--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 22:11:50 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/825-Oak-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -889.70 -897.64
2 -889.77 -897.94
--------------------------------------
TOTAL -889.74 -897.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.522852 0.020542 0.280878 0.803748 0.497287 787.91 1144.45 1.000
r(A<->C){all} 0.117885 0.005050 0.001770 0.257085 0.106542 560.09 568.91 1.001
r(A<->G){all} 0.212347 0.007059 0.059244 0.372296 0.205007 496.56 558.65 1.002
r(A<->T){all} 0.237229 0.007176 0.082699 0.399957 0.227723 783.27 809.42 1.002
r(C<->G){all} 0.128731 0.002684 0.044040 0.235406 0.121330 807.66 845.39 1.001
r(C<->T){all} 0.176114 0.003498 0.060535 0.285755 0.171138 747.84 807.13 1.000
r(G<->T){all} 0.127694 0.003661 0.019685 0.240768 0.119516 654.97 697.32 1.000
pi(A){all} 0.120025 0.000213 0.090364 0.147662 0.119679 1375.25 1395.52 1.000
pi(C){all} 0.365767 0.000461 0.325288 0.409917 0.365668 1293.21 1397.11 1.000
pi(G){all} 0.239168 0.000388 0.201284 0.278077 0.238387 1314.49 1321.00 1.000
pi(T){all} 0.275040 0.000406 0.236830 0.315056 0.274351 1274.11 1346.44 1.000
alpha{1,2} 0.203478 0.033950 0.000260 0.524118 0.160956 1094.65 1217.07 1.001
alpha{3} 0.906771 0.349609 0.137599 2.074984 0.748727 1246.15 1273.14 1.000
pinvar{all} 0.278017 0.027465 0.000033 0.566670 0.264733 756.55 978.69 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -776.102101
Model 2: PositiveSelection -771.423592
Model 0: one-ratio -786.152998
Model 3: discrete -771.423592
Model 7: beta -776.207867
Model 8: beta&w>1 -771.425925
Model 0 vs 1 20.101794000000154
Model 2 vs 1 9.357017999999925
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.506 3.073
66 A 0.961* 5.722
68 P 0.990* 5.891
69 L 0.993** 5.907
73 V 0.999** 5.943
76 K 0.989* 5.883
77 Y 0.978* 5.821
78 A 0.985* 5.860
80 T 0.670 4.029
89 K 0.991** 5.895
90 A 0.970* 5.773
92 T 0.670 4.029
97 R 0.501 3.046
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.791 5.415 +- 3.049
68 P 0.873 5.892 +- 2.795
69 L 0.915 6.176 +- 2.651
73 V 0.941 6.345 +- 2.530
76 K 0.882 5.967 +- 2.772
77 Y 0.822 5.569 +- 2.947
78 A 0.880 5.979 +- 2.796
80 T 0.542 3.742 +- 3.303
89 K 0.896 6.053 +- 2.722
90 A 0.784 5.315 +- 3.023
92 T 0.542 3.742 +- 3.303
Model 8 vs 7 9.563883999999916
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.505 3.074
66 A 0.959* 5.713
68 P 0.989* 5.889
69 L 0.992** 5.906
73 V 0.999** 5.944
76 K 0.988* 5.881
77 Y 0.977* 5.816
78 A 0.984* 5.857
80 T 0.669 4.029
89 K 0.990** 5.894
90 A 0.968* 5.765
92 T 0.669 4.029
97 R 0.501 3.048
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.864 5.566 +- 2.800
68 P 0.933 5.974 +- 2.516
69 L 0.956* 6.131 +- 2.415
73 V 0.976* 6.257 +- 2.305
76 K 0.936 6.002 +- 2.509
77 Y 0.895 5.728 +- 2.675
78 A 0.930 5.985 +- 2.544
80 T 0.618 3.981 +- 3.254
89 K 0.945 6.059 +- 2.467
90 A 0.867 5.540 +- 2.764
92 T 0.618 3.981 +- 3.254
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTA
TSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAAT
PLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYTAPAPVVTATSSQVIA
RNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLAAPLAAPLAAPLAY
SSPLAYSAPLSYAAAPAPLLIoooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=149
