587) (-888.186) -- 0:00:57

      Average standard deviation of split frequencies: 0.004746

      595500 -- (-894.024) [-890.072] (-892.510) (-897.516) * [-888.790] (-895.013) (-895.843) (-890.453) -- 0:00:57
      596000 -- (-893.282) (-893.090) [-890.177] (-892.671) * (-893.303) (-900.660) (-892.556) [-890.096] -- 0:00:57
      596500 -- [-893.309] (-891.728) (-894.202) (-899.132) * (-888.786) [-893.819] (-895.200) (-888.316) -- 0:00:57
      597000 -- (-906.066) (-888.306) (-889.898) [-890.535] * [-889.069] (-903.400) (-897.167) (-889.622) -- 0:00:57
      597500 -- (-906.533) (-895.333) [-890.361] (-894.560) * (-889.806) (-899.037) [-893.422] (-889.402) -- 0:00:57
      598000 -- (-900.237) [-891.536] (-890.778) (-892.870) * (-892.012) (-892.098) [-889.414] (-892.552) -- 0:00:57
      598500 -- (-899.371) [-890.190] (-890.119) (-896.665) * (-891.326) (-889.918) (-889.843) [-896.955] -- 0:00:57
      599000 -- (-893.618) (-887.736) [-890.367] (-899.387) * (-894.015) (-899.442) [-891.149] (-891.479) -- 0:00:56
      599500 -- (-897.997) (-892.997) (-890.825) [-896.328] * [-887.559] (-898.417) (-891.219) (-894.764) -- 0:00:56
      600000 -- [-897.949] (-892.927) (-889.603) (-893.507) * (-894.019) (-894.308) [-893.522] (-895.613) -- 0:00:56

      Average standard deviation of split frequencies: 0.004709

      600500 -- (-893.627) [-892.678] (-888.284) (-892.905) * (-893.521) (-892.549) (-893.138) [-888.028] -- 0:00:56
      601000 -- (-892.027) (-888.784) [-888.328] (-894.006) * (-894.249) (-895.837) [-889.868] (-891.245) -- 0:00:56
      601500 -- (-888.461) [-890.533] (-891.190) (-891.368) * (-892.414) (-899.159) (-892.833) [-893.341] -- 0:00:56
      602000 -- (-891.642) (-891.247) [-892.618] (-893.542) * (-895.536) (-899.321) (-894.070) [-888.281] -- 0:00:56
      602500 -- [-890.608] (-890.464) (-893.404) (-893.080) * (-894.567) [-895.068] (-903.458) (-892.308) -- 0:00:56
      603000 -- [-896.824] (-894.722) (-896.442) (-888.142) * (-890.584) (-900.820) [-891.011] (-890.688) -- 0:00:56
      603500 -- (-895.605) (-891.680) [-888.159] (-895.494) * (-894.982) (-895.981) (-892.092) [-892.520] -- 0:00:56
      604000 -- (-891.576) (-893.172) (-895.030) [-891.247] * (-890.689) [-893.136] (-892.118) (-894.672) -- 0:00:56
      604500 -- (-891.684) [-891.589] (-893.361) (-894.173) * (-890.846) (-896.802) [-891.360] (-894.322) -- 0:00:56
      605000 -- (-891.680) (-889.730) (-892.753) [-895.098] * (-890.975) (-894.524) (-892.845) [-890.241] -- 0:00:56

      Average standard deviation of split frequencies: 0.003889

      605500 -- (-893.004) (-896.454) [-891.360] (-895.295) * (-891.187) (-894.536) [-897.471] (-891.255) -- 0:00:56
      606000 -- [-890.909] (-897.817) (-893.602) (-890.169) * [-888.635] (-895.842) (-889.758) (-893.334) -- 0:00:55
      606500 -- (-893.671) [-893.126] (-893.722) (-887.740) * (-889.772) (-894.679) [-891.410] (-898.013) -- 0:00:55
      607000 -- (-889.637) [-888.603] (-894.596) (-892.624) * (-889.628) (-897.891) (-894.494) [-898.403] -- 0:00:55
      607500 -- (-892.490) (-891.237) (-890.357) [-891.730] * (-889.373) (-895.258) [-895.708] (-891.057) -- 0:00:55
      608000 -- [-887.430] (-892.079) (-890.990) (-890.657) * (-895.454) (-894.752) [-891.962] (-891.272) -- 0:00:55
      608500 -- (-888.202) (-893.909) (-891.810) [-892.589] * [-895.942] (-893.610) (-889.000) (-892.330) -- 0:00:55
      609000 -- (-895.223) (-892.784) (-894.515) [-892.788] * (-890.370) [-892.111] (-890.899) (-892.035) -- 0:00:55
      609500 -- [-893.599] (-889.407) (-895.763) (-891.303) * (-890.622) [-890.300] (-893.005) (-888.275) -- 0:00:55
      610000 -- (-898.517) (-896.475) (-890.887) [-889.446] * (-892.147) (-892.317) (-891.610) [-889.576] -- 0:00:55

      Average standard deviation of split frequencies: 0.004632

      610500 -- [-895.337] (-889.877) (-890.741) (-890.673) * (-894.720) (-887.756) (-895.500) [-889.390] -- 0:00:55
      611000 -- (-891.540) (-898.351) [-893.456] (-895.415) * (-893.837) [-889.116] (-890.273) (-891.282) -- 0:00:55
      611500 -- (-891.081) [-890.666] (-889.138) (-894.201) * (-895.403) (-891.000) [-889.158] (-890.206) -- 0:00:55
      612000 -- (-888.310) (-890.604) [-895.013] (-892.444) * (-898.399) (-896.527) [-888.526] (-894.279) -- 0:00:55
      612500 -- (-891.090) [-892.844] (-899.396) (-893.270) * (-892.027) (-892.042) (-890.507) [-890.330] -- 0:00:55
      613000 -- [-892.468] (-891.484) (-893.893) (-897.701) * (-890.165) (-889.325) [-889.558] (-893.619) -- 0:00:54
      613500 -- (-896.693) (-887.839) [-889.683] (-891.990) * (-892.582) (-895.996) [-888.716] (-894.393) -- 0:00:54
      614000 -- (-898.252) (-894.749) (-894.045) [-889.771] * (-889.037) (-891.131) [-889.328] (-890.933) -- 0:00:54
      614500 -- (-895.358) (-894.557) [-889.742] (-892.189) * (-890.456) [-891.801] (-894.771) (-894.432) -- 0:00:54
      615000 -- (-891.050) (-898.298) (-889.836) [-889.860] * (-889.705) (-890.179) (-899.474) [-892.152] -- 0:00:54

      Average standard deviation of split frequencies: 0.006887

      615500 -- [-892.439] (-890.959) (-891.308) (-896.570) * (-889.905) (-888.411) (-894.448) [-887.523] -- 0:00:54
      616000 -- (-891.061) [-889.101] (-891.343) (-897.459) * (-894.934) [-889.722] (-889.845) (-891.242) -- 0:00:54
      616500 -- (-894.462) (-893.740) [-893.995] (-895.588) * (-892.627) (-891.158) (-892.079) [-892.258] -- 0:00:54
      617000 -- (-891.392) (-891.592) [-890.291] (-897.637) * [-894.540] (-888.814) (-894.588) (-893.951) -- 0:00:54
      617500 -- (-891.951) (-896.294) [-892.922] (-895.880) * (-890.797) (-887.493) [-892.913] (-889.305) -- 0:00:54
      618000 -- (-892.534) (-891.532) [-892.923] (-894.629) * (-891.252) (-891.050) (-892.923) [-889.444] -- 0:00:54
      618500 -- [-891.452] (-892.497) (-892.488) (-891.365) * [-894.345] (-893.603) (-898.411) (-892.851) -- 0:00:54
      619000 -- (-890.366) (-888.658) [-898.756] (-890.358) * (-894.475) (-889.132) [-895.413] (-892.386) -- 0:00:54
      619500 -- (-893.168) (-890.413) (-901.023) [-893.631] * (-891.435) [-891.464] (-898.105) (-890.391) -- 0:00:54
      620000 -- (-891.245) [-891.118] (-903.238) (-894.879) * (-886.882) [-893.712] (-890.577) (-895.799) -- 0:00:53

      Average standard deviation of split frequencies: 0.006836

      620500 -- (-889.836) (-889.451) [-892.932] (-893.871) * (-894.082) (-890.634) (-895.885) [-894.425] -- 0:00:53
      621000 -- (-887.347) (-892.129) [-890.871] (-898.012) * (-890.728) (-899.153) (-890.789) [-895.363] -- 0:00:53
      621500 -- (-891.431) [-891.593] (-892.004) (-894.289) * [-890.441] (-900.367) (-894.136) (-893.305) -- 0:00:53
      622000 -- (-893.974) [-893.970] (-892.009) (-892.737) * (-892.317) [-890.467] (-892.659) (-893.391) -- 0:00:53
      622500 -- (-896.204) [-893.964] (-892.396) (-899.661) * [-890.060] (-890.966) (-891.594) (-889.808) -- 0:00:53
      623000 -- [-896.979] (-893.982) (-889.730) (-903.520) * [-889.919] (-890.500) (-891.371) (-892.747) -- 0:00:53
      623500 -- (-893.146) (-894.753) [-889.740] (-902.188) * (-893.044) (-890.249) (-892.736) [-895.627] -- 0:00:53
      624000 -- (-893.578) [-890.395] (-890.285) (-897.476) * [-888.776] (-892.744) (-891.263) (-893.710) -- 0:00:53
      624500 -- (-895.545) [-893.964] (-891.340) (-897.646) * (-888.310) (-893.655) [-890.814] (-893.483) -- 0:00:53
      625000 -- [-892.096] (-898.254) (-897.571) (-892.818) * (-890.175) (-896.958) [-894.004] (-892.392) -- 0:00:53

      Average standard deviation of split frequencies: 0.004518

      625500 -- (-888.406) (-891.085) (-891.786) [-892.033] * [-889.148] (-898.066) (-890.988) (-889.478) -- 0:00:53
      626000 -- (-888.712) (-894.432) (-888.102) [-890.650] * (-896.702) (-892.842) [-891.007] (-888.220) -- 0:00:53
      626500 -- (-894.192) [-890.583] (-899.445) (-891.636) * (-890.235) (-892.976) (-889.346) [-888.717] -- 0:00:53
      627000 -- (-893.042) (-894.171) [-890.941] (-893.671) * [-890.051] (-896.222) (-894.819) (-889.152) -- 0:00:52
      627500 -- [-889.871] (-891.990) (-896.119) (-896.090) * (-894.299) (-889.510) [-890.408] (-888.956) -- 0:00:52
      628000 -- [-896.300] (-893.102) (-894.276) (-894.711) * (-890.146) [-890.392] (-893.379) (-894.459) -- 0:00:52
      628500 -- (-893.970) [-890.477] (-891.904) (-904.882) * (-890.630) [-890.357] (-891.418) (-894.546) -- 0:00:52
      629000 -- (-892.675) (-892.190) [-892.250] (-898.701) * (-892.062) [-890.779] (-898.742) (-894.877) -- 0:00:52
      629500 -- (-895.029) [-893.056] (-892.885) (-896.506) * [-888.576] (-896.459) (-901.305) (-888.698) -- 0:00:52
      630000 -- (-889.306) (-892.230) (-897.762) [-891.705] * (-888.937) (-890.106) [-895.004] (-894.675) -- 0:00:52

      Average standard deviation of split frequencies: 0.004485

      630500 -- (-888.851) (-894.898) (-891.011) [-891.846] * (-894.006) (-896.345) [-894.595] (-887.149) -- 0:00:52
      631000 -- (-890.884) [-889.965] (-890.548) (-892.011) * (-895.314) (-895.655) (-890.087) [-889.679] -- 0:00:52
      631500 -- (-888.492) (-890.187) [-890.340] (-891.753) * (-894.735) (-892.869) (-891.454) [-886.768] -- 0:00:52
      632000 -- (-890.652) (-887.170) (-891.991) [-892.382] * [-890.566] (-891.558) (-894.126) (-896.624) -- 0:00:52
      632500 -- (-894.855) (-892.210) (-892.545) [-892.796] * (-891.267) [-890.360] (-892.211) (-892.809) -- 0:00:52
      633000 -- [-890.225] (-889.922) (-888.922) (-899.982) * (-890.912) (-890.309) [-892.464] (-896.035) -- 0:00:52
      633500 -- (-890.329) (-891.493) [-899.754] (-892.828) * (-891.046) (-891.907) [-888.887] (-888.777) -- 0:00:52
      634000 -- (-889.753) [-893.350] (-891.336) (-893.446) * [-891.568] (-893.615) (-894.068) (-895.352) -- 0:00:51
      634500 -- (-889.738) (-891.449) [-890.343] (-895.090) * (-895.863) (-891.455) [-890.837] (-891.936) -- 0:00:51
      635000 -- (-891.387) (-896.906) [-890.557] (-896.808) * (-893.814) (-890.059) (-891.751) [-890.825] -- 0:00:51

      Average standard deviation of split frequencies: 0.003706

      635500 -- [-896.054] (-895.671) (-898.846) (-896.961) * (-895.638) [-890.633] (-892.266) (-888.087) -- 0:00:51
      636000 -- (-891.508) (-894.369) (-893.600) [-891.863] * (-890.179) (-891.128) [-890.994] (-893.727) -- 0:00:51
      636500 -- (-894.709) (-888.864) (-900.409) [-893.812] * (-890.359) (-895.950) (-892.877) [-893.524] -- 0:00:51
      637000 -- (-891.504) (-894.330) (-897.156) [-889.395] * (-889.982) (-894.044) [-889.063] (-891.136) -- 0:00:51
      637500 -- [-889.926] (-890.051) (-893.651) (-892.764) * (-894.444) (-891.902) (-893.480) [-899.110] -- 0:00:51
      638000 -- (-888.772) (-890.159) (-893.811) [-889.194] * (-894.024) [-891.302] (-893.096) (-889.789) -- 0:00:51
      638500 -- (-893.358) (-892.384) [-890.381] (-894.127) * [-891.222] (-892.444) (-895.131) (-886.383) -- 0:00:51
      639000 -- [-895.739] (-891.922) (-893.726) (-893.532) * (-889.156) [-894.917] (-894.713) (-891.080) -- 0:00:51
      639500 -- (-891.549) (-893.480) (-893.222) [-889.918] * [-894.167] (-891.430) (-890.768) (-887.828) -- 0:00:51
      640000 -- [-892.610] (-888.014) (-898.273) (-893.814) * (-890.674) (-893.274) [-891.726] (-892.971) -- 0:00:51

      Average standard deviation of split frequencies: 0.003679

      640500 -- (-891.204) (-890.219) (-895.149) [-895.813] * (-892.267) (-898.774) [-889.088] (-896.073) -- 0:00:51
      641000 -- [-888.936] (-890.910) (-890.503) (-893.103) * [-894.130] (-890.549) (-895.989) (-894.786) -- 0:00:50
      641500 -- [-892.397] (-895.342) (-896.486) (-890.070) * [-888.081] (-891.095) (-893.337) (-892.163) -- 0:00:50
      642000 -- (-893.863) (-890.820) (-898.792) [-891.127] * (-896.052) (-895.447) [-887.945] (-889.855) -- 0:00:50
      642500 -- (-892.086) (-891.178) [-892.400] (-893.939) * (-888.226) (-894.706) [-889.577] (-890.075) -- 0:00:50
      643000 -- (-895.552) (-891.098) [-892.907] (-893.014) * [-890.509] (-899.037) (-894.788) (-890.690) -- 0:00:50
      643500 -- (-892.102) (-889.983) (-894.737) [-902.571] * (-890.733) (-893.250) (-891.585) [-894.691] -- 0:00:50
      644000 -- [-891.291] (-895.203) (-889.965) (-901.153) * (-887.610) (-899.734) [-892.624] (-889.811) -- 0:00:50
      644500 -- (-890.348) (-901.389) [-893.294] (-894.921) * (-895.569) (-893.140) [-890.755] (-893.775) -- 0:00:50
      645000 -- [-892.793] (-897.854) (-896.081) (-892.615) * [-890.247] (-900.420) (-887.883) (-891.487) -- 0:00:50