C1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
C2 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
C3 MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
C4 MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
*** ***.*.:*****************:***** :**
C1 APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
C2 APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
C3 APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
C4 APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
**************************** * **. :* *:**:**:.
C1 AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
C2 AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
C3 AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
C4 AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
* *:*:** *********************:**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2488]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [2488]--->[2229]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/825-Oak-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.208 Mb, Max= 30.411 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
FORMAT of file /tmp/tmp1440418097538211609aln Not Supported[FATAL:T-COFFEE]
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:149 S:89 BS:149
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 95.35 C1 C2 95.35
TOP 1 0 95.35 C2 C1 95.35
BOT 0 2 95.35 C1 C3 95.35
TOP 2 0 95.35 C3 C1 95.35
BOT 0 3 81.89 C1 C4 81.89
TOP 3 0 81.89 C4 C1 81.89
BOT 1 2 97.04 C2 C3 97.04
TOP 2 1 97.04 C3 C2 97.04
BOT 1 3 81.82 C2 C4 81.82
TOP 3 1 81.82 C4 C2 81.82
BOT 2 3 82.64 C3 C4 82.64
TOP 3 2 82.64 C4 C3 82.64
AVG 0 C1 * 90.86
AVG 1 C2 * 91.40
AVG 2 C3 * 91.68
AVG 3 C4 * 82.12
TOT TOT * 89.01
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC
C2 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
C3 ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
C4 ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC
**********.*** ** ** * ** * .*******************
C1 CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
C2 CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
C3 CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
C4 CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT
********************* ** * ** ***:******* *******
C1 AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C2 ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C3 ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
C4 AC---------------------------------------ACTGCTCCT
** .*******
C1 GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA
C2 GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
C3 GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
C4 GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA
*****************.************** *********** *****
C1 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
C2 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG
C3 TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
C4 TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG
***.************** ************** * ** ..: : ** *
C1 CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG
C2 CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
C3 CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
C4 CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT
** *: **** .. . ****.********.*******: *.*
C1 GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC
C2 GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC
C3 GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC
C4 GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC
** .. *** .***** *******:* ****************
C1 TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC
C2 ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
C3 ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
C4 GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC
***** *********************** *************** ***
C1 TCATC------------------------------------------
C2 TCATC------------------------------------------
C3 TCATC------------------------------------------
C4 TCATC------------------------------------------
*****
>C1
ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT
AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG
GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC
TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C2
ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG
CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC
ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C3
ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT
ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC
GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA
TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG
CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG
GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC
ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC
TCATC------------------------------------------
>C4
ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC
CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT
AC---------------------------------------ACTGCTCCT
GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA
TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG
CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT
GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC
GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC
TCATC------------------------------------------
>C1
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYooooooSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI
>C2
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C3
MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI
>C4
MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAYoooooooooooooTAP
APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
APoLAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 447 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480111724
Setting output file names to "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 959365650
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9304270436
Seed = 1177419686
Swapseed = 1480111724
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 25 unique site patterns
Division 2 has 19 unique site patterns
Division 3 has 33 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1043.858344 -- -26.620141
Chain 2 -- -1043.106005 -- -26.620141
Chain 3 -- -1043.858344 -- -26.620141
Chain 4 -- -1043.106005 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1043.858344 -- -26.620141
Chain 2 -- -1043.106005 -- -26.620141
Chain 3 -- -1019.873051 -- -26.620141
Chain 4 -- -1043.106005 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1043.858] (-1043.106) (-1043.858) (-1043.106) * [-1043.858] (-1043.106) (-1019.873) (-1043.106)
500 -- (-911.357) [-908.058] (-905.959) (-907.199) * (-910.720) [-910.150] (-897.476) (-902.731) -- 0:00:00
1000 -- (-896.578) (-900.751) [-897.406] (-898.907) * (-901.378) (-908.613) (-892.982) [-892.962] -- 0:00:00
1500 -- [-890.704] (-894.488) (-898.893) (-890.291) * (-902.080) (-898.299) (-890.089) [-890.443] -- 0:00:00
2000 -- (-890.971) (-888.918) [-897.468] (-892.637) * (-896.904) [-889.807] (-889.236) (-892.706) -- 0:00:00
2500 -- (-892.157) [-895.701] (-894.155) (-892.364) * (-900.795) (-892.550) (-891.458) [-889.345] -- 0:00:00
3000 -- [-892.786] (-894.602) (-892.891) (-891.720) * (-901.307) (-894.178) (-892.664) [-893.636] -- 0:00:00
3500 -- (-892.934) (-890.036) (-890.542) [-889.764] * [-892.139] (-892.830) (-895.223) (-894.182) -- 0:04:44
4000 -- (-898.397) (-889.582) (-890.974) [-892.548] * (-891.026) (-890.961) [-892.130] (-891.889) -- 0:04:09
4500 -- [-895.615] (-892.791) (-895.937) (-896.387) * [-896.389] (-897.418) (-891.345) (-891.894) -- 0:03:41
5000 -- [-894.348] (-889.416) (-892.866) (-888.086) * (-892.021) (-891.916) (-891.237) [-895.462] -- 0:03:19
Average standard deviation of split frequencies: 0.078567
5500 -- [-891.318] (-895.283) (-890.305) (-890.195) * (-889.502) (-893.491) (-890.971) [-891.820] -- 0:03:00
6000 -- [-889.577] (-892.156) (-889.913) (-892.791) * (-888.274) (-896.298) [-896.062] (-892.399) -- 0:02:45
6500 -- (-887.814) (-891.665) [-894.818] (-897.383) * (-891.952) [-896.695] (-894.613) (-890.999) -- 0:02:32
7000 -- (-890.824) (-892.247) (-898.357) [-899.606] * [-890.587] (-899.053) (-891.022) (-891.708) -- 0:02:21
7500 -- (-894.104) (-891.395) [-889.663] (-904.184) * (-892.418) (-893.019) (-888.502) [-895.467] -- 0:02:12
8000 -- (-895.381) (-897.562) [-892.908] (-894.485) * (-899.617) [-892.987] (-889.980) (-901.577) -- 0:02:04
8500 -- [-897.337] (-892.526) (-894.785) (-898.871) * (-891.703) [-893.728] (-894.007) (-894.384) -- 0:01:56
9000 -- (-891.434) (-893.522) [-891.482] (-891.126) * [-891.519] (-890.032) (-891.251) (-896.333) -- 0:01:50
9500 -- (-891.051) (-893.722) [-893.971] (-893.527) * [-891.926] (-894.590) (-894.093) (-892.695) -- 0:01:44
10000 -- [-892.692] (-890.891) (-894.602) (-893.562) * [-891.633] (-896.424) (-898.231) (-893.029) -- 0:01:39
Average standard deviation of split frequencies: 0.044194
10500 -- [-894.048] (-895.332) (-892.699) (-893.792) * (-893.717) (-893.584) [-890.432] (-891.463) -- 0:01:34