      Average standard deviation of split frequencies: 0.005108

      645500 -- (-892.450) (-890.356) [-896.034] (-896.486) * (-888.148) (-894.653) [-891.693] (-887.684) -- 0:00:50
      646000 -- (-891.364) (-889.604) (-889.303) [-894.716] * (-890.207) [-890.342] (-894.594) (-888.975) -- 0:00:50
      646500 -- (-892.780) [-888.829] (-888.719) (-894.987) * (-888.093) (-893.347) (-889.812) [-891.611] -- 0:00:50
      647000 -- (-891.352) [-889.636] (-890.544) (-894.852) * (-891.116) (-891.036) (-889.146) [-895.820] -- 0:00:50
      647500 -- [-893.532] (-890.157) (-897.439) (-900.173) * [-891.868] (-893.504) (-895.533) (-893.802) -- 0:00:50
      648000 -- (-891.634) (-889.268) (-892.801) [-893.093] * (-891.184) [-893.284] (-894.559) (-893.416) -- 0:00:49
      648500 -- (-899.817) (-896.261) [-894.576] (-896.404) * (-887.770) (-890.550) (-898.753) [-891.040] -- 0:00:49
      649000 -- (-891.670) (-892.712) (-893.399) [-892.013] * (-898.138) [-894.333] (-894.727) (-892.722) -- 0:00:49
      649500 -- (-891.344) (-893.023) [-891.035] (-892.055) * (-893.010) (-893.697) [-892.101] (-890.074) -- 0:00:49
      650000 -- [-892.527] (-889.464) (-889.931) (-889.899) * (-896.319) [-889.316] (-893.667) (-891.787) -- 0:00:49

      Average standard deviation of split frequencies: 0.005796

      650500 -- (-898.390) (-887.769) (-892.561) [-891.560] * (-891.988) [-890.687] (-891.932) (-890.528) -- 0:00:49
      651000 -- (-894.420) [-891.073] (-896.685) (-896.231) * (-895.227) [-888.218] (-894.255) (-894.330) -- 0:00:49
      651500 -- (-890.425) (-892.762) (-895.691) [-891.343] * (-894.085) [-893.559] (-895.600) (-891.530) -- 0:00:49
      652000 -- (-897.575) [-897.507] (-895.349) (-892.407) * (-891.611) [-888.555] (-892.703) (-891.064) -- 0:00:49
      652500 -- (-900.856) [-888.641] (-893.710) (-889.610) * (-890.079) [-889.141] (-893.369) (-896.021) -- 0:00:49
      653000 -- (-893.645) (-888.427) (-892.438) [-891.149] * (-888.829) (-891.041) (-890.076) [-890.912] -- 0:00:49
      653500 -- (-891.933) [-889.532] (-891.479) (-894.091) * (-887.304) (-893.090) (-902.009) [-890.973] -- 0:00:49
      654000 -- (-894.200) (-895.039) (-891.515) [-889.651] * (-893.155) (-887.035) (-888.087) [-893.461] -- 0:00:49
      654500 -- (-892.959) [-893.071] (-892.077) (-889.998) * (-891.958) [-889.438] (-889.014) (-893.012) -- 0:00:49
      655000 -- [-891.367] (-895.828) (-896.787) (-889.263) * [-892.750] (-896.087) (-890.452) (-890.687) -- 0:00:48

      Average standard deviation of split frequencies: 0.005749

      655500 -- [-889.494] (-893.459) (-892.561) (-890.813) * [-888.848] (-899.985) (-890.924) (-891.066) -- 0:00:48
      656000 -- (-890.407) (-889.476) (-893.230) [-893.472] * (-900.471) (-893.804) (-895.016) [-893.154] -- 0:00:48
      656500 -- [-891.569] (-893.361) (-889.373) (-891.354) * (-895.640) (-893.966) [-890.787] (-889.857) -- 0:00:48
      657000 -- (-892.646) (-892.749) [-890.199] (-891.040) * [-891.391] (-897.960) (-897.862) (-895.046) -- 0:00:48
      657500 -- (-898.333) (-892.475) (-894.557) [-892.034] * (-887.711) (-895.376) (-894.900) [-896.258] -- 0:00:48
      658000 -- (-894.727) (-894.845) (-893.331) [-891.131] * (-895.366) (-893.795) (-893.220) [-889.675] -- 0:00:48
      658500 -- [-897.270] (-891.657) (-891.135) (-896.277) * (-894.718) [-892.465] (-889.591) (-890.611) -- 0:00:48
      659000 -- (-890.982) (-888.508) (-900.990) [-895.861] * [-892.021] (-895.648) (-891.534) (-891.690) -- 0:00:48
      659500 -- [-891.630] (-893.207) (-887.857) (-905.311) * (-894.463) (-896.769) (-890.659) [-891.939] -- 0:00:48
      660000 -- [-892.375] (-893.323) (-890.009) (-894.709) * (-895.329) (-894.329) [-895.399] (-888.843) -- 0:00:48

      Average standard deviation of split frequencies: 0.005708

      660500 -- (-889.668) [-898.916] (-889.566) (-892.151) * (-893.120) [-893.951] (-888.587) (-890.822) -- 0:00:48
      661000 -- (-895.036) [-893.420] (-895.958) (-894.972) * (-893.054) [-891.810] (-893.393) (-888.943) -- 0:00:48
      661500 -- (-890.930) (-892.900) (-893.208) [-890.410] * (-900.673) (-889.974) [-893.744] (-892.922) -- 0:00:48
      662000 -- (-888.132) (-891.380) [-889.973] (-889.383) * (-892.229) [-896.920] (-892.454) (-889.030) -- 0:00:47
      662500 -- [-892.429] (-892.412) (-895.788) (-893.210) * [-893.641] (-893.814) (-890.522) (-895.397) -- 0:00:47
      663000 -- (-890.000) (-891.336) (-893.830) [-892.104] * [-893.661] (-894.567) (-888.788) (-893.032) -- 0:00:47
      663500 -- (-894.865) (-893.799) (-891.841) [-890.145] * (-895.199) (-891.674) (-894.567) [-895.130] -- 0:00:47
      664000 -- [-892.819] (-889.240) (-891.404) (-892.214) * (-894.352) (-891.044) (-894.560) [-893.584] -- 0:00:48
      664500 -- (-893.212) (-893.340) (-895.372) [-891.699] * (-892.162) [-890.805] (-892.210) (-889.768) -- 0:00:47
      665000 -- [-887.373] (-892.430) (-894.504) (-890.967) * [-897.045] (-892.283) (-892.299) (-897.512) -- 0:00:47

      Average standard deviation of split frequencies: 0.006370

      665500 -- (-889.498) (-895.087) [-891.731] (-893.275) * (-895.339) (-894.135) [-892.387] (-893.640) -- 0:00:47
      666000 -- (-893.752) (-889.254) [-891.833] (-892.426) * (-889.317) (-898.080) (-889.566) [-894.358] -- 0:00:47
      666500 -- (-892.291) (-893.727) [-890.365] (-891.149) * [-890.334] (-891.576) (-894.774) (-888.668) -- 0:00:47
      667000 -- [-888.596] (-892.606) (-891.656) (-893.091) * (-896.193) [-887.464] (-891.072) (-890.606) -- 0:00:47
      667500 -- (-891.967) (-896.290) (-889.961) [-889.144] * (-894.465) [-894.753] (-889.851) (-895.304) -- 0:00:47
      668000 -- (-895.061) (-891.331) (-891.456) [-888.794] * (-889.220) (-898.727) [-888.514] (-899.423) -- 0:00:47
      668500 -- (-892.449) (-889.230) [-890.311] (-892.229) * [-893.173] (-892.562) (-892.743) (-890.559) -- 0:00:47
      669000 -- (-895.340) [-890.144] (-896.725) (-890.117) * (-893.448) (-890.787) (-890.395) [-896.449] -- 0:00:47
      669500 -- (-893.975) [-888.956] (-896.151) (-889.314) * (-895.462) (-889.252) (-890.097) [-891.426] -- 0:00:46
      670000 -- (-890.702) [-891.951] (-889.426) (-889.423) * [-892.567] (-894.354) (-888.830) (-894.982) -- 0:00:46

      Average standard deviation of split frequencies: 0.005623

      670500 -- (-890.131) (-892.980) (-894.309) [-892.340] * (-890.140) [-895.182] (-894.403) (-897.860) -- 0:00:46
      671000 -- (-893.362) (-889.644) (-890.356) [-888.587] * [-890.604] (-890.671) (-897.139) (-894.213) -- 0:00:47
      671500 -- (-894.657) (-889.564) [-889.111] (-894.763) * (-893.531) (-893.397) [-893.847] (-891.447) -- 0:00:46
      672000 -- (-892.488) (-892.123) [-889.135] (-890.782) * [-893.761] (-890.930) (-889.533) (-892.734) -- 0:00:46
      672500 -- (-888.469) (-892.602) [-897.535] (-890.754) * [-890.113] (-891.502) (-900.104) (-893.374) -- 0:00:46
      673000 -- (-893.381) (-890.157) [-890.366] (-888.769) * [-892.131] (-890.138) (-892.706) (-891.086) -- 0:00:46
      673500 -- (-893.546) [-894.200] (-894.223) (-888.096) * [-887.410] (-886.928) (-894.400) (-893.351) -- 0:00:46
      674000 -- [-889.687] (-888.079) (-897.458) (-893.555) * (-888.297) (-895.464) (-896.653) [-889.468] -- 0:00:46
      674500 -- (-893.278) (-892.232) (-890.091) [-890.138] * (-889.322) [-894.331] (-891.181) (-895.203) -- 0:00:46
      675000 -- (-892.624) [-888.268] (-895.265) (-894.802) * (-891.391) (-891.119) [-890.017] (-892.905) -- 0:00:46

      Average standard deviation of split frequencies: 0.004881

      675500 -- (-892.577) (-890.046) (-893.372) [-895.953] * [-893.455] (-894.193) (-898.752) (-889.952) -- 0:00:46
      676000 -- (-891.424) (-895.599) [-889.025] (-896.430) * (-889.903) [-887.077] (-897.291) (-895.242) -- 0:00:46
      676500 -- (-896.271) [-890.976] (-889.435) (-894.069) * (-890.975) [-888.513] (-891.242) (-895.271) -- 0:00:45
      677000 -- [-891.129] (-891.012) (-890.323) (-903.669) * (-890.942) [-893.894] (-892.547) (-895.261) -- 0:00:45
      677500 -- [-895.350] (-892.807) (-893.026) (-890.520) * (-896.079) [-892.849] (-890.559) (-896.812) -- 0:00:45
      678000 -- (-890.397) [-891.083] (-894.461) (-890.672) * (-895.843) (-894.093) (-888.054) [-889.073] -- 0:00:46
      678500 -- (-893.357) (-892.490) (-893.675) [-889.474] * (-889.920) [-892.710] (-891.594) (-891.079) -- 0:00:45
      679000 -- [-890.306] (-895.025) (-889.502) (-892.585) * (-891.688) (-891.813) (-892.612) [-889.928] -- 0:00:45
      679500 -- [-889.346] (-893.802) (-891.684) (-887.977) * [-890.443] (-897.229) (-895.804) (-894.404) -- 0:00:45
      680000 -- [-889.177] (-893.131) (-889.820) (-891.604) * (-895.159) [-890.928] (-891.602) (-895.122) -- 0:00:45

      Average standard deviation of split frequencies: 0.004848

      680500 -- (-893.413) (-892.040) [-893.004] (-892.660) * [-889.896] (-890.766) (-891.619) (-894.844) -- 0:00:45
      681000 -- (-893.940) (-893.423) [-889.515] (-891.938) * (-894.052) [-889.885] (-894.662) (-891.620) -- 0:00:45
      681500 -- (-895.968) (-890.704) (-889.490) [-890.279] * [-891.611] (-892.795) (-895.689) (-891.262) -- 0:00:45
      682000 -- (-896.651) [-888.953] (-892.959) (-894.075) * [-891.479] (-891.368) (-895.398) (-892.364) -- 0:00:45
      682500 -- (-895.862) (-892.700) [-891.914] (-892.806) * [-891.693] (-896.442) (-891.503) (-898.587) -- 0:00:45
      683000 -- (-887.603) [-887.751] (-894.391) (-893.227) * (-888.866) (-891.902) (-893.863) [-902.787] -- 0:00:45
      683500 -- (-892.017) (-889.771) (-893.189) [-889.331] * (-888.663) [-891.503] (-889.283) (-893.762) -- 0:00:44
      684000 -- (-893.974) (-894.879) (-895.341) [-891.060] * (-891.495) (-888.927) [-889.992] (-894.487) -- 0:00:44
      684500 -- (-891.748) [-892.391] (-893.085) (-892.917) * (-896.057) (-892.765) (-892.560) [-892.803] -- 0:00:44
      685000 -- [-893.475] (-895.246) (-889.318) (-890.685) * (-901.734) (-890.080) [-887.885] (-889.420) -- 0:00:45

      Average standard deviation of split frequencies: 0.004810

      685500 -- [-889.163] (-894.921) (-889.691) (-896.932) * (-898.556) [-894.139] (-889.663) (-898.283) -- 0:00:44
      686000 -- (-888.493) (-890.806) [-889.867] (-894.841) * (-899.404) [-894.728] (-890.328) (-894.908) -- 0:00:44
      686500 -- (-894.312) [-894.733] (-891.579) (-893.396) * (-893.630) (-892.357) (-889.841) [-894.706] -- 0:00:44
      687000 -- (-891.293) [-893.981] (-890.489) (-891.859) * (-891.081) (-888.564) (-891.343) [-896.303] -- 0:00:44
      687500 -- (-892.227) (-890.497) [-889.933] (-901.749) * (-891.349) [-887.760] (-889.954) (-894.716) -- 0:00:44
      688000 -- [-894.360] (-892.447) (-895.469) (-896.893) * (-890.695) (-891.382) (-888.809) [-894.006] -- 0:00:44
      688500 -- (-889.134) [-888.379] (-891.284) (-896.990) * (-893.212) (-888.295) (-890.964) [-889.408] -- 0:00:44
      689000 -- (-890.512) (-901.234) [-895.729] (-894.997) * (-897.182) [-894.024] (-892.569) (-896.295) -- 0:00:44
      689500 -- [-894.363] (-896.766) (-888.105) (-890.072) * (-891.760) [-888.008] (-888.795) (-894.465) -- 0:00:44
      690000 -- (-894.065) (-897.201) [-889.462] (-892.924) * [-890.582] (-889.441) (-891.181) (-890.713) -- 0:00:44

      Average standard deviation of split frequencies: 0.006143

      690500 -- (-890.413) (-896.126) (-897.255) [-887.194] * (-892.204) (-890.975) [-897.588] (-891.760) -- 0:00:43
      691000 -- (-887.433) (-891.456) [-899.187] (-891.288) * (-891.420) [-889.758] (-891.930) (-890.499) -- 0:00:43
      691500 -- [-888.162] (-894.791) (-894.131) (-894.535) * (-887.655) (-888.726) [-888.725] (-891.439) -- 0:00:43
      692000 -- (-890.309) [-891.878] (-893.042) (-892.415) * (-890.274) (-890.343) (-888.444) [-889.177] -- 0:00:44
      692500 -- [-893.360] (-892.676) (-891.157) (-893.056) * (-891.659) (-891.670) (-893.853) [-893.327] -- 0:00:43
      693000 -- (-896.695) (-888.192) [-890.998] (-892.159) * (-895.786) (-895.274) [-892.468] (-896.076) -- 0:00:43
      693500 -- [-894.418] (-894.344) (-893.439) (-894.160) * (-895.729) [-894.920] (-892.373) (-893.177) -- 0:00:43
      694000 -- (-895.141) (-890.630) [-888.834] (-897.843) * (-891.172) (-897.210) [-888.815] (-889.708) -- 0:00:43
      694500 -- (-892.035) (-888.573) [-893.503] (-890.268) * [-890.870] (-896.479) (-893.146) (-891.786) -- 0:00:43
      695000 -- (-890.657) (-891.286) [-893.741] (-894.488) * [-890.756] (-894.999) (-890.697) (-886.556) -- 0:00:43

      Average standard deviation of split frequencies: 0.005418

      695500 -- (-893.572) (-894.518) [-892.395] (-890.651) * (-897.727) (-893.214) (-895.684) [-890.371] -- 0:00:43
      696000 -- (-890.699) (-894.176) [-888.904] (-892.079) * (-891.769) [-891.282] (-892.389) (-889.693) -- 0:00:43
      696500 -- (-893.216) [-893.910] (-891.687) (-890.992) * (-892.661) (-892.455) (-888.407) [-892.558] -- 0:00:43
      697000 -- [-890.301] (-889.743) (-901.830) (-894.569) * (-896.150) (-893.475) [-889.716] (-892.346) -- 0:00:43
      697500 -- (-893.493) [-896.140] (-896.220) (-893.516) * [-892.683] (-889.689) (-892.428) (-890.496) -- 0:00:42
      698000 -- [-893.082] (-893.011) (-893.638) (-894.860) * (-889.279) [-896.801] (-892.619) (-890.744) -- 0:00:42
      698500 -- (-897.328) (-892.533) [-890.153] (-895.673) * (-892.015) (-895.158) [-894.093] (-887.847) -- 0:00:43
      699000 -- (-893.097) (-892.153) [-892.745] (-892.848) * (-890.813) (-890.513) (-894.218) [-891.446] -- 0:00:43
      699500 -- [-891.508] (-890.889) (-890.671) (-897.455) * (-890.415) (-894.315) (-890.256) [-890.073] -- 0:00:42
      700000 -- (-892.132) [-893.331] (-889.151) (-897.510) * (-894.614) (-898.113) (-888.661) [-898.317] -- 0:00:42