11000 -- (-889.215) [-890.292] (-900.933) (-891.019) * (-888.386) (-889.702) (-897.953) [-888.114] -- 0:02:59
11500 -- (-888.921) (-896.219) [-894.354] (-894.815) * (-892.675) [-891.788] (-894.736) (-890.141) -- 0:02:51
12000 -- [-889.862] (-887.547) (-895.801) (-893.636) * [-892.173] (-892.107) (-891.978) (-897.445) -- 0:02:44
12500 -- (-892.692) (-895.395) [-890.765] (-894.551) * (-890.289) [-890.039] (-892.499) (-891.628) -- 0:02:38
13000 -- [-893.417] (-896.011) (-891.345) (-889.126) * (-889.192) (-890.758) [-891.690] (-893.349) -- 0:02:31
13500 -- (-895.722) (-891.209) [-889.764] (-893.722) * (-887.430) (-892.053) [-888.004] (-891.277) -- 0:02:26
14000 -- [-891.161] (-889.666) (-894.307) (-901.781) * (-897.946) [-902.908] (-888.032) (-888.878) -- 0:02:20
14500 -- (-895.416) [-889.290] (-892.154) (-891.784) * (-892.799) (-890.684) [-888.877] (-897.015) -- 0:02:15
15000 -- (-890.522) [-890.177] (-896.567) (-892.785) * (-890.159) (-894.592) [-892.394] (-896.592) -- 0:02:11
Average standard deviation of split frequencies: 0.058926
15500 -- [-892.297] (-892.048) (-895.976) (-897.439) * (-891.362) (-892.485) [-888.981] (-894.792) -- 0:02:07
16000 -- (-887.316) (-899.658) [-894.445] (-898.821) * (-889.245) (-897.817) [-888.548] (-892.301) -- 0:02:03
16500 -- [-888.980] (-896.040) (-894.961) (-892.465) * [-893.725] (-894.395) (-889.612) (-891.508) -- 0:01:59
17000 -- [-890.981] (-893.134) (-891.751) (-891.346) * (-893.780) [-891.471] (-895.008) (-890.625) -- 0:01:55
17500 -- (-892.453) (-895.765) (-895.004) [-891.371] * [-891.306] (-890.533) (-891.872) (-891.168) -- 0:01:52
18000 -- (-889.243) [-892.396] (-896.469) (-889.174) * [-892.944] (-891.752) (-893.424) (-891.861) -- 0:02:43
18500 -- (-891.376) (-893.329) (-893.598) [-891.190] * [-890.936] (-888.470) (-892.966) (-899.232) -- 0:02:39
19000 -- (-890.975) (-892.056) (-898.671) [-888.841] * (-892.759) [-888.386] (-890.186) (-891.322) -- 0:02:34
19500 -- (-891.928) (-894.977) (-898.003) [-893.687] * (-889.089) [-894.689] (-897.748) (-890.903) -- 0:02:30
20000 -- (-890.813) (-896.343) (-893.456) [-891.331] * (-892.647) (-896.062) (-889.503) [-886.453] -- 0:02:27
Average standard deviation of split frequencies: 0.114049
20500 -- (-893.656) [-894.954] (-894.342) (-890.417) * (-891.846) (-894.727) (-888.307) [-888.824] -- 0:02:23
21000 -- (-893.146) (-895.718) (-895.865) [-892.532] * (-898.376) [-888.072] (-892.467) (-893.624) -- 0:02:19
21500 -- (-892.623) (-894.155) (-897.066) [-889.214] * (-888.728) (-889.126) [-893.766] (-898.790) -- 0:02:16
22000 -- (-890.360) (-895.375) [-893.898] (-890.984) * (-889.536) [-890.630] (-897.159) (-888.983) -- 0:02:13
22500 -- (-891.371) [-893.751] (-895.109) (-891.042) * (-890.606) [-888.762] (-892.288) (-890.379) -- 0:02:10
23000 -- (-890.348) (-895.563) (-897.906) [-892.268] * (-897.069) (-892.777) [-891.683] (-890.562) -- 0:02:07
23500 -- (-892.663) [-891.403] (-891.773) (-888.861) * (-890.521) (-893.427) (-892.609) [-890.327] -- 0:02:04
24000 -- (-891.406) (-894.127) [-890.552] (-893.931) * [-891.931] (-895.721) (-889.205) (-892.190) -- 0:02:02
24500 -- (-890.603) [-894.365] (-893.472) (-895.080) * (-892.898) (-895.345) [-893.407] (-891.549) -- 0:01:59
25000 -- (-888.559) (-893.996) [-893.901] (-890.189) * (-889.393) (-891.238) (-889.704) [-890.397] -- 0:02:36
Average standard deviation of split frequencies: 0.090655
25500 -- (-892.723) [-892.688] (-893.079) (-891.547) * (-892.204) [-892.086] (-889.001) (-891.946) -- 0:02:32
26000 -- (-889.229) (-894.090) (-893.805) [-890.593] * (-890.609) [-891.903] (-890.416) (-891.897) -- 0:02:29
26500 -- (-890.748) [-891.728] (-890.316) (-892.960) * [-893.485] (-893.089) (-891.197) (-889.329) -- 0:02:26
27000 -- (-889.730) [-893.787] (-893.910) (-897.351) * [-888.339] (-894.416) (-892.726) (-888.605) -- 0:02:24
27500 -- [-890.714] (-898.581) (-889.573) (-899.894) * (-892.643) (-897.188) (-896.108) [-892.054] -- 0:02:21
28000 -- (-890.660) (-897.916) [-891.335] (-901.140) * [-892.422] (-889.967) (-890.301) (-893.756) -- 0:02:18
28500 -- [-894.105] (-897.833) (-888.213) (-895.052) * (-896.001) [-888.806] (-889.698) (-892.847) -- 0:02:16
29000 -- (-896.828) [-894.850] (-893.789) (-893.342) * (-891.480) (-892.295) [-894.356] (-895.678) -- 0:02:13
29500 -- (-893.988) (-900.026) (-889.389) [-896.265] * (-893.696) [-889.442] (-891.613) (-895.968) -- 0:02:11
30000 -- (-889.790) (-893.271) (-893.631) [-893.185] * (-889.769) [-890.198] (-893.552) (-898.525) -- 0:02:09
Average standard deviation of split frequencies: 0.107603
30500 -- (-894.677) (-894.921) (-898.419) [-898.365] * (-889.773) [-891.514] (-897.380) (-896.787) -- 0:02:07