      Average standard deviation of split frequencies: 0.003364

      700500 -- (-894.047) [-891.802] (-900.134) (-894.800) * (-898.937) (-899.353) [-889.953] (-893.493) -- 0:00:42
      701000 -- (-892.802) [-893.474] (-892.235) (-895.835) * (-891.862) (-890.182) [-891.339] (-891.944) -- 0:00:42
      701500 -- [-887.567] (-894.397) (-889.524) (-898.499) * [-888.844] (-896.616) (-890.753) (-900.349) -- 0:00:42
      702000 -- (-892.320) (-894.028) (-894.815) [-893.962] * (-894.892) (-893.276) (-892.383) [-892.378] -- 0:00:42
      702500 -- [-888.952] (-895.390) (-890.567) (-894.040) * (-894.057) (-898.393) (-896.510) [-891.740] -- 0:00:42
      703000 -- (-896.929) [-889.460] (-889.963) (-892.920) * (-894.107) [-887.595] (-893.658) (-890.925) -- 0:00:42
      703500 -- (-896.408) (-894.783) (-893.816) [-895.772] * [-891.628] (-892.469) (-893.315) (-891.184) -- 0:00:42
      704000 -- (-893.371) [-888.521] (-891.249) (-897.900) * (-893.471) (-894.819) (-890.489) [-888.730] -- 0:00:42
      704500 -- [-892.394] (-893.478) (-890.533) (-896.980) * [-890.153] (-893.165) (-890.841) (-889.881) -- 0:00:41
      705000 -- (-889.864) [-893.175] (-889.541) (-891.589) * [-890.077] (-893.273) (-890.140) (-894.628) -- 0:00:41

      Average standard deviation of split frequencies: 0.003339

      705500 -- (-889.328) [-889.917] (-889.776) (-890.633) * [-891.681] (-892.762) (-887.724) (-891.172) -- 0:00:42
      706000 -- [-889.994] (-893.115) (-891.911) (-892.444) * (-895.884) (-895.284) [-894.267] (-899.134) -- 0:00:42
      706500 -- (-896.937) (-891.456) [-889.516] (-891.575) * (-896.624) (-891.933) (-891.842) [-891.433] -- 0:00:41
      707000 -- (-888.785) (-893.266) (-891.544) [-889.233] * (-891.798) (-887.728) (-891.029) [-893.167] -- 0:00:41
      707500 -- [-893.174] (-891.726) (-894.418) (-889.591) * [-892.782] (-892.965) (-895.864) (-890.058) -- 0:00:41
      708000 -- (-887.992) (-892.133) [-891.318] (-894.424) * [-890.217] (-893.309) (-891.313) (-891.583) -- 0:00:41
      708500 -- (-897.592) [-890.794] (-891.650) (-892.351) * (-894.509) (-887.114) (-892.240) [-890.660] -- 0:00:41
      709000 -- (-891.669) [-888.283] (-895.951) (-890.538) * (-892.326) (-887.712) (-894.753) [-890.246] -- 0:00:41
      709500 -- (-891.728) (-897.165) [-891.686] (-898.300) * (-895.319) (-888.192) [-892.825] (-890.837) -- 0:00:41
      710000 -- (-890.425) (-890.582) [-894.929] (-892.944) * [-893.039] (-889.302) (-889.934) (-886.706) -- 0:00:41

      Average standard deviation of split frequencies: 0.002653

      710500 -- [-890.183] (-894.483) (-891.317) (-893.565) * [-891.955] (-888.392) (-890.361) (-890.738) -- 0:00:41
      711000 -- (-890.908) (-895.651) [-894.238] (-900.559) * (-904.782) (-890.939) [-890.338] (-897.469) -- 0:00:41
      711500 -- [-894.642] (-888.148) (-891.480) (-896.851) * (-896.464) (-892.114) (-891.091) [-891.490] -- 0:00:40
      712000 -- [-890.463] (-897.752) (-895.269) (-893.688) * (-889.523) [-892.748] (-888.587) (-895.993) -- 0:00:40
      712500 -- (-898.197) (-897.689) [-894.216] (-891.499) * (-892.457) (-894.635) [-892.159] (-890.583) -- 0:00:41
      713000 -- (-896.183) [-891.254] (-895.057) (-891.021) * (-894.219) (-894.405) [-887.632] (-896.198) -- 0:00:41
      713500 -- [-892.279] (-893.369) (-900.873) (-888.378) * (-890.357) (-893.386) (-893.080) [-892.177] -- 0:00:40
      714000 -- (-900.743) (-891.921) (-897.576) [-892.682] * [-890.632] (-895.475) (-895.251) (-893.589) -- 0:00:40
      714500 -- (-889.102) [-888.525] (-893.085) (-893.262) * [-895.581] (-896.257) (-892.920) (-894.916) -- 0:00:40
      715000 -- (-892.153) (-890.257) [-891.344] (-891.306) * (-896.690) (-897.204) [-893.841] (-889.569) -- 0:00:40

      Average standard deviation of split frequencies: 0.001975

      715500 -- (-897.864) [-893.947] (-888.837) (-890.267) * (-891.054) (-893.179) (-893.603) [-889.259] -- 0:00:40
      716000 -- (-892.003) (-893.685) [-889.265] (-889.312) * [-892.083] (-894.982) (-893.895) (-890.930) -- 0:00:40
      716500 -- (-896.387) (-889.474) [-890.036] (-892.245) * [-889.355] (-895.595) (-894.027) (-890.407) -- 0:00:40
      717000 -- (-890.386) [-890.164] (-890.575) (-892.739) * (-889.530) (-889.472) [-892.401] (-891.953) -- 0:00:40
      717500 -- (-888.385) (-890.996) (-889.389) [-889.163] * (-895.440) (-890.080) (-893.083) [-890.815] -- 0:00:40
      718000 -- (-890.193) (-891.214) (-889.782) [-898.355] * (-891.854) [-891.134] (-891.660) (-898.021) -- 0:00:40
      718500 -- (-893.710) (-893.596) (-891.849) [-894.026] * (-890.488) (-896.431) [-888.402] (-894.380) -- 0:00:39
      719000 -- (-893.603) (-897.253) (-894.337) [-892.982] * (-891.129) [-886.989] (-894.766) (-896.450) -- 0:00:39
      719500 -- [-891.361] (-893.043) (-891.341) (-893.744) * (-890.920) (-891.417) [-891.366] (-893.942) -- 0:00:40
      720000 -- [-890.403] (-895.243) (-892.573) (-894.563) * (-892.522) (-893.562) [-890.647] (-894.726) -- 0:00:40

      Average standard deviation of split frequencies: 0.001962

      720500 -- (-891.813) (-896.537) (-893.210) [-890.410] * [-892.621] (-893.545) (-891.622) (-895.898) -- 0:00:39
      721000 -- [-893.538] (-891.211) (-898.409) (-893.134) * (-892.549) [-891.009] (-895.317) (-901.331) -- 0:00:39
      721500 -- (-891.882) (-890.716) [-892.065] (-889.922) * (-893.546) (-895.500) (-893.677) [-890.373] -- 0:00:39
      722000 -- (-895.413) (-893.726) [-891.089] (-889.983) * (-891.035) [-894.037] (-890.921) (-889.415) -- 0:00:39
      722500 -- (-889.336) [-892.205] (-898.473) (-894.892) * (-892.126) [-889.734] (-889.570) (-890.158) -- 0:00:39
      723000 -- (-899.544) [-889.358] (-891.511) (-890.368) * (-888.284) [-892.330] (-896.101) (-890.418) -- 0:00:39
      723500 -- (-895.446) [-890.884] (-891.342) (-894.271) * (-889.701) (-893.880) (-894.313) [-892.398] -- 0:00:39
      724000 -- (-888.255) (-889.268) [-892.766] (-890.108) * [-888.120] (-891.274) (-891.641) (-892.197) -- 0:00:39
      724500 -- (-888.433) [-890.732] (-895.424) (-891.926) * (-891.185) [-890.044] (-899.131) (-897.388) -- 0:00:39
      725000 -- (-894.092) (-895.987) [-892.044] (-893.529) * (-891.491) (-890.563) (-895.957) [-890.019] -- 0:00:39

      Average standard deviation of split frequencies: 0.001948

      725500 -- [-893.914] (-894.964) (-897.557) (-889.552) * (-889.623) (-890.817) [-895.511] (-896.697) -- 0:00:38
      726000 -- [-892.173] (-890.821) (-892.855) (-891.639) * (-889.156) (-889.019) [-890.014] (-889.305) -- 0:00:38
      726500 -- (-891.685) [-889.417] (-887.124) (-892.538) * (-889.003) (-895.689) [-893.401] (-889.879) -- 0:00:39
      727000 -- [-890.618] (-890.576) (-889.897) (-890.393) * [-891.483] (-892.937) (-892.216) (-889.823) -- 0:00:39
      727500 -- [-891.420] (-889.677) (-888.085) (-891.395) * (-889.217) (-893.355) (-892.072) [-890.021] -- 0:00:38
      728000 -- [-896.417] (-889.877) (-890.481) (-891.174) * (-890.947) (-890.757) (-899.226) [-889.029] -- 0:00:38
      728500 -- (-889.473) [-889.513] (-890.999) (-897.396) * (-893.031) (-889.951) [-890.117] (-889.859) -- 0:00:38
      729000 -- (-892.300) (-891.276) [-892.769] (-888.715) * (-894.861) (-889.521) [-887.983] (-893.937) -- 0:00:38
      729500 -- (-889.894) [-891.931] (-893.594) (-896.852) * (-889.127) (-891.556) [-891.732] (-889.689) -- 0:00:38
      730000 -- (-893.307) (-892.075) [-890.204] (-898.724) * (-889.992) (-897.127) [-896.410] (-894.320) -- 0:00:38

      Average standard deviation of split frequencies: 0.002581

      730500 -- (-892.845) [-891.071] (-895.151) (-895.224) * [-891.470] (-894.092) (-890.674) (-889.447) -- 0:00:38
      731000 -- (-895.450) [-891.823] (-893.149) (-896.583) * (-899.012) [-894.437] (-893.394) (-891.156) -- 0:00:38
      731500 -- (-892.102) (-895.184) [-888.043] (-902.432) * (-893.255) (-899.062) (-892.758) [-891.433] -- 0:00:38
      732000 -- (-892.084) [-889.830] (-888.685) (-896.428) * (-897.945) (-896.402) (-894.170) [-888.366] -- 0:00:38
      732500 -- [-890.190] (-892.510) (-896.366) (-890.567) * [-888.603] (-889.185) (-890.558) (-892.962) -- 0:00:37
      733000 -- (-895.109) (-893.256) (-889.018) [-888.661] * (-896.086) (-896.389) [-891.536] (-892.106) -- 0:00:38
      733500 -- (-890.607) (-892.925) (-887.945) [-887.528] * (-891.355) (-893.986) (-891.975) [-888.770] -- 0:00:38
      734000 -- (-891.741) [-897.366] (-897.760) (-892.662) * (-892.523) (-889.192) (-891.282) [-887.233] -- 0:00:38
      734500 -- (-893.747) (-894.517) (-895.122) [-889.904] * (-892.313) (-890.411) [-888.562] (-890.557) -- 0:00:37
      735000 -- [-889.643] (-892.580) (-899.754) (-890.957) * (-888.690) (-892.046) (-889.944) [-892.745] -- 0:00:37

      Average standard deviation of split frequencies: 0.002562

      735500 -- (-894.142) [-892.405] (-897.302) (-893.063) * (-893.251) (-893.097) (-888.761) [-890.639] -- 0:00:37
      736000 -- (-890.226) (-893.239) (-896.107) [-893.581] * (-892.612) [-889.573] (-892.890) (-897.502) -- 0:00:37
      736500 -- (-889.015) [-890.281] (-898.034) (-892.916) * (-892.828) (-894.159) [-889.696] (-888.811) -- 0:00:37
      737000 -- (-889.941) [-900.539] (-895.244) (-895.064) * (-888.026) [-888.935] (-890.332) (-890.138) -- 0:00:37
      737500 -- (-890.530) (-891.762) (-895.786) [-890.361] * (-891.733) [-890.986] (-888.767) (-887.680) -- 0:00:37
      738000 -- (-895.594) (-890.111) [-891.052] (-895.377) * (-893.993) (-889.212) [-889.088] (-891.506) -- 0:00:37
      738500 -- (-892.666) [-888.410] (-890.934) (-892.986) * (-889.776) [-895.893] (-889.970) (-895.003) -- 0:00:37
      739000 -- (-892.999) (-897.405) (-892.953) [-890.958] * (-889.604) (-893.367) (-893.545) [-891.788] -- 0:00:37
      739500 -- (-898.015) (-892.336) (-896.251) [-890.713] * [-890.855] (-893.851) (-895.266) (-889.956) -- 0:00:36
      740000 -- (-896.976) [-890.020] (-890.965) (-888.808) * (-889.544) (-891.214) [-890.855] (-897.251) -- 0:00:37

      Average standard deviation of split frequencies: 0.003819

      740500 -- [-888.323] (-891.929) (-890.868) (-895.849) * (-896.509) (-892.988) [-889.577] (-895.907) -- 0:00:37
      741000 -- [-888.236] (-890.235) (-893.939) (-894.501) * [-890.660] (-897.410) (-892.390) (-890.947) -- 0:00:37
      741500 -- (-894.126) (-893.478) (-893.638) [-893.853] * (-888.593) (-894.642) [-890.261] (-888.515) -- 0:00:36
      742000 -- (-895.025) (-895.912) (-893.093) [-889.398] * (-890.969) [-894.501] (-891.444) (-890.444) -- 0:00:36
      742500 -- (-892.719) [-892.098] (-888.437) (-892.399) * (-891.256) (-891.556) (-892.932) [-890.926] -- 0:00:36
      743000 -- (-898.665) (-892.808) [-890.006] (-892.955) * (-895.254) (-896.923) [-895.123] (-890.764) -- 0:00:36
      743500 -- (-895.235) [-895.104] (-892.059) (-895.341) * (-890.933) (-897.846) [-887.300] (-894.172) -- 0:00:36
      744000 -- (-896.341) (-890.883) [-890.697] (-893.349) * (-891.799) [-894.195] (-893.715) (-894.631) -- 0:00:36
      744500 -- [-892.721] (-889.345) (-897.267) (-895.309) * (-890.155) (-888.463) [-893.982] (-892.698) -- 0:00:36
      745000 -- (-899.176) [-891.938] (-892.799) (-905.223) * (-892.213) [-887.942] (-893.893) (-892.051) -- 0:00:36

      Average standard deviation of split frequencies: 0.003791

      745500 -- (-889.102) (-894.588) (-893.422) [-896.874] * (-892.883) (-890.712) (-897.301) [-889.698] -- 0:00:36
      746000 -- [-893.551] (-892.143) (-893.196) (-891.474) * (-893.253) (-890.335) [-895.018] (-892.887) -- 0:00:36
      746500 -- (-889.754) [-897.098] (-890.411) (-888.066) * (-892.980) (-898.888) [-888.927] (-896.634) -- 0:00:35
      747000 -- [-891.389] (-891.363) (-889.079) (-891.916) * [-893.761] (-892.968) (-887.837) (-892.864) -- 0:00:36
      747500 -- [-896.188] (-895.714) (-890.451) (-898.042) * (-892.191) (-899.148) (-890.801) [-889.335] -- 0:00:36
      748000 -- [-897.431] (-892.797) (-892.615) (-901.070) * (-889.190) (-896.220) [-890.542] (-892.794) -- 0:00:36
      748500 -- [-891.192] (-895.560) (-891.683) (-890.066) * (-892.220) [-896.733] (-891.472) (-887.756) -- 0:00:35
      749000 -- (-892.085) (-895.360) [-888.128] (-892.945) * (-890.217) (-891.150) [-893.778] (-890.281) -- 0:00:35
      749500 -- (-893.818) [-896.887] (-887.232) (-890.334) * (-888.396) [-888.909] (-890.179) (-886.767) -- 0:00:35
      750000 -- [-888.420] (-890.553) (-893.015) (-891.039) * (-890.801) [-894.443] (-890.112) (-888.578) -- 0:00:35