31000 -- (-893.492) [-895.379] (-893.212) (-894.244) * (-889.001) (-891.604) (-898.783) [-892.262] -- 0:02:05
31500 -- (-891.710) (-894.610) (-892.177) [-893.351] * (-892.132) [-890.915] (-891.513) (-903.102) -- 0:02:02
32000 -- (-893.520) (-892.864) [-891.333] (-894.527) * (-891.584) (-890.089) [-888.610] (-903.028) -- 0:02:31
32500 -- (-889.824) (-895.406) (-890.928) [-892.255] * [-889.971] (-889.656) (-890.511) (-904.225) -- 0:02:28
33000 -- (-889.239) (-894.773) [-890.825] (-892.070) * (-890.188) [-891.421] (-891.807) (-893.642) -- 0:02:26
33500 -- (-892.250) (-896.904) [-892.005] (-897.165) * (-892.334) [-890.730] (-893.494) (-892.683) -- 0:02:24
34000 -- (-892.443) (-893.623) (-897.284) [-889.786] * [-892.836] (-896.875) (-892.530) (-894.056) -- 0:02:22
34500 -- (-891.979) (-894.164) [-889.580] (-906.433) * (-889.131) (-895.106) (-893.854) [-886.976] -- 0:02:19
35000 -- (-892.910) [-896.731] (-891.412) (-896.640) * (-892.294) [-893.346] (-890.785) (-895.456) -- 0:02:17
Average standard deviation of split frequencies: 0.091662
35500 -- (-888.871) [-888.761] (-892.901) (-891.145) * (-894.553) (-894.836) [-893.137] (-890.945) -- 0:02:15
36000 -- [-887.153] (-889.197) (-895.897) (-892.943) * (-893.308) [-890.998] (-890.878) (-890.656) -- 0:02:13
36500 -- (-889.532) (-892.262) (-892.055) [-890.529] * [-890.467] (-891.522) (-893.470) (-893.158) -- 0:02:11
37000 -- [-891.630] (-888.920) (-891.233) (-892.683) * (-898.111) [-893.972] (-893.217) (-895.191) -- 0:02:10
37500 -- [-897.847] (-891.913) (-894.581) (-889.615) * (-892.352) (-894.390) [-894.856] (-894.594) -- 0:02:08
38000 -- (-896.380) (-888.792) [-895.651] (-889.114) * (-890.607) (-892.815) (-895.007) [-898.484] -- 0:02:06
38500 -- (-891.598) [-891.179] (-891.244) (-895.321) * (-891.277) (-897.779) [-893.729] (-896.513) -- 0:02:04
39000 -- (-893.903) (-889.032) [-891.655] (-893.212) * [-892.244] (-896.469) (-893.827) (-893.120) -- 0:02:27
39500 -- (-893.507) (-891.545) (-894.252) [-889.248] * (-891.555) (-890.498) (-893.828) [-892.105] -- 0:02:25
40000 -- (-895.898) (-890.420) (-893.102) [-891.410] * (-891.824) [-888.040] (-894.417) (-891.470) -- 0:02:24
Average standard deviation of split frequencies: 0.092735
40500 -- (-902.870) (-890.525) (-903.786) [-889.832] * [-891.579] (-891.828) (-890.546) (-895.868) -- 0:02:22
41000 -- (-895.202) (-891.416) [-888.086] (-891.948) * (-889.158) [-893.929] (-893.154) (-893.185) -- 0:02:20
41500 -- (-890.917) (-890.882) [-890.745] (-890.091) * [-891.907] (-891.010) (-895.040) (-893.780) -- 0:02:18
42000 -- (-895.481) [-891.198] (-894.361) (-889.241) * (-890.668) (-895.427) [-890.563] (-893.577) -- 0:02:16
42500 -- (-896.189) (-889.514) [-891.338] (-892.420) * [-892.326] (-895.554) (-892.875) (-892.753) -- 0:02:15
43000 -- (-900.388) [-890.391] (-893.772) (-890.925) * (-894.153) (-888.988) [-889.318] (-894.312) -- 0:02:13
43500 -- (-890.108) (-889.414) [-895.592] (-891.273) * (-889.970) (-888.810) [-889.464] (-896.287) -- 0:02:11
44000 -- [-890.066] (-887.899) (-891.976) (-889.657) * (-890.128) [-890.725] (-888.295) (-894.352) -- 0:02:10
44500 -- [-895.064] (-889.888) (-893.643) (-890.441) * [-888.728] (-892.542) (-896.476) (-893.429) -- 0:02:08
45000 -- (-894.704) (-893.118) (-904.665) [-893.839] * (-894.010) (-890.398) [-891.380] (-891.741) -- 0:02:07
Average standard deviation of split frequencies: 0.087107
45500 -- (-890.819) (-893.346) (-889.872) [-890.307] * (-894.558) [-892.516] (-890.673) (-897.306) -- 0:02:05
46000 -- (-900.924) (-890.820) (-898.494) [-889.628] * (-898.754) (-897.477) (-895.620) [-892.789] -- 0:02:04
46500 -- (-892.630) [-893.183] (-892.963) (-895.422) * (-897.977) (-891.825) [-889.251] (-893.986) -- 0:02:23
47000 -- (-891.099) (-892.789) [-890.251] (-892.149) * (-895.360) (-893.389) [-893.767] (-889.645) -- 0:02:21
47500 -- [-893.440] (-888.187) (-890.264) (-891.343) * (-895.195) (-894.278) (-892.846) [-891.785] -- 0:02:20
48000 -- (-891.618) (-896.895) [-893.636] (-892.330) * (-891.266) (-895.548) [-891.265] (-892.354) -- 0:02:18
48500 -- (-893.897) (-894.950) (-891.452) [-889.027] * (-889.872) [-890.660] (-890.259) (-891.355) -- 0:02:17
49000 -- (-894.189) (-889.907) (-890.652) [-890.563] * [-892.028] (-888.435) (-898.070) (-897.805) -- 0:02:15
49500 -- [-890.108] (-895.024) (-892.452) (-890.369) * (-888.736) (-894.515) (-896.458) [-898.968] -- 0:02:14
50000 -- (-895.587) (-888.977) [-888.493] (-892.371) * (-887.258) [-890.122] (-903.441) (-898.152) -- 0:02:13
Average standard deviation of split frequencies: 0.079084
50500 -- (-887.633) [-890.769] (-893.158) (-893.081) * (-893.055) [-890.947] (-895.713) (-896.519) -- 0:02:11