      Average standard deviation of split frequencies: 0.003140

      750500 -- (-895.384) (-893.454) [-893.488] (-894.947) * (-887.580) (-898.137) [-896.235] (-892.616) -- 0:00:35
      751000 -- [-891.728] (-890.156) (-903.269) (-891.451) * [-895.413] (-898.749) (-894.537) (-890.833) -- 0:00:35
      751500 -- (-890.246) (-890.617) (-893.422) [-888.064] * (-894.020) (-894.931) (-889.601) [-890.154] -- 0:00:35
      752000 -- [-893.522] (-895.594) (-890.817) (-889.085) * (-894.789) (-894.644) (-892.900) [-891.212] -- 0:00:35
      752500 -- (-892.672) (-900.696) [-891.890] (-895.815) * (-891.727) (-892.031) [-889.069] (-889.562) -- 0:00:35
      753000 -- (-889.464) [-888.940] (-891.392) (-892.193) * [-893.611] (-897.525) (-891.406) (-893.162) -- 0:00:35
      753500 -- (-890.922) (-887.435) (-890.513) [-893.465] * (-896.907) (-892.863) (-893.483) [-892.537] -- 0:00:35
      754000 -- [-890.277] (-893.546) (-891.986) (-892.136) * (-893.124) (-894.699) [-887.462] (-888.653) -- 0:00:35
      754500 -- (-889.654) (-894.089) (-888.921) [-889.550] * (-889.819) (-891.567) (-893.351) [-890.560] -- 0:00:35
      755000 -- (-891.416) (-906.900) [-892.947] (-888.308) * [-893.552] (-893.003) (-890.661) (-888.749) -- 0:00:35

      Average standard deviation of split frequencies: 0.003118

      755500 -- (-895.077) [-887.676] (-894.495) (-893.026) * (-893.001) [-891.961] (-892.404) (-892.569) -- 0:00:34
      756000 -- (-887.749) (-897.150) [-890.146] (-893.832) * (-888.905) [-892.277] (-889.167) (-892.053) -- 0:00:34
      756500 -- [-897.510] (-893.505) (-889.448) (-891.740) * (-887.597) (-892.824) [-893.014] (-890.275) -- 0:00:34
      757000 -- [-895.099] (-891.777) (-889.985) (-892.910) * [-890.501] (-890.136) (-895.557) (-890.085) -- 0:00:34
      757500 -- (-890.554) (-890.047) [-889.029] (-894.056) * [-891.224] (-890.941) (-893.194) (-898.026) -- 0:00:34
      758000 -- (-897.559) [-888.325] (-892.321) (-893.329) * (-892.431) [-892.407] (-894.191) (-897.250) -- 0:00:34
      758500 -- (-889.170) (-895.102) [-889.693] (-892.326) * (-887.893) (-892.201) (-894.267) [-890.933] -- 0:00:34
      759000 -- (-890.732) (-893.769) [-893.034] (-890.313) * (-893.208) (-900.394) (-891.004) [-891.599] -- 0:00:34
      759500 -- (-897.678) (-892.161) (-894.512) [-893.681] * (-895.351) [-898.337] (-890.905) (-893.530) -- 0:00:34
      760000 -- (-892.154) (-892.849) [-888.883] (-892.118) * (-889.391) (-897.168) [-894.455] (-897.320) -- 0:00:34

      Average standard deviation of split frequencies: 0.003099

      760500 -- [-891.783] (-897.966) (-889.442) (-887.842) * (-888.854) (-893.081) [-891.018] (-889.997) -- 0:00:34
      761000 -- (-890.272) (-895.303) (-894.819) [-892.543] * (-888.268) [-891.314] (-893.830) (-905.188) -- 0:00:34
      761500 -- (-895.852) (-895.700) (-891.788) [-891.432] * (-889.614) (-891.237) [-891.189] (-892.465) -- 0:00:34
      762000 -- (-891.732) (-890.327) [-893.073] (-892.454) * (-889.112) (-902.921) (-892.696) [-889.798] -- 0:00:34
      762500 -- [-889.946] (-900.048) (-890.227) (-890.458) * (-893.015) (-895.609) [-888.194] (-891.480) -- 0:00:33
      763000 -- (-897.673) (-891.696) (-889.237) [-888.007] * (-896.037) [-890.673] (-889.518) (-896.421) -- 0:00:33
      763500 -- (-897.058) (-888.433) (-889.095) [-891.097] * (-890.885) (-896.733) (-890.576) [-890.903] -- 0:00:33
      764000 -- (-890.586) (-897.061) (-890.459) [-893.363] * (-895.471) (-892.990) [-891.890] (-893.376) -- 0:00:33
      764500 -- (-893.327) (-894.841) (-900.178) [-889.700] * (-894.088) (-894.116) [-889.505] (-893.160) -- 0:00:33
      765000 -- (-894.429) (-893.168) (-898.082) [-892.587] * (-891.037) (-893.655) (-888.892) [-890.469] -- 0:00:33

      Average standard deviation of split frequencies: 0.002462

      765500 -- (-896.549) (-895.885) [-887.887] (-898.959) * (-897.625) (-889.802) (-892.944) [-891.127] -- 0:00:33
      766000 -- (-898.764) (-901.451) (-893.361) [-890.558] * (-887.524) [-890.969] (-897.592) (-892.270) -- 0:00:33
      766500 -- (-894.381) (-895.633) [-890.237] (-889.599) * (-890.188) (-890.003) (-894.673) [-893.206] -- 0:00:33
      767000 -- (-894.776) (-895.945) (-893.858) [-891.274] * (-896.194) (-893.334) (-892.428) [-888.346] -- 0:00:33
      767500 -- (-888.997) (-892.566) (-895.544) [-888.295] * [-894.147] (-891.848) (-886.702) (-890.426) -- 0:00:33
      768000 -- (-894.298) (-893.171) (-888.233) [-890.464] * (-893.633) (-893.555) [-888.685] (-894.550) -- 0:00:33
      768500 -- [-888.687] (-899.695) (-890.535) (-896.218) * (-889.801) (-890.635) (-887.481) [-891.366] -- 0:00:33
      769000 -- (-892.936) [-890.365] (-891.475) (-893.633) * (-891.317) (-893.326) [-896.992] (-896.538) -- 0:00:33
      769500 -- (-891.195) (-891.412) [-896.208] (-895.727) * (-892.033) [-892.121] (-895.294) (-894.125) -- 0:00:32
      770000 -- [-893.935] (-892.809) (-902.328) (-899.042) * [-890.964] (-893.239) (-887.538) (-900.139) -- 0:00:32

      Average standard deviation of split frequencies: 0.001835

      770500 -- (-893.458) [-896.276] (-890.381) (-896.943) * (-894.141) (-896.256) [-887.961] (-896.866) -- 0:00:32
      771000 -- (-890.191) (-894.662) (-894.634) [-897.907] * (-892.543) (-896.227) (-892.888) [-897.307] -- 0:00:32
      771500 -- [-895.670] (-894.894) (-892.928) (-897.720) * (-891.056) (-892.371) (-893.270) [-893.324] -- 0:00:32
      772000 -- [-890.893] (-891.000) (-891.939) (-897.846) * (-890.047) (-891.438) (-895.119) [-889.935] -- 0:00:32
      772500 -- (-890.623) (-889.323) (-890.195) [-894.061] * (-896.059) [-891.511] (-899.105) (-887.684) -- 0:00:32
      773000 -- [-893.754] (-898.070) (-891.572) (-893.607) * (-894.235) (-893.559) [-888.426] (-892.217) -- 0:00:32
      773500 -- (-893.933) (-895.771) [-893.090] (-895.142) * (-891.632) [-897.293] (-896.709) (-896.142) -- 0:00:32
      774000 -- (-889.835) (-894.121) [-889.844] (-895.982) * (-890.583) (-890.535) [-892.649] (-891.468) -- 0:00:32
      774500 -- (-894.704) [-889.907] (-894.674) (-890.995) * (-889.064) [-891.538] (-894.908) (-898.431) -- 0:00:32
      775000 -- [-896.521] (-890.923) (-894.073) (-893.277) * [-891.782] (-900.432) (-888.803) (-897.444) -- 0:00:32

      Average standard deviation of split frequencies: 0.001215

      775500 -- (-893.925) (-896.226) [-887.069] (-891.987) * (-894.260) (-892.282) (-889.815) [-888.278] -- 0:00:32
      776000 -- (-890.424) (-892.343) [-896.926] (-887.650) * (-893.057) (-889.949) [-888.789] (-894.888) -- 0:00:32
      776500 -- (-894.490) (-900.473) (-890.283) [-889.060] * (-894.775) (-891.283) (-896.770) [-888.995] -- 0:00:31
      777000 -- (-887.676) (-896.439) (-899.951) [-889.962] * (-889.748) (-891.988) (-895.604) [-890.289] -- 0:00:31
      777500 -- (-891.071) (-889.404) (-889.428) [-891.925] * (-893.458) [-892.568] (-895.701) (-893.718) -- 0:00:31
      778000 -- [-890.022] (-887.691) (-894.795) (-890.583) * (-890.071) [-890.634] (-894.968) (-896.835) -- 0:00:31
      778500 -- (-890.802) [-891.303] (-897.852) (-890.286) * (-892.458) [-890.224] (-895.529) (-897.770) -- 0:00:31
      779000 -- (-900.069) (-893.875) (-898.235) [-896.688] * [-892.031] (-897.046) (-886.684) (-893.967) -- 0:00:31
      779500 -- [-892.349] (-896.195) (-897.312) (-889.421) * (-890.263) (-898.624) [-889.916] (-896.757) -- 0:00:31
      780000 -- (-889.821) (-894.139) [-892.461] (-890.720) * (-893.917) [-897.807] (-898.093) (-891.420) -- 0:00:31

      Average standard deviation of split frequencies: 0.001208

      780500 -- (-890.145) [-897.042] (-890.362) (-889.327) * [-890.421] (-889.412) (-899.830) (-893.493) -- 0:00:31
      781000 -- (-894.576) (-893.988) [-894.124] (-891.229) * (-890.712) [-890.923] (-891.452) (-892.220) -- 0:00:31
      781500 -- (-887.867) (-892.742) (-892.490) [-891.257] * (-894.348) [-891.900] (-891.698) (-891.689) -- 0:00:31
      782000 -- (-889.749) [-887.920] (-894.452) (-892.455) * (-891.922) (-896.891) [-892.192] (-890.318) -- 0:00:31
      782500 -- (-892.040) (-889.039) [-892.360] (-890.830) * (-891.083) (-895.852) [-891.516] (-891.960) -- 0:00:31
      783000 -- (-896.615) (-894.684) (-893.616) [-893.634] * (-891.297) [-893.703] (-892.342) (-891.149) -- 0:00:31
      783500 -- (-891.907) (-900.509) [-890.217] (-891.463) * (-892.931) [-889.589] (-896.766) (-889.469) -- 0:00:30
      784000 -- (-896.083) (-888.627) (-888.917) [-892.859] * (-891.116) (-890.159) [-893.296] (-889.456) -- 0:00:30
      784500 -- [-891.714] (-892.352) (-893.545) (-902.400) * [-891.817] (-891.707) (-891.797) (-890.488) -- 0:00:30
      785000 -- (-890.450) [-894.420] (-891.217) (-891.152) * [-897.928] (-897.595) (-894.291) (-893.572) -- 0:00:30

      Average standard deviation of split frequencies: 0.001200

      785500 -- (-895.884) (-891.849) (-891.561) [-892.627] * (-899.325) (-893.211) (-890.479) [-892.021] -- 0:00:30
      786000 -- (-890.541) [-890.836] (-892.696) (-894.225) * (-890.755) (-891.264) [-896.674] (-895.731) -- 0:00:30
      786500 -- (-892.045) [-894.307] (-894.859) (-892.308) * [-890.866] (-888.803) (-891.526) (-891.013) -- 0:00:30
      787000 -- (-895.390) (-893.674) (-897.425) [-891.540] * (-895.332) [-891.182] (-892.290) (-894.659) -- 0:00:30
      787500 -- (-889.224) [-890.694] (-888.135) (-892.743) * (-890.987) (-892.314) [-890.668] (-890.597) -- 0:00:30
      788000 -- (-893.312) [-893.071] (-891.152) (-887.395) * (-890.231) (-894.843) [-890.507] (-889.083) -- 0:00:30
      788500 -- (-897.710) [-892.114] (-893.632) (-890.544) * (-891.166) (-895.479) [-888.755] (-892.018) -- 0:00:30
      789000 -- (-896.536) [-891.021] (-898.490) (-892.673) * [-889.499] (-894.207) (-891.933) (-896.030) -- 0:00:30
      789500 -- (-899.335) (-888.513) (-898.348) [-891.964] * (-887.620) (-890.511) [-890.743] (-890.975) -- 0:00:30
      790000 -- (-892.030) (-891.306) (-893.477) [-894.592] * (-900.050) (-895.291) [-888.323] (-894.313) -- 0:00:30

      Average standard deviation of split frequencies: 0.000000

      790500 -- [-890.664] (-890.265) (-892.311) (-893.653) * (-902.393) (-888.814) [-892.533] (-892.168) -- 0:00:29
      791000 -- (-892.719) [-893.722] (-896.639) (-891.197) * (-895.414) (-892.435) [-891.069] (-893.056) -- 0:00:29
      791500 -- (-892.401) [-895.838] (-890.267) (-888.743) * (-894.972) [-891.648] (-892.434) (-891.880) -- 0:00:29
      792000 -- (-893.245) (-902.957) [-888.215] (-896.071) * (-890.404) [-891.385] (-895.680) (-894.955) -- 0:00:29
      792500 -- [-892.332] (-893.073) (-894.526) (-899.796) * (-889.672) [-893.096] (-893.222) (-898.314) -- 0:00:29
      793000 -- (-896.322) (-892.016) (-895.098) [-892.095] * (-893.862) [-895.650] (-895.367) (-894.168) -- 0:00:29
      793500 -- (-889.790) (-891.088) [-890.115] (-894.565) * (-897.067) [-891.267] (-897.874) (-894.044) -- 0:00:29
      794000 -- (-886.878) [-891.998] (-888.895) (-893.089) * (-893.287) (-891.533) [-892.274] (-892.582) -- 0:00:29
      794500 -- [-891.496] (-892.269) (-891.019) (-892.049) * [-893.522] (-896.277) (-889.219) (-896.898) -- 0:00:29
      795000 -- (-895.785) (-891.460) [-891.389] (-895.743) * (-890.875) (-900.680) [-891.986] (-892.689) -- 0:00:29

      Average standard deviation of split frequencies: 0.000000

      795500 -- (-892.599) (-890.606) [-895.871] (-895.037) * (-894.813) (-890.553) [-891.926] (-898.833) -- 0:00:29
      796000 -- [-891.665] (-891.673) (-889.740) (-894.632) * [-889.848] (-889.792) (-888.334) (-898.232) -- 0:00:29
      796500 -- [-891.509] (-893.125) (-890.483) (-895.230) * (-895.213) [-890.894] (-897.997) (-895.230) -- 0:00:29
      797000 -- (-893.315) (-901.501) [-892.530] (-889.886) * [-891.768] (-887.371) (-891.410) (-892.209) -- 0:00:29
      797500 -- (-893.617) (-897.695) [-891.794] (-894.871) * (-895.377) [-891.004] (-898.395) (-896.300) -- 0:00:28
      798000 -- (-895.518) (-897.077) (-894.970) [-890.291] * [-894.458] (-893.340) (-893.936) (-892.416) -- 0:00:28
      798500 -- (-894.859) (-894.293) (-892.117) [-891.750] * [-901.948] (-892.866) (-889.044) (-902.067) -- 0:00:28
      799000 -- (-889.837) (-893.318) (-897.950) [-891.577] * [-889.615] (-895.314) (-900.969) (-891.248) -- 0:00:28
      799500 -- (-888.679) (-890.810) (-894.933) [-888.992] * [-894.576] (-900.231) (-900.969) (-891.507) -- 0:00:28
      800000 -- [-889.219] (-899.932) (-897.192) (-892.108) * (-892.640) (-896.749) (-892.684) [-891.946] -- 0:00:28

      Average standard deviation of split frequencies: 0.000000

      800500 -- (-892.770) (-892.165) [-889.597] (-893.021) * [-891.047] (-896.677) (-888.899) (-895.050) -- 0:00:28
      801000 -- (-892.977) [-890.238] (-890.233) (-890.718) * (-890.673) [-891.443] (-893.819) (-888.944) -- 0:00:28
      801500 -- [-893.737] (-893.853) (-896.867) (-891.854) * (-890.051) (-898.302) [-887.958] (-892.856) -- 0:00:28
      802000 -- [-888.957] (-896.318) (-890.106) (-890.624) * (-892.942) [-893.937] (-889.445) (-893.520) -- 0:00:28
      802500 -- (-890.705) (-890.534) (-896.011) [-890.045] * (-895.962) [-891.352] (-891.712) (-895.596) -- 0:00:28
      803000 -- [-892.207] (-892.114) (-893.920) (-892.736) * [-891.254] (-904.368) (-888.844) (-892.052) -- 0:00:28
      803500 -- (-889.704) [-891.074] (-895.536) (-889.147) * [-891.126] (-894.201) (-890.304) (-888.434) -- 0:00:28
      804000 -- [-890.194] (-893.106) (-894.253) (-894.436) * (-892.535) (-894.468) [-889.709] (-891.668) -- 0:00:28
      804500 -- (-887.766) (-897.801) [-891.577] (-895.852) * (-894.491) (-894.131) (-891.938) [-894.218] -- 0:00:27
      805000 -- [-891.206] (-895.645) (-896.674) (-893.583) * (-894.480) [-896.700] (-895.248) (-892.315) -- 0:00:27