51000 -- (-888.028) (-890.407) (-896.784) [-890.760] * [-888.542] (-891.725) (-891.851) (-892.484) -- 0:02:10
51500 -- [-890.281] (-894.132) (-892.573) (-893.166) * (-888.838) [-891.705] (-903.610) (-892.481) -- 0:02:08
52000 -- (-899.320) (-892.518) (-893.771) [-893.772] * (-890.171) [-891.279] (-903.669) (-892.853) -- 0:02:07
52500 -- [-892.566] (-889.405) (-889.169) (-895.236) * [-890.989] (-888.127) (-896.887) (-894.863) -- 0:02:06
53000 -- (-890.546) (-889.239) [-893.570] (-892.862) * (-886.759) [-891.434] (-898.289) (-891.792) -- 0:02:05
53500 -- [-894.636] (-896.568) (-891.755) (-893.422) * (-887.599) (-887.981) [-890.541] (-893.132) -- 0:02:21
54000 -- [-887.763] (-897.317) (-893.080) (-893.410) * (-897.511) (-894.530) (-892.057) [-897.733] -- 0:02:20
54500 -- (-894.564) (-897.859) (-890.565) [-890.784] * (-886.993) [-889.334] (-892.390) (-895.409) -- 0:02:18
55000 -- [-888.566] (-891.443) (-895.063) (-890.400) * (-895.453) [-891.004] (-890.124) (-895.696) -- 0:02:17
Average standard deviation of split frequencies: 0.075761
55500 -- (-890.166) [-887.455] (-896.159) (-893.336) * (-888.879) [-890.014] (-896.408) (-901.164) -- 0:02:16
56000 -- [-895.580] (-893.386) (-894.441) (-902.384) * [-894.715] (-894.048) (-891.904) (-901.040) -- 0:02:14
56500 -- (-895.357) (-894.003) [-891.217] (-891.687) * (-890.913) (-896.103) (-892.820) [-888.702] -- 0:02:13
57000 -- [-889.691] (-894.968) (-899.185) (-888.855) * (-887.850) (-897.075) [-891.451] (-892.642) -- 0:02:12
57500 -- (-895.286) (-894.591) [-895.877] (-895.374) * (-893.521) (-895.173) (-892.513) [-891.231] -- 0:02:11
58000 -- (-893.787) [-890.164] (-894.436) (-891.943) * (-895.662) (-897.968) [-890.126] (-891.178) -- 0:02:09
58500 -- (-888.355) (-890.782) (-892.901) [-894.335] * [-887.911] (-890.965) (-889.177) (-892.575) -- 0:02:08
59000 -- (-888.758) [-895.080] (-895.184) (-895.539) * (-888.566) (-890.029) [-887.379] (-893.628) -- 0:02:07
59500 -- [-888.346] (-891.717) (-897.390) (-889.083) * [-888.117] (-895.593) (-889.114) (-895.379) -- 0:02:06
60000 -- (-893.197) [-891.236] (-892.142) (-890.540) * (-891.987) [-889.662] (-893.754) (-895.751) -- 0:02:05
Average standard deviation of split frequencies: 0.062163
60500 -- (-889.248) (-893.893) [-897.747] (-898.203) * [-889.875] (-894.846) (-892.271) (-892.486) -- 0:02:19
61000 -- (-897.947) (-890.959) [-895.452] (-895.679) * (-892.425) (-898.070) (-896.447) [-892.201] -- 0:02:18
61500 -- [-890.215] (-889.341) (-890.034) (-891.573) * (-892.808) [-890.851] (-893.748) (-893.200) -- 0:02:17
62000 -- (-892.300) (-888.688) [-895.129] (-889.713) * (-895.965) [-890.834] (-895.948) (-893.489) -- 0:02:16
62500 -- (-893.735) (-893.914) [-890.293] (-890.595) * (-893.964) [-891.105] (-892.332) (-889.025) -- 0:02:15
63000 -- [-892.483] (-890.998) (-890.963) (-893.011) * (-896.495) (-894.929) [-892.250] (-892.224) -- 0:02:13
63500 -- (-893.427) [-894.968] (-891.993) (-891.908) * [-897.313] (-898.002) (-893.618) (-891.192) -- 0:02:12
64000 -- (-893.129) [-891.467] (-890.112) (-894.877) * (-903.093) [-896.007] (-895.496) (-889.180) -- 0:02:11
64500 -- (-891.314) [-890.042] (-892.959) (-889.127) * (-902.464) (-897.007) (-893.878) [-888.586] -- 0:02:10
65000 -- (-891.363) (-894.495) (-892.953) [-891.275] * (-901.384) (-898.817) (-897.227) [-898.350] -- 0:02:09
Average standard deviation of split frequencies: 0.049997
65500 -- [-890.246] (-891.414) (-895.926) (-891.269) * (-892.864) (-893.879) (-891.136) [-889.427] -- 0:02:08
66000 -- (-891.531) [-897.377] (-892.630) (-896.931) * (-888.912) [-891.421] (-895.616) (-888.010) -- 0:02:07
66500 -- [-891.040] (-889.370) (-901.030) (-890.861) * (-891.756) (-892.434) (-894.956) [-889.689] -- 0:02:06
67000 -- [-887.762] (-891.197) (-891.775) (-894.224) * (-890.992) (-890.078) (-889.645) [-891.793] -- 0:02:05
67500 -- (-891.374) [-892.416] (-892.204) (-892.493) * (-891.498) (-897.160) [-893.730] (-897.356) -- 0:02:18
68000 -- (-891.149) (-892.572) [-889.672] (-898.473) * (-892.580) [-889.333] (-892.101) (-892.548) -- 0:02:17
68500 -- [-890.270] (-893.915) (-892.583) (-891.470) * (-890.020) (-889.609) (-891.619) [-894.567] -- 0:02:15
69000 -- (-891.098) (-895.007) [-898.345] (-892.929) * [-892.025] (-889.766) (-891.195) (-895.737) -- 0:02:14
69500 -- (-890.583) (-896.610) (-891.511) [-891.686] * (-892.242) (-894.315) [-890.090] (-898.604) -- 0:02:13
70000 -- (-892.842) [-891.256] (-893.192) (-905.774) * (-904.731) (-891.991) (-887.651) [-895.633] -- 0:02:12
Average standard deviation of split frequencies: 0.033354
70500 -- (-891.174) (-891.600) [-891.006] (-894.931) * (-897.505) (-892.247) (-887.871) [-893.438] -- 0:02:11