      Average standard deviation of split frequencies: 0.000585

      805500 -- [-887.319] (-892.100) (-895.794) (-892.129) * (-894.579) (-892.755) [-891.633] (-890.613) -- 0:00:27
      806000 -- (-895.518) (-894.532) (-891.874) [-893.523] * (-897.213) (-897.377) [-890.816] (-889.345) -- 0:00:27
      806500 -- [-891.472] (-896.641) (-894.294) (-893.237) * [-894.030] (-889.352) (-895.937) (-891.353) -- 0:00:27
      807000 -- (-892.975) (-893.792) (-891.535) [-893.306] * (-889.783) (-891.235) [-888.138] (-894.381) -- 0:00:27
      807500 -- [-896.205] (-888.815) (-890.945) (-894.442) * (-889.518) (-891.622) (-892.757) [-893.151] -- 0:00:27
      808000 -- (-891.290) (-893.115) [-888.143] (-893.530) * [-888.545] (-896.141) (-890.257) (-890.052) -- 0:00:27
      808500 -- (-887.687) [-888.617] (-894.484) (-895.627) * (-889.696) (-892.302) [-890.275] (-895.199) -- 0:00:27
      809000 -- (-890.303) (-891.810) [-889.841] (-893.425) * (-889.385) (-894.537) (-900.875) [-894.512] -- 0:00:27
      809500 -- (-895.243) [-889.339] (-891.240) (-895.411) * (-892.551) [-892.273] (-892.731) (-889.201) -- 0:00:27
      810000 -- (-890.869) (-897.845) (-892.439) [-891.233] * [-887.689] (-893.716) (-891.078) (-894.348) -- 0:00:27

      Average standard deviation of split frequencies: 0.000582

      810500 -- (-891.242) (-893.169) (-887.872) [-888.350] * (-890.283) (-889.312) [-893.839] (-896.909) -- 0:00:27
      811000 -- (-892.893) (-895.502) [-890.574] (-892.464) * (-896.417) (-891.842) (-894.671) [-890.409] -- 0:00:27
      811500 -- (-887.667) (-902.265) (-888.242) [-890.896] * (-891.958) [-896.257] (-889.788) (-894.092) -- 0:00:26
      812000 -- [-894.621] (-891.168) (-892.010) (-893.754) * [-893.794] (-896.027) (-892.482) (-892.886) -- 0:00:26
      812500 -- (-901.445) (-896.014) [-892.585] (-888.998) * (-899.423) (-891.579) [-889.761] (-891.181) -- 0:00:26
      813000 -- (-897.242) (-891.880) (-891.819) [-895.371] * (-898.446) [-892.407] (-894.388) (-894.554) -- 0:00:26
      813500 -- (-896.633) (-894.532) (-897.521) [-891.503] * [-899.668] (-892.169) (-894.619) (-895.601) -- 0:00:26
      814000 -- (-891.497) [-888.733] (-897.790) (-889.503) * [-890.850] (-889.280) (-892.707) (-896.444) -- 0:00:26
      814500 -- (-889.767) [-891.441] (-890.590) (-889.926) * (-888.992) (-895.913) (-890.004) [-891.223] -- 0:00:26
      815000 -- [-893.571] (-890.213) (-890.521) (-892.027) * [-887.285] (-892.452) (-891.405) (-895.636) -- 0:00:26

      Average standard deviation of split frequencies: 0.002311

      815500 -- (-896.260) (-892.988) [-889.992] (-890.018) * [-892.452] (-897.662) (-893.324) (-894.138) -- 0:00:26
      816000 -- (-892.999) (-887.587) (-892.459) [-891.052] * (-890.382) [-891.853] (-891.435) (-890.475) -- 0:00:26
      816500 -- (-892.292) (-890.137) (-889.494) [-890.230] * [-895.114] (-893.637) (-893.042) (-891.458) -- 0:00:26
      817000 -- (-891.051) [-891.037] (-890.939) (-894.564) * (-894.550) [-888.357] (-894.877) (-892.210) -- 0:00:26
      817500 -- [-895.721] (-893.757) (-890.704) (-895.098) * (-889.817) (-897.403) (-889.016) [-891.567] -- 0:00:26
      818000 -- [-893.275] (-888.772) (-895.321) (-890.818) * (-892.662) [-889.840] (-889.171) (-890.882) -- 0:00:26
      818500 -- (-894.639) (-895.533) [-891.278] (-895.455) * [-893.900] (-895.217) (-892.701) (-891.216) -- 0:00:25
      819000 -- (-893.793) (-892.505) (-890.524) [-895.645] * (-892.275) (-896.590) [-891.404] (-902.014) -- 0:00:25
      819500 -- (-905.104) (-892.468) [-890.818] (-896.659) * (-891.438) [-887.038] (-895.843) (-891.583) -- 0:00:25
      820000 -- (-889.172) [-889.136] (-893.857) (-893.164) * [-890.573] (-888.862) (-889.507) (-895.059) -- 0:00:25

      Average standard deviation of split frequencies: 0.002872

      820500 -- [-894.962] (-890.000) (-894.255) (-900.486) * (-890.387) (-894.125) [-888.345] (-890.514) -- 0:00:25
      821000 -- (-889.711) [-887.749] (-892.496) (-896.294) * (-895.304) (-893.044) [-888.723] (-893.849) -- 0:00:25
      821500 -- (-891.451) [-891.860] (-887.424) (-889.777) * (-892.439) (-897.634) [-896.513] (-888.462) -- 0:00:25
      822000 -- [-888.017] (-891.026) (-896.681) (-888.570) * (-892.086) (-901.256) [-890.314] (-893.587) -- 0:00:25
      822500 -- [-890.112] (-888.615) (-898.665) (-889.397) * [-897.025] (-900.826) (-890.432) (-891.589) -- 0:00:25
      823000 -- (-888.569) (-891.833) [-895.748] (-899.355) * [-888.660] (-893.907) (-888.837) (-893.373) -- 0:00:25
      823500 -- [-893.685] (-891.153) (-892.840) (-895.171) * (-890.936) (-895.979) (-890.244) [-889.474] -- 0:00:25
      824000 -- (-893.122) [-890.322] (-892.891) (-899.536) * [-890.065] (-887.271) (-892.561) (-890.506) -- 0:00:25
      824500 -- (-889.698) (-888.477) (-888.619) [-890.770] * [-891.886] (-892.457) (-892.451) (-894.245) -- 0:00:25
      825000 -- (-889.538) [-899.145] (-896.523) (-894.291) * [-893.396] (-891.035) (-890.676) (-890.782) -- 0:00:25

      Average standard deviation of split frequencies: 0.001712

      825500 -- (-892.182) (-897.765) [-889.332] (-890.443) * (-895.163) (-893.245) (-901.753) [-889.238] -- 0:00:24
      826000 -- (-888.955) (-890.701) (-893.524) [-892.420] * (-900.436) (-899.850) [-898.464] (-891.405) -- 0:00:24
      826500 -- (-890.889) [-892.885] (-890.047) (-890.081) * [-895.566] (-896.606) (-890.035) (-898.715) -- 0:00:24
      827000 -- (-890.508) (-890.792) [-895.075] (-891.008) * (-888.893) (-897.392) (-894.589) [-890.516] -- 0:00:24
      827500 -- (-891.588) [-893.060] (-888.872) (-894.252) * [-890.681] (-892.543) (-894.545) (-896.469) -- 0:00:24
      828000 -- [-892.176] (-895.102) (-890.213) (-890.200) * [-896.247] (-890.612) (-890.946) (-894.929) -- 0:00:24
      828500 -- (-899.493) (-894.208) [-890.135] (-893.162) * (-893.491) (-894.128) [-892.816] (-895.134) -- 0:00:24
      829000 -- (-896.660) [-889.436] (-891.473) (-892.036) * [-893.582] (-893.678) (-900.399) (-890.784) -- 0:00:24
      829500 -- (-896.334) [-893.168] (-892.307) (-893.657) * (-893.173) [-890.170] (-897.028) (-894.218) -- 0:00:24
      830000 -- [-896.523] (-893.140) (-895.208) (-896.781) * (-892.703) [-888.702] (-889.203) (-896.810) -- 0:00:24

      Average standard deviation of split frequencies: 0.002270

      830500 -- (-892.987) [-891.073] (-899.464) (-889.408) * [-889.979] (-892.932) (-889.611) (-891.759) -- 0:00:24
      831000 -- (-894.289) (-896.904) (-896.761) [-890.320] * (-893.617) (-892.213) (-894.280) [-889.149] -- 0:00:24
      831500 -- [-891.823] (-890.020) (-896.440) (-895.290) * (-893.190) [-889.267] (-891.660) (-891.824) -- 0:00:24
      832000 -- (-891.663) (-892.363) [-889.316] (-891.679) * (-890.704) [-891.758] (-892.257) (-892.190) -- 0:00:24
      832500 -- (-894.485) (-892.909) (-895.287) [-895.121] * (-889.519) (-889.779) (-897.533) [-894.446] -- 0:00:23
      833000 -- (-888.215) (-898.389) [-894.543] (-888.962) * (-898.833) (-890.456) (-893.896) [-890.825] -- 0:00:23
      833500 -- (-891.753) (-895.179) (-890.171) [-889.901] * (-891.162) [-891.387] (-895.213) (-888.719) -- 0:00:23
      834000 -- (-889.853) (-887.934) [-891.521] (-892.768) * [-893.798] (-894.418) (-889.198) (-891.087) -- 0:00:23
      834500 -- (-887.693) (-888.905) [-889.507] (-892.704) * (-892.361) [-895.989] (-889.652) (-891.289) -- 0:00:23
      835000 -- (-893.496) (-892.471) [-895.603] (-891.151) * (-890.954) (-895.089) [-891.978] (-892.496) -- 0:00:23

      Average standard deviation of split frequencies: 0.002256

      835500 -- (-900.467) (-892.864) [-891.707] (-887.983) * (-892.104) (-898.758) (-892.207) [-892.371] -- 0:00:23
      836000 -- [-892.509] (-888.444) (-891.942) (-900.780) * (-894.129) [-890.189] (-893.180) (-893.311) -- 0:00:23
      836500 -- (-892.711) [-893.912] (-891.641) (-891.537) * (-893.882) (-890.942) [-892.567] (-890.282) -- 0:00:23
      837000 -- (-894.922) (-893.414) [-896.294] (-893.299) * (-896.914) (-898.241) (-890.082) [-888.211] -- 0:00:23
      837500 -- (-889.749) [-891.394] (-896.238) (-895.576) * [-890.248] (-894.507) (-892.036) (-889.620) -- 0:00:23
      838000 -- [-891.330] (-893.922) (-895.552) (-894.537) * (-891.874) (-893.444) [-897.388] (-888.971) -- 0:00:23
      838500 -- (-890.434) [-892.601] (-892.021) (-891.171) * (-895.148) (-895.849) (-893.702) [-894.696] -- 0:00:23
      839000 -- [-892.713] (-891.677) (-889.775) (-900.489) * (-894.660) (-896.796) [-895.782] (-891.421) -- 0:00:23
      839500 -- (-890.130) [-895.516] (-887.610) (-896.177) * (-895.466) (-891.506) [-887.229] (-893.526) -- 0:00:22
      840000 -- [-892.977] (-891.502) (-891.001) (-891.469) * (-893.318) (-897.479) [-892.886] (-891.543) -- 0:00:22

      Average standard deviation of split frequencies: 0.002804

      840500 -- [-892.477] (-891.091) (-894.638) (-893.484) * (-890.349) (-891.334) (-890.291) [-894.147] -- 0:00:22
      841000 -- [-890.819] (-891.743) (-904.494) (-893.825) * (-897.634) [-891.575] (-893.168) (-894.020) -- 0:00:22
      841500 -- (-899.496) [-897.645] (-896.882) (-895.957) * (-890.658) (-895.800) [-889.137] (-892.025) -- 0:00:22
      842000 -- (-893.399) (-898.772) (-891.434) [-889.566] * (-891.679) (-897.969) (-888.564) [-894.651] -- 0:00:22
      842500 -- (-893.505) (-895.691) (-899.050) [-890.878] * (-895.042) (-892.275) [-889.906] (-889.427) -- 0:00:22
      843000 -- [-891.939] (-891.626) (-891.924) (-891.635) * [-888.713] (-892.325) (-890.767) (-889.587) -- 0:00:22
      843500 -- (-887.869) (-892.137) (-892.032) [-895.322] * [-896.996] (-889.701) (-894.546) (-893.343) -- 0:00:22
      844000 -- [-890.135] (-894.460) (-889.926) (-891.764) * (-891.143) (-895.588) (-894.886) [-890.719] -- 0:00:22
      844500 -- (-890.812) (-894.451) [-889.293] (-892.866) * (-893.424) [-890.236] (-894.186) (-899.057) -- 0:00:22
      845000 -- (-888.078) [-893.408] (-894.871) (-888.320) * (-897.355) (-895.940) (-889.444) [-892.985] -- 0:00:22

      Average standard deviation of split frequencies: 0.003343

      845500 -- (-893.605) [-890.029] (-892.901) (-891.554) * (-894.333) (-891.256) (-895.633) [-892.606] -- 0:00:22
      846000 -- (-896.658) (-899.070) (-891.884) [-890.267] * [-898.007] (-897.038) (-898.262) (-891.492) -- 0:00:22
      846500 -- (-894.001) (-892.469) (-897.251) [-894.258] * (-891.939) [-888.522] (-891.417) (-887.950) -- 0:00:21
      847000 -- (-896.125) [-889.138] (-891.552) (-890.963) * (-895.516) (-895.310) (-894.768) [-895.452] -- 0:00:21
      847500 -- [-890.788] (-888.639) (-899.217) (-891.931) * (-895.453) (-889.429) (-894.404) [-895.002] -- 0:00:21
      848000 -- (-894.952) (-897.411) [-894.671] (-900.708) * (-890.592) (-890.269) [-898.059] (-893.118) -- 0:00:21
      848500 -- (-892.286) [-897.104] (-891.052) (-897.801) * [-898.165] (-890.012) (-901.150) (-895.648) -- 0:00:21
      849000 -- [-898.633] (-896.340) (-892.171) (-897.357) * (-896.080) [-889.666] (-890.500) (-889.611) -- 0:00:21
      849500 -- (-893.697) (-888.982) [-889.491] (-894.753) * (-896.451) (-891.770) [-887.791] (-888.765) -- 0:00:21
      850000 -- (-891.021) [-888.435] (-891.243) (-895.543) * (-894.327) (-894.601) [-888.327] (-891.256) -- 0:00:21

      Average standard deviation of split frequencies: 0.002217

      850500 -- [-890.290] (-894.968) (-896.514) (-894.372) * [-894.052] (-892.427) (-893.113) (-893.511) -- 0:00:21
      851000 -- (-892.983) (-892.586) [-890.706] (-895.915) * (-891.157) (-889.883) [-891.375] (-890.500) -- 0:00:21
      851500 -- (-893.958) [-891.333] (-895.664) (-891.499) * [-896.258] (-891.389) (-890.024) (-890.183) -- 0:00:21
      852000 -- (-892.673) (-888.169) (-891.481) [-892.889] * (-895.351) (-891.565) (-894.959) [-891.249] -- 0:00:21
      852500 -- (-888.687) [-889.373] (-890.026) (-893.003) * (-890.651) (-892.097) (-891.979) [-890.220] -- 0:00:21
      853000 -- (-888.602) [-890.842] (-904.170) (-890.614) * [-892.872] (-891.326) (-895.021) (-892.948) -- 0:00:21
      853500 -- (-891.466) (-892.647) (-890.993) [-897.582] * (-889.838) [-889.522] (-890.928) (-889.625) -- 0:00:20
      854000 -- (-891.230) (-891.998) [-891.890] (-889.433) * [-892.276] (-890.930) (-890.713) (-890.715) -- 0:00:20
      854500 -- (-893.959) (-889.465) [-892.585] (-894.662) * (-893.382) [-891.131] (-889.212) (-893.714) -- 0:00:20
      855000 -- [-893.809] (-890.242) (-893.822) (-894.006) * (-888.849) (-891.128) (-891.604) [-893.976] -- 0:00:20

      Average standard deviation of split frequencies: 0.002754

      855500 -- (-888.097) [-890.829] (-897.065) (-892.998) * (-888.618) [-890.080] (-888.977) (-888.813) -- 0:00:20
      856000 -- [-888.416] (-892.246) (-900.599) (-895.881) * (-895.858) (-889.255) (-891.164) [-890.813] -- 0:00:20
      856500 -- (-888.649) (-893.014) [-895.583] (-900.147) * [-892.910] (-890.435) (-889.824) (-889.627) -- 0:00:20
      857000 -- (-895.901) (-895.603) [-895.030] (-900.500) * (-897.910) (-894.958) (-889.799) [-893.313] -- 0:00:20
      857500 -- (-892.620) (-893.558) [-889.576] (-891.580) * (-899.700) [-890.538] (-888.752) (-890.896) -- 0:00:20
      858000 -- (-895.087) (-891.180) (-892.454) [-892.061] * (-890.599) (-893.283) [-892.384] (-892.834) -- 0:00:20
      858500 -- (-892.217) (-891.757) (-891.445) [-891.125] * (-887.565) (-896.927) [-891.339] (-890.939) -- 0:00:20
      859000 -- (-889.965) (-891.131) [-890.622] (-890.373) * (-889.320) [-893.796] (-892.813) (-895.500) -- 0:00:20
      859500 -- (-891.517) [-890.599] (-890.583) (-891.991) * [-893.031] (-887.982) (-895.210) (-893.512) -- 0:00:20
      860000 -- (-891.758) [-890.006] (-892.092) (-892.330) * (-893.063) (-891.065) [-893.517] (-890.315) -- 0:00:20

      Average standard deviation of split frequencies: 0.003834

      860500 -- (-894.939) (-892.384) [-895.288] (-896.323) * (-897.459) (-892.642) [-895.304] (-889.977) -- 0:00:19
      861000 -- [-892.649] (-897.396) (-891.075) (-895.102) * [-890.125] (-891.993) (-895.004) (-892.124) -- 0:00:19
      861500 -- (-891.759) (-896.885) (-892.695) [-895.127] * (-890.494) [-891.696] (-889.357) (-892.109) -- 0:00:19
      862000 -- (-891.103) [-898.608] (-889.927) (-889.155) * [-890.720] (-895.965) (-892.062) (-889.207) -- 0:00:19
      862500 -- (-893.034) (-896.731) (-890.105) [-889.759] * (-892.653) [-892.160] (-890.975) (-890.058) -- 0:00:19
      863000 -- (-894.603) [-895.971] (-888.134) (-892.673) * (-896.067) (-899.899) (-892.456) [-891.327] -- 0:00:19
      863500 -- (-889.583) [-896.528] (-890.331) (-894.960) * [-891.530] (-902.097) (-893.770) (-890.772) -- 0:00:19
      864000 -- (-890.089) (-898.981) (-895.041) [-889.253] * [-892.447] (-892.195) (-896.017) (-894.748) -- 0:00:19
      864500 -- [-890.861] (-892.446) (-892.086) (-895.062) * (-897.983) (-889.452) (-901.003) [-891.699] -- 0:00:19
      865000 -- (-892.670) (-906.090) (-893.007) [-893.044] * (-893.699) (-888.911) (-901.968) [-893.367] -- 0:00:19

      Average standard deviation of split frequencies: 0.003266

      865500 -- (-889.496) (-895.907) [-891.633] (-892.784) * (-889.463) [-889.700] (-890.569) (-897.775) -- 0:00:19
      866000 -- (-889.049) [-893.831] (-898.506) (-893.508) * (-891.641) (-891.133) [-888.515] (-900.203) -- 0:00:19
      866500 -- [-898.377] (-892.077) (-896.671) (-891.684) * [-892.646] (-892.694) (-889.080) (-894.434) -- 0:00:19
      867000 -- (-891.003) [-888.722] (-895.346) (-892.492) * (-897.123) (-893.944) (-893.627) [-889.857] -- 0:00:19
      867500 -- [-892.245] (-889.697) (-893.560) (-896.864) * (-892.821) (-898.284) (-888.557) [-891.655] -- 0:00:18
      868000 -- (-894.596) [-892.712] (-888.721) (-893.762) * (-892.042) (-891.500) (-891.984) [-891.633] -- 0:00:18
      868500 -- (-892.361) [-892.805] (-895.561) (-893.678) * (-892.581) (-893.602) [-891.168] (-891.834) -- 0:00:18
      869000 -- (-893.189) (-890.339) (-900.591) [-895.592] * [-888.642] (-894.350) (-892.134) (-898.439) -- 0:00:18
      869500 -- (-889.926) [-891.523] (-895.332) (-888.806) * (-888.111) (-893.138) [-889.236] (-889.874) -- 0:00:18
      870000 -- [-896.011] (-894.982) (-892.930) (-898.886) * (-894.334) (-892.077) (-893.199) [-889.916] -- 0:00:18

      Average standard deviation of split frequencies: 0.003249

      870500 -- (-893.908) [-888.510] (-894.401) (-891.900) * (-892.835) (-892.943) [-890.202] (-891.934) -- 0:00:18
      871000 -- (-894.322) [-886.332] (-893.803) (-890.701) * (-895.670) (-896.543) [-892.268] (-892.835) -- 0:00:18
      871500 -- (-892.771) (-894.724) (-897.038) [-895.759] * (-890.409) [-893.451] (-891.397) (-896.172) -- 0:00:18
      872000 -- [-890.375] (-890.733) (-893.289) (-891.364) * (-891.960) [-891.530] (-897.752) (-892.844) -- 0:00:18
      872500 -- [-888.390] (-900.563) (-894.019) (-889.784) * (-891.344) (-892.522) (-891.076) [-889.628] -- 0:00:18
      873000 -- (-893.130) [-899.781] (-894.055) (-888.904) * (-890.907) (-891.380) [-895.855] (-893.943) -- 0:00:18
      873500 -- [-891.966] (-894.008) (-893.027) (-889.197) * (-890.467) [-890.262] (-890.196) (-888.758) -- 0:00:18
      874000 -- (-896.019) (-890.688) [-888.081] (-890.817) * (-888.673) (-888.913) [-894.155] (-892.483) -- 0:00:18
      874500 -- (-894.385) (-895.900) (-892.062) [-888.340] * (-891.069) (-888.854) [-893.266] (-894.071) -- 0:00:17
      875000 -- (-891.452) (-891.329) [-891.328] (-893.754) * (-890.309) (-887.743) (-892.307) [-893.170] -- 0:00:17

      Average standard deviation of split frequencies: 0.003229

      875500 -- [-890.631] (-894.060) (-891.231) (-892.630) * (-891.800) (-890.997) [-887.411] (-895.231) -- 0:00:17
      876000 -- [-889.723] (-889.587) (-893.446) (-892.318) * (-892.055) (-893.977) [-891.793] (-896.545) -- 0:00:17
      876500 -- (-895.775) (-890.071) (-890.643) [-889.070] * (-895.623) (-894.491) [-887.860] (-900.297) -- 0:00:17
      877000 -- (-892.860) [-892.391] (-887.250) (-891.604) * (-892.248) (-893.252) [-901.976] (-893.235) -- 0:00:17
      877500 -- (-892.770) [-892.189] (-896.465) (-889.177) * (-895.251) (-890.527) (-890.398) [-888.940] -- 0:00:17
      878000 -- [-893.739] (-892.610) (-890.286) (-891.912) * (-890.236) (-894.601) (-891.209) [-890.222] -- 0:00:17
      878500 -- (-895.351) (-898.269) [-890.925] (-894.736) * [-890.523] (-891.596) (-888.107) (-895.177) -- 0:00:17
      879000 -- [-892.482] (-892.798) (-895.862) (-894.160) * (-894.898) (-889.306) [-886.929] (-888.451) -- 0:00:17
      879500 -- [-889.958] (-896.396) (-890.416) (-889.151) * [-886.553] (-892.539) (-890.795) (-888.612) -- 0:00:17
      880000 -- (-895.149) (-894.432) (-896.721) [-889.086] * (-892.601) (-891.404) [-889.120] (-890.168) -- 0:00:17

      Average standard deviation of split frequencies: 0.003212

      880500 -- (-892.192) [-896.191] (-889.997) (-889.738) * [-892.030] (-891.883) (-893.311) (-894.424) -- 0:00:17
      881000 -- (-889.886) [-894.992] (-892.768) (-891.094) * (-891.177) [-888.995] (-892.132) (-901.152) -- 0:00:17
      881500 -- (-893.445) [-894.311] (-892.418) (-893.720) * (-891.644) (-891.198) (-897.783) [-890.757] -- 0:00:16
      882000 -- (-890.304) (-893.565) (-891.746) [-889.277] * (-890.037) (-889.607) (-892.987) [-891.236] -- 0:00:16
      882500 -- (-894.225) (-892.697) (-891.779) [-896.991] * [-890.819] (-889.585) (-902.940) (-899.721) -- 0:00:16
      883000 -- (-895.463) (-891.814) (-894.014) [-888.410] * (-889.168) (-893.565) (-892.169) [-895.285] -- 0:00:16
      883500 -- (-892.156) [-886.918] (-895.471) (-889.001) * [-889.234] (-893.751) (-894.355) (-894.007) -- 0:00:16
      884000 -- [-892.867] (-889.443) (-895.390) (-892.039) * [-890.416] (-896.640) (-891.407) (-895.767) -- 0:00:16
      884500 -- (-892.357) (-895.414) (-894.751) [-892.202] * [-889.437] (-893.013) (-890.253) (-893.427) -- 0:00:16
      885000 -- (-890.997) [-892.015] (-890.687) (-893.042) * (-887.072) (-889.284) (-893.190) [-894.522] -- 0:00:16

      Average standard deviation of split frequencies: 0.002660

      885500 -- (-893.432) [-896.958] (-893.461) (-888.974) * (-896.020) (-895.942) [-891.392] (-887.982) -- 0:00:16
      886000 -- (-892.927) (-895.295) (-893.929) [-888.660] * [-889.090] (-892.245) (-892.211) (-890.832) -- 0:00:16
      886500 -- (-889.059) (-892.509) [-895.022] (-902.040) * (-889.525) [-890.163] (-896.865) (-890.368) -- 0:00:16
      887000 -- (-891.652) (-893.927) (-897.700) [-893.340] * (-898.635) [-894.226] (-892.682) (-890.382) -- 0:00:16
      887500 -- [-890.111] (-889.826) (-896.349) (-895.801) * (-889.696) (-891.056) (-891.188) [-889.573] -- 0:00:16
      888000 -- (-891.069) [-894.849] (-887.845) (-894.817) * [-889.368] (-887.947) (-891.200) (-892.935) -- 0:00:16
      888500 -- [-894.158] (-890.782) (-894.199) (-896.454) * (-893.688) (-895.093) (-891.754) [-888.638] -- 0:00:15
      889000 -- (-894.873) (-889.158) (-892.139) [-894.307] * (-891.027) (-894.527) [-893.679] (-893.235) -- 0:00:15
      889500 -- (-892.549) [-892.967] (-892.099) (-893.977) * (-891.292) (-893.532) [-893.725] (-889.471) -- 0:00:15
      890000 -- (-902.102) (-892.936) [-891.535] (-897.749) * (-895.069) [-893.544] (-895.130) (-889.029) -- 0:00:15

      Average standard deviation of split frequencies: 0.002646

      890500 -- [-891.055] (-897.671) (-891.284) (-888.244) * (-894.358) [-890.688] (-893.523) (-895.962) -- 0:00:15
      891000 -- [-895.645] (-893.877) (-891.733) (-895.067) * (-895.555) (-890.571) (-887.528) [-892.299] -- 0:00:15
      891500 -- (-894.575) (-893.196) (-893.995) [-893.560] * [-889.546] (-888.582) (-888.137) (-897.470) -- 0:00:15
      892000 -- (-890.260) [-896.239] (-891.290) (-893.305) * [-893.975] (-890.581) (-894.463) (-898.802) -- 0:00:15
      892500 -- [-891.877] (-891.812) (-898.064) (-891.895) * (-890.737) (-890.075) (-892.245) [-890.594] -- 0:00:15
      893000 -- (-888.621) (-889.848) [-893.331] (-889.145) * (-890.179) (-895.269) (-891.856) [-889.635] -- 0:00:15
      893500 -- (-894.886) (-894.728) [-892.493] (-894.036) * [-895.957] (-898.187) (-897.024) (-900.316) -- 0:00:15
      894000 -- (-889.267) (-894.218) (-890.859) [-890.378] * (-888.099) [-889.103] (-901.286) (-892.941) -- 0:00:15
      894500 -- (-892.153) [-896.359] (-890.635) (-892.373) * [-890.359] (-889.769) (-891.166) (-893.801) -- 0:00:15
      895000 -- (-895.057) (-896.488) [-891.684] (-893.839) * (-896.997) [-888.382] (-894.624) (-893.482) -- 0:00:15

      Average standard deviation of split frequencies: 0.002631

      895500 -- (-894.532) [-891.664] (-892.221) (-889.578) * (-897.782) [-892.184] (-891.052) (-887.403) -- 0:00:14
      896000 -- [-891.499] (-891.628) (-893.534) (-893.327) * (-888.893) (-890.463) (-890.240) [-890.266] -- 0:00:14
      896500 -- (-892.964) [-892.763] (-898.268) (-891.983) * (-892.823) (-896.075) (-890.643) [-890.826] -- 0:00:14
      897000 -- [-892.398] (-896.015) (-894.054) (-889.337) * (-894.356) (-893.533) (-895.448) [-893.049] -- 0:00:14
      897500 -- [-888.386] (-891.181) (-897.735) (-887.756) * [-894.223] (-894.128) (-888.784) (-893.904) -- 0:00:14
      898000 -- (-889.276) [-892.124] (-894.737) (-900.916) * (-890.649) [-890.399] (-891.998) (-900.759) -- 0:00:14
      898500 -- [-890.249] (-894.873) (-887.739) (-894.909) * [-890.192] (-894.724) (-892.486) (-895.089) -- 0:00:14
      899000 -- (-888.571) [-889.147] (-892.225) (-892.568) * (-894.203) (-891.329) [-898.562] (-891.926) -- 0:00:14
      899500 -- (-889.722) (-891.459) (-890.649) [-891.186] * (-892.997) (-891.968) (-894.997) [-892.562] -- 0:00:14
      900000 -- (-898.682) (-888.080) [-891.543] (-894.314) * (-895.540) [-893.437] (-892.636) (-897.731) -- 0:00:14

      Average standard deviation of split frequencies: 0.002094

      900500 -- (-891.664) (-891.416) (-887.795) [-898.117] * [-890.152] (-896.914) (-894.552) (-904.697) -- 0:00:14
      901000 -- [-888.996] (-893.926) (-892.300) (-893.143) * (-889.824) (-890.622) [-901.004] (-891.047) -- 0:00:14
      901500 -- [-889.504] (-893.478) (-899.004) (-894.499) * (-891.598) (-892.632) (-894.458) [-892.127] -- 0:00:14
      902000 -- (-891.887) (-894.623) (-894.531) [-891.148] * (-888.851) [-895.095] (-894.761) (-891.577) -- 0:00:14
      902500 -- (-892.309) [-892.945] (-898.137) (-891.599) * [-893.922] (-891.758) (-895.393) (-889.022) -- 0:00:13
      903000 -- (-891.455) (-889.958) (-893.137) [-888.907] * (-895.970) [-894.342] (-891.142) (-895.189) -- 0:00:13
      903500 -- (-894.351) (-894.048) [-890.572] (-893.226) * (-896.646) [-891.099] (-898.398) (-891.519) -- 0:00:13
      904000 -- (-896.640) (-891.564) [-888.861] (-890.219) * [-892.574] (-890.909) (-891.599) (-891.233) -- 0:00:13
      904500 -- (-895.801) (-895.077) (-891.121) [-889.732] * (-891.978) (-893.637) (-890.294) [-888.245] -- 0:00:13
      905000 -- [-891.873] (-896.844) (-888.961) (-894.286) * (-891.662) (-898.087) (-891.945) [-891.830] -- 0:00:13