71000 -- (-892.206) (-893.844) (-890.833) [-887.488] * (-898.324) [-896.128] (-893.358) (-896.641) -- 0:02:10
71500 -- (-892.165) (-894.422) [-888.752] (-895.142) * (-899.044) [-892.906] (-891.497) (-891.470) -- 0:02:09
72000 -- [-890.628] (-892.988) (-892.703) (-893.308) * (-896.128) (-891.579) [-893.949] (-890.345) -- 0:02:08
72500 -- (-897.186) [-888.505] (-893.260) (-896.088) * (-890.307) (-893.806) (-889.261) [-891.606] -- 0:02:07
73000 -- [-892.548] (-891.029) (-898.456) (-895.873) * [-898.361] (-889.679) (-890.527) (-888.067) -- 0:02:06
73500 -- [-893.192] (-894.096) (-892.051) (-893.832) * (-891.937) [-889.909] (-889.471) (-893.534) -- 0:02:06
74000 -- (-891.398) [-893.293] (-891.409) (-895.784) * (-892.734) (-887.840) [-892.967] (-891.692) -- 0:02:05
74500 -- (-891.759) (-889.433) [-890.385] (-897.900) * (-890.931) (-887.179) [-888.498] (-895.255) -- 0:02:16
75000 -- (-894.374) (-888.294) [-894.937] (-894.107) * (-889.623) (-890.138) [-887.928] (-891.399) -- 0:02:15
Average standard deviation of split frequencies: 0.037216
75500 -- (-896.254) [-893.766] (-895.395) (-895.450) * (-891.511) (-890.323) [-891.048] (-892.235) -- 0:02:14
76000 -- (-899.443) [-890.969] (-895.105) (-894.352) * (-893.534) [-889.577] (-889.478) (-895.558) -- 0:02:13
76500 -- [-894.386] (-888.456) (-894.850) (-889.695) * [-889.330] (-893.298) (-890.734) (-891.504) -- 0:02:12
77000 -- [-891.827] (-889.123) (-893.834) (-890.195) * [-893.135] (-895.482) (-890.183) (-889.685) -- 0:02:11
77500 -- [-890.732] (-892.461) (-891.726) (-891.789) * (-892.258) (-897.189) (-891.641) [-892.818] -- 0:02:10
78000 -- (-890.415) [-892.140] (-895.755) (-891.469) * [-891.139] (-893.921) (-895.132) (-893.230) -- 0:02:10
78500 -- (-897.024) (-890.415) (-892.944) [-888.706] * [-891.815] (-892.524) (-896.310) (-898.406) -- 0:02:09
79000 -- (-890.908) (-889.358) (-896.170) [-889.427] * (-887.348) (-896.555) [-890.069] (-893.471) -- 0:02:08
79500 -- (-891.592) [-891.414] (-895.343) (-891.689) * (-890.478) (-892.515) [-893.718] (-890.856) -- 0:02:07
80000 -- (-891.129) (-892.449) (-892.857) [-890.421] * [-890.125] (-895.790) (-896.466) (-896.765) -- 0:02:06
Average standard deviation of split frequencies: 0.040907
80500 -- (-893.268) (-894.308) (-893.974) [-887.581] * (-889.189) [-894.180] (-889.771) (-891.436) -- 0:02:05
81000 -- (-894.550) (-896.778) [-891.691] (-890.253) * (-892.867) (-897.144) (-892.615) [-889.069] -- 0:02:04
81500 -- (-893.158) (-891.457) (-890.983) [-897.114] * [-889.201] (-890.059) (-887.661) (-890.245) -- 0:02:15
82000 -- (-891.483) [-894.023] (-889.619) (-892.303) * [-891.364] (-893.542) (-890.891) (-893.279) -- 0:02:14
82500 -- [-889.234] (-889.782) (-892.160) (-888.648) * [-892.451] (-891.213) (-894.603) (-894.879) -- 0:02:13
83000 -- (-891.619) (-893.507) (-893.007) [-887.735] * (-891.521) [-892.575] (-895.867) (-892.833) -- 0:02:12
83500 -- [-891.884] (-891.520) (-892.133) (-891.466) * [-890.782] (-889.980) (-892.733) (-894.292) -- 0:02:11
84000 -- (-893.100) (-887.569) (-894.957) [-890.310] * (-890.080) (-892.837) [-894.958] (-891.148) -- 0:02:10
84500 -- (-891.797) (-890.343) (-888.782) [-890.626] * (-897.777) [-888.766] (-893.362) (-893.062) -- 0:02:10
85000 -- [-890.348] (-891.810) (-888.030) (-892.742) * [-890.137] (-889.163) (-887.903) (-891.013) -- 0:02:09
Average standard deviation of split frequencies: 0.032889
85500 -- (-892.383) [-887.755] (-894.918) (-893.487) * (-891.329) [-888.703] (-893.088) (-892.094) -- 0:02:08
86000 -- (-891.896) [-892.568] (-893.195) (-894.746) * (-891.282) (-889.819) [-890.684] (-902.139) -- 0:02:07
86500 -- (-889.720) (-892.570) [-898.422] (-893.635) * (-889.141) [-888.505] (-896.196) (-891.388) -- 0:02:06
87000 -- [-889.718] (-891.913) (-894.901) (-896.544) * [-888.661] (-891.355) (-892.437) (-896.338) -- 0:02:05
87500 -- [-891.049] (-892.586) (-894.456) (-890.229) * [-892.334] (-890.112) (-892.174) (-888.306) -- 0:02:05
88000 -- (-887.359) (-894.653) (-896.290) [-893.466] * (-892.544) [-892.096] (-891.878) (-892.832) -- 0:02:04
88500 -- [-891.360] (-892.590) (-893.966) (-892.488) * (-890.778) (-894.052) [-891.734] (-897.853) -- 0:02:03
89000 -- (-891.757) (-890.145) (-898.007) [-889.343] * (-893.051) (-893.736) (-889.287) [-895.958] -- 0:02:13
89500 -- (-893.557) (-887.215) (-892.637) [-893.491] * (-888.639) [-887.844] (-894.652) (-900.424) -- 0:02:12
90000 -- [-896.849] (-894.070) (-897.579) (-891.870) * [-889.413] (-892.249) (-892.800) (-890.902) -- 0:02:11
Average standard deviation of split frequencies: 0.025997