      Average standard deviation of split frequencies: 0.002081

      905500 -- (-894.034) (-891.219) (-889.101) [-892.408] * [-892.699] (-896.527) (-890.411) (-894.254) -- 0:00:13
      906000 -- (-894.107) [-886.916] (-889.088) (-900.494) * (-893.434) (-892.210) (-891.384) [-890.855] -- 0:00:13
      906500 -- (-890.834) (-890.878) [-888.949] (-891.890) * (-890.023) (-891.661) [-890.831] (-892.114) -- 0:00:13
      907000 -- [-897.581] (-891.485) (-890.777) (-896.808) * (-890.990) (-888.224) [-891.235] (-893.341) -- 0:00:13
      907500 -- (-895.479) (-891.197) [-892.010] (-893.591) * [-890.164] (-894.827) (-900.234) (-894.174) -- 0:00:13
      908000 -- (-890.117) (-890.392) (-895.163) [-891.860] * (-891.436) (-890.809) (-894.044) [-893.360] -- 0:00:13
      908500 -- (-888.332) (-899.546) [-890.858] (-894.893) * [-893.899] (-894.492) (-890.344) (-895.866) -- 0:00:13
      909000 -- [-887.917] (-894.702) (-890.585) (-891.419) * (-893.554) (-888.280) [-891.688] (-896.019) -- 0:00:13
      909500 -- (-890.932) (-890.474) [-894.202] (-891.812) * (-890.675) (-890.352) [-890.660] (-890.790) -- 0:00:12
      910000 -- (-896.867) (-894.428) (-894.485) [-892.547] * (-891.870) [-891.176] (-898.250) (-891.741) -- 0:00:12

      Average standard deviation of split frequencies: 0.003106

      910500 -- (-897.761) (-889.073) [-892.277] (-897.215) * [-891.212] (-897.403) (-898.833) (-890.285) -- 0:00:12
      911000 -- (-893.566) [-888.074] (-894.615) (-896.188) * (-889.096) (-894.250) (-892.769) [-891.928] -- 0:00:12
      911500 -- [-891.506] (-892.267) (-894.139) (-894.702) * (-888.718) [-892.053] (-890.084) (-892.567) -- 0:00:12
      912000 -- [-886.370] (-893.086) (-898.012) (-895.347) * (-890.329) (-892.136) [-888.461] (-891.013) -- 0:00:12
      912500 -- (-890.571) (-891.191) (-896.905) [-890.445] * [-894.544] (-888.677) (-893.366) (-895.165) -- 0:00:12
      913000 -- (-891.629) [-889.798] (-887.759) (-896.540) * (-894.308) [-888.950] (-893.775) (-889.548) -- 0:00:12
      913500 -- (-892.139) (-896.133) [-890.782] (-895.631) * (-895.147) (-891.738) (-890.894) [-892.826] -- 0:00:12
      914000 -- (-898.576) [-888.890] (-897.242) (-894.632) * (-896.447) (-890.469) (-894.932) [-889.871] -- 0:00:12
      914500 -- (-896.329) [-892.671] (-897.900) (-892.492) * [-893.761] (-892.581) (-889.672) (-890.200) -- 0:00:12
      915000 -- (-896.326) [-891.345] (-898.589) (-893.682) * [-896.044] (-890.692) (-893.129) (-895.393) -- 0:00:12

      Average standard deviation of split frequencies: 0.004117

      915500 -- [-897.366] (-889.080) (-899.169) (-892.607) * (-890.392) [-891.916] (-894.049) (-889.947) -- 0:00:12
      916000 -- (-897.796) [-891.512] (-900.040) (-895.441) * (-891.076) [-889.065] (-897.913) (-892.187) -- 0:00:12
      916500 -- [-890.843] (-896.185) (-893.947) (-891.207) * (-893.836) [-890.482] (-891.655) (-890.726) -- 0:00:11
      917000 -- (-893.340) (-894.083) (-894.345) [-891.095] * [-890.580] (-890.705) (-889.137) (-890.940) -- 0:00:11
      917500 -- (-890.989) (-888.803) [-896.466] (-891.574) * (-895.146) [-888.722] (-890.973) (-892.314) -- 0:00:11
      918000 -- (-894.943) [-892.847] (-895.234) (-895.993) * (-896.737) (-896.529) (-892.088) [-888.473] -- 0:00:11
      918500 -- (-890.191) (-890.536) [-891.765] (-898.537) * (-888.895) [-893.114] (-890.206) (-889.068) -- 0:00:11
      919000 -- (-899.572) (-888.437) [-891.145] (-895.426) * [-889.446] (-894.842) (-895.944) (-891.376) -- 0:00:11
      919500 -- (-898.637) (-890.009) [-897.001] (-893.256) * [-892.839] (-900.330) (-899.413) (-892.179) -- 0:00:11
      920000 -- (-891.966) (-897.984) [-887.567] (-893.823) * (-893.611) (-893.269) (-895.335) [-895.786] -- 0:00:11

      Average standard deviation of split frequencies: 0.004608

      920500 -- [-889.060] (-891.616) (-892.598) (-897.907) * (-893.347) (-890.952) (-894.308) [-891.319] -- 0:00:11
      921000 -- (-891.217) (-889.743) [-888.456] (-893.816) * (-892.636) (-896.076) [-893.345] (-893.344) -- 0:00:11
      921500 -- (-894.145) (-889.491) (-893.137) [-890.862] * (-890.287) (-893.130) [-894.529] (-897.487) -- 0:00:11
      922000 -- (-894.362) [-892.393] (-891.812) (-886.474) * (-890.943) (-892.006) [-892.238] (-898.187) -- 0:00:11
      922500 -- (-891.473) (-895.094) [-892.515] (-893.613) * [-893.199] (-893.689) (-897.059) (-893.523) -- 0:00:11
      923000 -- (-891.788) (-892.143) [-888.561] (-892.402) * (-895.826) (-894.438) [-890.427] (-894.861) -- 0:00:11
      923500 -- (-889.121) (-892.869) [-890.936] (-892.298) * (-892.256) (-893.501) (-891.134) [-894.258] -- 0:00:10
      924000 -- (-890.261) [-889.871] (-891.191) (-891.825) * [-892.085] (-890.403) (-888.929) (-895.725) -- 0:00:10
      924500 -- (-894.518) [-892.004] (-892.989) (-891.417) * (-894.746) [-892.467] (-894.125) (-891.761) -- 0:00:10
      925000 -- [-889.837] (-890.571) (-897.041) (-891.035) * (-889.250) (-890.795) [-891.828] (-888.720) -- 0:00:10

      Average standard deviation of split frequencies: 0.004073

      925500 -- (-888.512) [-889.794] (-892.120) (-894.338) * (-892.681) (-890.073) (-889.565) [-892.422] -- 0:00:10
      926000 -- (-890.026) [-889.920] (-895.722) (-890.538) * (-897.234) [-892.900] (-895.784) (-895.937) -- 0:00:10
      926500 -- (-892.554) [-892.127] (-889.857) (-890.021) * [-895.135] (-903.447) (-895.689) (-890.357) -- 0:00:10
      927000 -- (-895.144) (-892.730) (-897.392) [-889.811] * (-890.243) (-893.542) (-895.661) [-896.002] -- 0:00:10
      927500 -- [-889.132] (-892.376) (-889.144) (-891.030) * [-888.428] (-889.420) (-891.202) (-891.977) -- 0:00:10
      928000 -- (-891.526) (-889.679) (-891.429) [-888.614] * (-892.387) [-888.383] (-893.052) (-898.250) -- 0:00:10
      928500 -- (-889.673) (-889.586) [-890.284] (-892.726) * [-888.076] (-892.849) (-894.364) (-897.893) -- 0:00:10
      929000 -- (-893.560) (-895.367) (-893.619) [-891.403] * [-892.474] (-898.037) (-892.418) (-897.657) -- 0:00:10
      929500 -- (-891.166) (-891.847) (-895.689) [-887.428] * [-888.356] (-899.032) (-889.667) (-895.436) -- 0:00:10
      930000 -- (-889.719) (-894.923) [-890.816] (-890.423) * (-895.029) [-893.023] (-889.457) (-893.238) -- 0:00:10

      Average standard deviation of split frequencies: 0.004052

      930500 -- (-892.538) (-898.093) (-890.850) [-889.137] * (-895.357) (-899.351) [-892.816] (-895.098) -- 0:00:09
      931000 -- (-893.420) (-897.626) (-893.988) [-889.692] * [-892.529] (-895.966) (-895.892) (-895.908) -- 0:00:09
      931500 -- (-895.371) (-894.766) (-892.533) [-890.733] * (-893.602) [-893.392] (-888.988) (-889.856) -- 0:00:09
      932000 -- (-892.186) [-891.991] (-889.350) (-892.520) * [-892.255] (-897.420) (-893.453) (-890.558) -- 0:00:09
      932500 -- (-897.745) (-887.577) (-893.969) [-897.669] * (-892.961) [-890.014] (-891.927) (-891.407) -- 0:00:09
      933000 -- (-892.842) [-890.141] (-889.845) (-894.850) * (-890.934) [-892.857] (-890.842) (-890.540) -- 0:00:09
      933500 -- [-890.649] (-890.736) (-892.017) (-892.355) * (-901.390) [-891.903] (-891.985) (-888.338) -- 0:00:09
      934000 -- [-890.617] (-893.214) (-890.201) (-893.177) * (-898.485) (-891.329) [-888.715] (-887.885) -- 0:00:09
      934500 -- [-894.243] (-894.022) (-892.884) (-893.642) * (-890.664) [-889.170] (-893.445) (-894.284) -- 0:00:09
      935000 -- [-890.156] (-896.989) (-890.118) (-892.660) * (-892.431) [-894.654] (-893.111) (-896.175) -- 0:00:09

      Average standard deviation of split frequencies: 0.004029

      935500 -- [-888.612] (-895.283) (-892.150) (-890.789) * (-894.984) [-892.180] (-897.458) (-893.356) -- 0:00:09
      936000 -- [-891.439] (-892.339) (-899.524) (-890.829) * (-895.104) [-890.827] (-896.303) (-896.974) -- 0:00:09
      936500 -- [-889.606] (-891.270) (-890.844) (-892.958) * (-896.692) [-895.143] (-892.725) (-897.329) -- 0:00:09
      937000 -- (-890.305) (-889.099) (-897.701) [-890.032] * (-896.959) [-890.511] (-890.269) (-892.799) -- 0:00:09
      937500 -- (-889.424) (-893.918) [-892.929] (-890.188) * (-895.191) [-891.973] (-897.376) (-893.355) -- 0:00:08
      938000 -- (-895.493) (-890.514) [-889.117] (-889.873) * (-890.185) [-895.249] (-895.918) (-892.078) -- 0:00:08
      938500 -- (-891.312) (-893.870) [-893.471] (-892.508) * (-894.530) (-890.058) (-892.356) [-890.689] -- 0:00:08
      939000 -- (-893.025) (-889.872) (-891.377) [-891.973] * (-894.262) [-893.410] (-891.713) (-887.789) -- 0:00:08
      939500 -- (-892.185) [-890.790] (-892.149) (-890.874) * [-891.958] (-889.659) (-898.455) (-893.541) -- 0:00:08
      940000 -- (-897.772) [-894.464] (-890.399) (-892.868) * (-895.823) [-891.229] (-893.955) (-892.910) -- 0:00:08

      Average standard deviation of split frequencies: 0.004009

      940500 -- (-888.893) (-895.073) (-902.837) [-894.114] * (-900.700) (-887.680) [-895.441] (-894.836) -- 0:00:08
      941000 -- [-887.493] (-892.955) (-893.011) (-894.693) * [-890.139] (-896.508) (-889.436) (-891.439) -- 0:00:08
      941500 -- (-888.704) (-888.356) (-892.000) [-891.913] * (-888.690) (-896.567) (-893.235) [-890.630] -- 0:00:08
      942000 -- (-895.719) (-889.354) (-890.796) [-888.706] * (-892.454) (-891.897) [-894.759] (-893.055) -- 0:00:08
      942500 -- (-900.007) [-892.180] (-887.336) (-893.337) * (-893.574) (-889.953) (-891.422) [-890.761] -- 0:00:08
      943000 -- [-894.855] (-889.308) (-891.586) (-897.060) * (-893.446) (-888.602) [-892.936] (-889.957) -- 0:00:08
      943500 -- (-893.114) (-889.807) (-893.922) [-888.910] * [-890.212] (-894.964) (-900.596) (-893.355) -- 0:00:08
      944000 -- (-891.023) (-887.857) [-894.651] (-890.215) * (-890.241) (-893.917) (-894.372) [-891.993] -- 0:00:08
      944500 -- (-893.964) (-890.912) [-891.157] (-892.599) * [-889.075] (-898.172) (-891.489) (-897.827) -- 0:00:07
      945000 -- (-894.903) [-889.117] (-895.076) (-890.770) * (-894.173) (-889.844) [-894.525] (-893.446) -- 0:00:07

      Average standard deviation of split frequencies: 0.003987

      945500 -- (-888.991) [-890.004] (-890.001) (-894.148) * (-898.664) (-890.737) (-894.121) [-895.633] -- 0:00:07
      946000 -- [-891.500] (-889.841) (-889.799) (-892.253) * (-901.148) (-890.161) [-890.571] (-891.055) -- 0:00:07
      946500 -- (-898.963) (-893.350) [-897.223] (-896.410) * (-894.660) (-894.897) (-889.595) [-892.829] -- 0:00:07
      947000 -- (-893.064) (-889.206) (-892.318) [-892.418] * (-890.114) [-889.685] (-892.603) (-894.881) -- 0:00:07
      947500 -- (-892.995) [-889.145] (-888.071) (-897.774) * (-895.666) (-890.095) [-893.561] (-892.224) -- 0:00:07
      948000 -- [-892.104] (-897.881) (-896.628) (-894.959) * (-890.287) [-893.811] (-894.391) (-891.691) -- 0:00:07
      948500 -- (-893.594) (-894.776) [-897.849] (-892.403) * (-888.243) (-890.533) (-891.848) [-891.200] -- 0:00:07
      949000 -- [-888.501] (-892.575) (-893.172) (-891.950) * (-891.162) (-894.861) (-889.012) [-887.969] -- 0:00:07
      949500 -- (-892.595) [-896.303] (-897.175) (-889.958) * (-898.316) [-893.740] (-892.352) (-889.730) -- 0:00:07
      950000 -- (-895.990) [-892.055] (-890.400) (-891.340) * (-892.466) (-901.209) [-888.441] (-890.953) -- 0:00:07

      Average standard deviation of split frequencies: 0.003967

      950500 -- (-895.729) (-890.166) (-899.545) [-891.149] * (-893.085) [-887.979] (-894.604) (-891.841) -- 0:00:07
      951000 -- [-890.145] (-889.401) (-895.335) (-890.294) * [-892.049] (-887.824) (-889.332) (-890.827) -- 0:00:07
      951500 -- (-896.869) (-891.704) [-891.049] (-894.620) * (-889.469) (-891.399) [-897.412] (-891.490) -- 0:00:06
      952000 -- (-897.399) (-897.131) (-892.422) [-889.811] * (-890.510) [-893.749] (-896.586) (-891.734) -- 0:00:06
      952500 -- (-898.244) (-890.982) [-890.203] (-889.670) * [-893.047] (-891.153) (-888.581) (-897.915) -- 0:00:06
      953000 -- (-889.296) [-893.987] (-891.565) (-895.061) * (-894.284) (-892.991) [-889.733] (-893.112) -- 0:00:06
      953500 -- (-891.388) (-893.171) (-898.599) [-890.189] * [-894.621] (-888.682) (-893.884) (-889.262) -- 0:00:06
      954000 -- [-889.353] (-891.786) (-894.248) (-900.894) * (-890.892) [-890.590] (-895.533) (-890.101) -- 0:00:06
      954500 -- (-892.995) (-892.991) (-889.964) [-895.533] * (-894.559) (-887.516) [-889.292] (-892.558) -- 0:00:06
      955000 -- (-890.489) (-890.188) (-890.428) [-894.038] * (-893.491) [-889.287] (-890.304) (-891.680) -- 0:00:06

      Average standard deviation of split frequencies: 0.004931

      955500 -- (-894.179) [-888.681] (-899.220) (-893.659) * [-892.640] (-893.610) (-890.587) (-897.967) -- 0:00:06
      956000 -- (-888.508) (-889.165) (-894.433) [-892.264] * (-892.923) (-888.697) [-889.363] (-892.036) -- 0:00:06
      956500 -- (-890.171) [-893.261] (-893.976) (-889.271) * [-889.783] (-891.987) (-898.105) (-893.857) -- 0:00:06
      957000 -- [-894.083] (-892.568) (-891.832) (-892.001) * (-890.210) (-895.902) (-893.952) [-893.402] -- 0:00:06
      957500 -- (-888.421) (-891.782) [-893.605] (-890.196) * (-896.209) (-891.506) [-888.102] (-895.138) -- 0:00:06
      958000 -- (-894.861) [-891.120] (-893.715) (-898.753) * [-890.456] (-893.124) (-889.950) (-892.413) -- 0:00:06
      958500 -- [-890.556] (-894.770) (-887.367) (-894.935) * [-895.442] (-895.769) (-900.684) (-891.565) -- 0:00:05
      959000 -- [-892.614] (-891.719) (-891.221) (-895.849) * [-895.094] (-889.730) (-889.151) (-894.319) -- 0:00:05
      959500 -- (-894.326) (-888.817) [-890.637] (-897.039) * [-889.626] (-896.906) (-895.185) (-892.795) -- 0:00:05
      960000 -- (-896.293) (-890.420) (-895.755) [-891.115] * (-896.144) (-895.030) [-890.568] (-889.610) -- 0:00:05

      Average standard deviation of split frequencies: 0.004416

      960500 -- (-891.728) (-893.033) [-893.087] (-891.989) * (-895.449) (-895.182) (-887.334) [-895.493] -- 0:00:05
      961000 -- [-902.521] (-890.498) (-899.391) (-893.584) * [-896.615] (-899.872) (-889.261) (-894.279) -- 0:00:05
      961500 -- (-889.940) (-888.771) (-899.561) [-891.195] * (-893.662) (-893.770) [-889.748] (-891.593) -- 0:00:05
      962000 -- (-892.965) [-892.414] (-895.556) (-893.130) * (-891.108) (-890.621) (-897.413) [-888.107] -- 0:00:05
      962500 -- (-892.976) [-889.246] (-894.984) (-897.862) * (-894.284) [-889.156] (-892.734) (-889.325) -- 0:00:05
      963000 -- (-892.526) [-891.052] (-890.140) (-890.670) * (-895.507) (-888.810) [-891.675] (-893.259) -- 0:00:05
      963500 -- [-888.979] (-894.018) (-889.408) (-898.305) * (-894.990) [-891.090] (-896.486) (-890.525) -- 0:00:05
      964000 -- (-889.970) [-890.551] (-890.358) (-896.740) * [-891.077] (-888.244) (-899.043) (-893.964) -- 0:00:05
      964500 -- (-889.671) (-890.953) [-890.880] (-890.242) * (-900.053) [-890.087] (-889.783) (-892.909) -- 0:00:05
      965000 -- (-893.334) (-888.199) [-899.226] (-889.230) * (-898.429) [-890.708] (-892.950) (-892.749) -- 0:00:05

      Average standard deviation of split frequencies: 0.003904

      965500 -- (-892.781) [-891.705] (-890.529) (-896.977) * (-891.443) [-891.748] (-893.310) (-889.569) -- 0:00:04
      966000 -- (-889.702) [-891.027] (-889.587) (-889.989) * (-894.025) [-892.868] (-897.315) (-893.633) -- 0:00:04
      966500 -- (-895.341) [-892.245] (-895.176) (-889.009) * [-893.766] (-892.055) (-893.015) (-892.903) -- 0:00:04
      967000 -- (-888.413) (-892.408) [-887.743] (-889.199) * (-894.363) [-890.437] (-891.754) (-897.028) -- 0:00:04
      967500 -- (-892.494) (-897.621) [-891.799] (-893.118) * (-888.947) [-895.200] (-890.466) (-894.424) -- 0:00:04
      968000 -- (-891.647) [-887.410] (-893.239) (-896.635) * [-892.492] (-900.733) (-891.890) (-896.168) -- 0:00:04
      968500 -- [-893.730] (-890.102) (-888.673) (-895.469) * [-890.074] (-894.870) (-892.343) (-891.876) -- 0:00:04
      969000 -- (-894.408) (-894.108) (-892.737) [-888.264] * (-894.252) [-890.364] (-893.184) (-889.211) -- 0:00:04
      969500 -- (-896.140) (-897.819) (-893.343) [-891.798] * [-896.058] (-894.633) (-887.441) (-889.551) -- 0:00:04
      970000 -- (-891.655) (-900.096) [-889.971] (-896.146) * (-899.899) [-889.812] (-896.543) (-893.840) -- 0:00:04

      Average standard deviation of split frequencies: 0.002914

      970500 -- (-888.711) (-897.789) (-891.384) [-888.284] * (-892.543) (-891.721) (-891.183) [-888.313] -- 0:00:04
      971000 -- [-888.437] (-896.772) (-892.792) (-889.828) * (-896.637) (-890.870) [-893.002] (-891.412) -- 0:00:04
      971500 -- (-890.300) (-891.931) [-891.046] (-886.469) * [-892.877] (-893.071) (-895.261) (-897.026) -- 0:00:04
      972000 -- (-891.951) (-897.249) (-892.396) [-887.403] * (-891.429) [-891.850] (-894.069) (-890.782) -- 0:00:04
      972500 -- (-893.687) (-898.810) (-891.172) [-893.619] * [-894.145] (-901.589) (-897.538) (-891.258) -- 0:00:03
      973000 -- (-896.571) (-891.967) (-894.406) [-888.992] * (-892.021) [-892.685] (-893.724) (-890.973) -- 0:00:03
      973500 -- (-893.578) [-889.889] (-900.079) (-892.147) * (-893.179) (-891.977) [-891.962] (-892.042) -- 0:00:03
      974000 -- [-893.915] (-894.558) (-891.042) (-887.780) * (-900.624) (-890.732) (-899.477) [-890.751] -- 0:00:03
      974500 -- (-900.584) (-889.929) (-891.059) [-888.296] * [-893.803] (-896.514) (-897.202) (-890.338) -- 0:00:03
      975000 -- (-903.724) [-892.711] (-892.180) (-894.552) * (-893.676) (-898.952) [-897.103] (-896.586) -- 0:00:03

      Average standard deviation of split frequencies: 0.002898

      975500 -- (-899.446) (-893.383) [-891.924] (-891.898) * (-894.757) (-894.026) (-895.400) [-890.302] -- 0:00:03
      976000 -- (-891.755) (-897.238) (-889.431) [-891.724] * (-893.129) (-901.859) (-897.754) [-890.227] -- 0:00:03
      976500 -- [-889.859] (-894.771) (-892.334) (-892.259) * (-891.538) (-890.418) [-890.114] (-892.402) -- 0:00:03
      977000 -- (-888.455) (-893.220) (-889.055) [-888.391] * (-892.175) (-891.507) (-893.316) [-893.076] -- 0:00:03
      977500 -- [-889.306] (-899.711) (-893.142) (-892.789) * (-892.234) [-894.938] (-890.552) (-897.195) -- 0:00:03
      978000 -- [-893.628] (-897.156) (-893.542) (-889.803) * (-893.999) [-904.463] (-898.938) (-890.834) -- 0:00:03
      978500 -- [-894.840] (-892.888) (-890.171) (-890.267) * [-891.612] (-899.893) (-893.359) (-893.487) -- 0:00:03
      979000 -- (-895.038) (-892.914) (-891.510) [-889.727] * [-891.137] (-899.430) (-890.964) (-893.364) -- 0:00:03
      979500 -- (-895.088) [-889.271] (-892.538) (-893.840) * [-890.775] (-889.057) (-893.090) (-900.557) -- 0:00:02
      980000 -- [-890.783] (-888.364) (-892.647) (-890.720) * [-892.484] (-897.268) (-890.830) (-894.158) -- 0:00:02

      Average standard deviation of split frequencies: 0.002884

      980500 -- [-891.353] (-889.444) (-890.080) (-890.371) * (-892.747) [-888.440] (-892.851) (-893.366) -- 0:00:02
      981000 -- (-896.280) [-890.694] (-891.732) (-891.226) * (-892.315) [-889.365] (-891.574) (-889.591) -- 0:00:02
      981500 -- (-894.021) (-894.846) [-890.284] (-887.805) * (-890.967) (-892.715) [-891.928] (-892.161) -- 0:00:02
      982000 -- [-893.269] (-893.967) (-895.985) (-889.674) * (-892.115) [-890.065] (-890.685) (-897.359) -- 0:00:02
      982500 -- (-895.762) (-894.332) (-892.644) [-892.109] * [-891.122] (-889.563) (-896.261) (-891.408) -- 0:00:02
      983000 -- (-891.016) [-893.720] (-898.257) (-889.071) * (-890.634) (-891.191) (-891.601) [-891.366] -- 0:00:02
      983500 -- (-894.331) (-888.256) (-893.438) [-898.605] * (-889.531) (-890.248) (-895.679) [-893.173] -- 0:00:02
      984000 -- (-893.573) (-890.491) (-887.463) [-889.274] * [-894.939] (-888.584) (-898.308) (-895.727) -- 0:00:02
      984500 -- [-888.938] (-893.429) (-892.935) (-894.514) * (-888.194) (-889.941) [-889.214] (-895.772) -- 0:00:02
      985000 -- (-891.126) (-890.557) (-890.299) [-891.832] * (-899.232) (-891.666) [-889.283] (-892.324) -- 0:00:02

      Average standard deviation of split frequencies: 0.002869

      985500 -- [-893.279] (-889.510) (-894.052) (-888.438) * (-892.938) (-889.819) [-892.706] (-892.646) -- 0:00:02
      986000 -- (-891.823) (-891.394) (-890.708) [-889.504] * (-890.812) (-895.670) (-891.531) [-888.675] -- 0:00:02
      986500 -- (-888.318) (-896.465) [-889.365] (-891.206) * (-892.905) [-894.073] (-889.901) (-887.181) -- 0:00:01
      987000 -- [-890.913] (-887.316) (-895.860) (-892.106) * (-892.507) [-892.032] (-891.751) (-893.615) -- 0:00:01
      987500 -- (-892.091) (-892.111) (-894.775) [-892.824] * [-893.311] (-898.469) (-889.429) (-891.536) -- 0:00:01
      988000 -- [-893.136] (-891.951) (-899.204) (-893.968) * (-888.944) (-900.156) [-890.931] (-891.652) -- 0:00:01
      988500 -- (-896.363) (-887.859) [-891.784] (-903.366) * (-888.082) (-892.599) (-890.948) [-893.534] -- 0:00:01
      989000 -- (-889.861) [-891.673] (-893.989) (-892.481) * (-888.813) [-892.025] (-886.665) (-896.720) -- 0:00:01
      989500 -- (-888.806) [-890.410] (-895.294) (-888.850) * (-896.094) (-888.744) [-894.173] (-902.335) -- 0:00:01
      990000 -- [-890.539] (-889.073) (-893.634) (-893.498) * (-894.869) [-890.212] (-893.220) (-892.801) -- 0:00:01

      Average standard deviation of split frequencies: 0.003331

      990500 -- (-891.856) (-893.181) [-890.394] (-888.809) * (-894.668) (-890.303) [-891.193] (-897.164) -- 0:00:01
      991000 -- (-896.677) (-897.364) [-895.824] (-894.104) * (-890.694) (-895.660) [-890.106] (-890.999) -- 0:00:01
      991500 -- [-891.380] (-896.831) (-892.965) (-894.305) * (-896.978) (-891.566) [-889.651] (-888.048) -- 0:00:01
      992000 -- (-892.838) (-892.731) (-889.863) [-890.596] * (-890.395) [-891.678] (-891.536) (-893.506) -- 0:00:01
      992500 -- [-891.532] (-890.961) (-893.189) (-895.599) * (-893.431) (-888.969) (-895.627) [-890.830] -- 0:00:01
      993000 -- (-890.799) [-887.912] (-891.994) (-891.154) * (-889.866) (-895.474) (-890.761) [-890.117] -- 0:00:01
      993500 -- (-892.095) (-898.830) (-893.113) [-893.869] * (-890.463) (-894.794) [-890.825] (-895.795) -- 0:00:00
      994000 -- (-893.993) [-893.549] (-889.415) (-900.530) * (-895.768) (-888.037) (-893.338) [-897.594] -- 0:00:00
      994500 -- (-889.646) (-890.407) (-891.295) [-900.023] * (-889.272) [-891.166] (-888.964) (-891.071) -- 0:00:00
      995000 -- [-894.123] (-888.259) (-890.194) (-900.409) * [-891.736] (-891.584) (-894.640) (-894.526) -- 0:00:00

      Average standard deviation of split frequencies: 0.003786

      995500 -- (-892.545) (-892.430) (-892.798) [-894.132] * (-891.172) (-895.745) [-894.097] (-891.282) -- 0:00:00
      996000 -- [-890.267] (-895.649) (-892.221) (-896.245) * [-892.121] (-893.620) (-889.099) (-894.867) -- 0:00:00
      996500 -- (-894.034) (-893.164) [-890.577] (-894.208) * (-898.344) (-892.316) (-892.376) [-892.779] -- 0:00:00
      997000 -- (-895.259) (-897.913) [-889.566] (-894.321) * [-894.571] (-888.899) (-895.389) (-889.419) -- 0:00:00
      997500 -- (-893.818) [-886.846] (-891.746) (-892.612) * [-892.550] (-888.817) (-888.351) (-895.594) -- 0:00:00
      998000 -- (-891.710) [-890.519] (-895.599) (-899.384) * (-891.661) [-888.294] (-891.999) (-894.103) -- 0:00:00
      998500 -- (-890.319) [-888.375] (-894.178) (-895.719) * [-892.243] (-895.014) (-894.992) (-896.950) -- 0:00:00
      999000 -- (-895.929) [-894.786] (-896.123) (-894.757) * [-894.061] (-893.290) (-894.517) (-893.298) -- 0:00:00
      999500 -- (-896.694) [-895.691] (-895.753) (-891.803) * (-896.194) (-893.903) (-894.186) [-891.805] -- 0:00:00
      1000000 -- (-890.852) (-891.066) (-892.648) [-898.292] * (-889.756) (-893.771) (-888.193) [-895.331] -- 0:00:00

      Average standard deviation of split frequencies: 0.002827
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -890.851632 -- 10.840362
         Chain 1 -- -890.851632 -- 10.840362
         Chain 2 -- -891.066008 -- 12.892868
         Chain 2 -- -891.066008 -- 12.892868
         Chain 3 -- -892.648414 -- 11.106489
         Chain 3 -- -892.648414 -- 11.106489
         Chain 4 -- -898.291719 -- 12.488587
         Chain 4 -- -898.291719 -- 12.488587
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -889.755832 -- 12.250880
         Chain 1 -- -889.755832 -- 12.250880
         Chain 2 -- -893.770506 -- 13.031470
         Chain 2 -- -893.770506 -- 13.031470
         Chain 3 -- -888.192769 -- 5.693924
         Chain 3 -- -888.192769 -- 5.693924
         Chain 4 -- -895.331365 -- 13.365909
         Chain 4 -- -895.331365 -- 13.365909

      Analysis completed in 2 mins 23 seconds
      Analysis used 143.12 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -885.43
      Likelihood of best state for "cold" chain of run 2 was -885.43

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            67.7 %     ( 62 %)     Dirichlet(Revmat{all})
            78.4 %     ( 59 %)     Slider(Revmat{all})
            30.5 %     ( 29 %)     Dirichlet(Pi{all})
            31.0 %     ( 26 %)     Slider(Pi{all})
            51.0 %     ( 29 %)     Multiplier(Alpha{1,2})
            49.5 %     ( 32 %)     Multiplier(Alpha{3})
            67.1 %     ( 44 %)     Slider(Pinvar{all})
             7.1 %     (  6 %)     NNI(Tau{all},V{all})
             5.7 %     (  4 %)     ParsSPR(Tau{all},V{all})
            26.4 %     ( 32 %)     Multiplier(V{all})
            37.2 %     ( 41 %)     Nodeslider(V{all})
            26.1 %     ( 26 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            68.7 %     ( 61 %)     Dirichlet(Revmat{all})
            78.9 %     ( 67 %)     Slider(Revmat{all})
            30.4 %     ( 28 %)     Dirichlet(Pi{all})
            30.4 %     ( 22 %)     Slider(Pi{all})
            51.1 %     ( 24 %)     Multiplier(Alpha{1,2})
            49.8 %     ( 27 %)     Multiplier(Alpha{3})
            66.4 %     ( 52 %)     Slider(Pinvar{all})
             6.9 %     (  7 %)     NNI(Tau{all},V{all})
             5.5 %     (  3 %)     ParsSPR(Tau{all},V{all})
            26.3 %     ( 24 %)     Multiplier(V{all})
            37.1 %     ( 28 %)     Nodeslider(V{all})
            26.1 %     ( 23 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.70    0.58 
         2 |  166436            0.86    0.72 
         3 |  166868  166737            0.87 
         4 |  166253  166929  166777         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.70    0.58 
         2 |  166519            0.85    0.73 
         3 |  167199  166365            0.87 
         4 |  166961  166471  166485         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -890.56
      |                     2                                1  1  |
      |            1      1          2  1    2                     |
      |                          1          2      1     2         |
      |   1          1                   1                 1       |
      |                  1   2                                     |
      |    1   2           2      1            1    2   2   1    1 |
      |1    2          1 2        2 2     2*    2                  |
      | *  2  1  2 2 2        1212 2        112 1         2  2 2   |
      |  2   1      1     2            2         2121           2  |
      |2     2  2     1                  2        2  2 2 1  2 1    |
      |  12 1    11   2 1   1 21   11121  1   12       1   2  21 22|
      |        1                2                1      1         1|
      |         1 2    22  1            2             1   1        |
      |       2     2                 1              1             |
      |                      1                        2            |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -892.82
      ^