90500 -- (-893.267) [-888.738] (-903.168) (-892.191) * (-894.251) (-889.131) (-895.744) [-893.804] -- 0:02:10
91000 -- (-892.054) [-889.405] (-894.201) (-892.512) * (-891.797) (-890.435) (-898.161) [-892.883] -- 0:02:09
91500 -- [-898.049] (-893.172) (-900.124) (-896.155) * (-888.999) (-896.389) (-893.622) [-896.293] -- 0:02:09
92000 -- [-894.447] (-889.985) (-895.917) (-892.288) * (-895.506) [-887.712] (-891.337) (-895.913) -- 0:02:08
92500 -- (-896.487) (-892.505) [-891.011] (-892.411) * (-888.492) (-892.470) [-895.898] (-896.173) -- 0:02:07
93000 -- (-890.064) (-892.429) (-892.869) [-895.745] * (-892.411) (-894.392) (-891.866) [-892.472] -- 0:02:06
93500 -- (-891.860) [-887.802] (-891.842) (-895.842) * (-893.379) (-898.814) (-890.611) [-888.923] -- 0:02:06
94000 -- [-893.775] (-888.654) (-890.571) (-893.122) * [-889.469] (-890.373) (-894.548) (-889.383) -- 0:02:05
94500 -- (-891.163) (-891.905) (-890.898) [-895.585] * (-891.842) [-888.633] (-895.473) (-890.994) -- 0:02:04
95000 -- (-887.050) (-891.490) [-895.775] (-892.443) * (-895.252) (-888.509) [-888.473] (-890.537) -- 0:02:03
Average standard deviation of split frequencies: 0.034373
95500 -- (-891.338) [-890.629] (-889.905) (-889.561) * (-889.733) [-890.251] (-889.786) (-896.888) -- 0:02:03
96000 -- (-893.870) (-892.425) [-891.318] (-891.491) * (-889.486) (-895.136) [-892.474] (-891.422) -- 0:02:11
96500 -- [-893.500] (-891.308) (-892.193) (-896.189) * [-891.860] (-891.363) (-890.988) (-891.513) -- 0:02:11
97000 -- (-894.501) [-889.247] (-889.608) (-892.786) * (-893.633) [-894.928] (-894.945) (-901.075) -- 0:02:10
97500 -- (-889.846) (-891.362) [-891.198] (-891.824) * (-892.467) (-889.424) [-892.906] (-894.326) -- 0:02:09
98000 -- (-896.247) [-892.953] (-895.330) (-891.915) * (-893.422) (-889.923) (-892.189) [-888.318] -- 0:02:08
98500 -- (-891.259) (-891.194) (-894.099) [-893.289] * (-890.156) (-890.935) [-888.533] (-890.788) -- 0:02:08
99000 -- (-888.280) [-887.974] (-897.850) (-896.326) * (-888.946) (-894.183) (-891.204) [-888.272] -- 0:02:07
99500 -- (-896.806) (-892.401) [-896.384] (-900.865) * (-895.001) (-890.191) (-895.001) [-893.050] -- 0:02:06
100000 -- (-892.754) [-888.108] (-895.677) (-891.952) * (-890.470) [-889.590] (-888.886) (-889.022) -- 0:02:05
Average standard deviation of split frequencies: 0.032780
100500 -- (-890.657) [-891.479] (-894.556) (-898.863) * (-889.342) [-890.301] (-893.083) (-890.732) -- 0:02:05
101000 -- (-894.976) [-894.136] (-891.182) (-898.751) * (-894.194) [-891.240] (-893.675) (-891.184) -- 0:02:04
101500 -- (-890.807) [-896.007] (-888.526) (-895.625) * (-898.213) (-889.094) (-891.030) [-891.565] -- 0:02:03
102000 -- (-894.257) [-892.799] (-891.023) (-890.393) * (-898.658) [-891.703] (-889.372) (-891.915) -- 0:02:03
102500 -- [-889.784] (-890.028) (-888.258) (-888.808) * (-887.861) (-895.615) [-889.382] (-892.600) -- 0:02:02
103000 -- (-890.165) [-890.260] (-895.164) (-888.486) * (-901.761) (-894.676) [-891.175] (-893.475) -- 0:02:10
103500 -- [-888.559] (-888.832) (-890.608) (-888.526) * [-893.834] (-891.718) (-893.668) (-893.637) -- 0:02:09
104000 -- (-891.709) (-891.793) (-890.310) [-890.628] * (-888.756) (-890.798) (-898.263) [-888.220] -- 0:02:09
104500 -- (-890.623) [-887.903] (-894.139) (-892.866) * (-893.487) (-892.401) (-891.913) [-892.843] -- 0:02:08
105000 -- (-890.666) [-891.528] (-895.168) (-892.866) * [-889.878] (-894.599) (-890.609) (-893.883) -- 0:02:07
Average standard deviation of split frequencies: 0.031130
105500 -- (-888.768) [-890.080] (-901.461) (-888.324) * (-889.879) (-892.548) [-894.650] (-895.394) -- 0:02:07
106000 -- (-895.968) [-888.359] (-903.750) (-895.034) * (-892.118) (-890.503) (-896.453) [-890.638] -- 0:02:06
106500 -- (-893.046) (-890.654) (-891.174) [-894.567] * [-890.623] (-892.215) (-898.213) (-894.242) -- 0:02:05
107000 -- [-889.247] (-890.100) (-894.124) (-890.900) * [-888.432] (-893.105) (-890.452) (-895.041) -- 0:02:05
107500 -- (-890.583) (-888.651) [-891.389] (-894.065) * (-906.601) (-889.441) (-890.768) [-894.431] -- 0:02:04
108000 -- (-891.773) [-893.355] (-893.184) (-890.204) * (-894.682) (-895.523) (-894.437) [-889.955] -- 0:02:03
108500 -- (-890.720) [-892.300] (-896.955) (-893.720) * (-896.829) (-893.664) [-892.226] (-893.916) -- 0:02:03
109000 -- (-892.702) (-894.635) [-890.256] (-892.169) * [-893.362] (-887.624) (-891.102) (-892.273) -- 0:02:02
109500 -- (-891.460) [-891.831] (-895.879) (-893.127) * [-892.521] (-888.700) (-894.019) (-896.420) -- 0:02:01
110000 -- (-891.799) (-891.047) [-895.163] (-903.159) * [-896.051] (-891.122) (-891.587) (-896.948) -- 0:02:09
Average standard deviation of split frequencies: 0.029818
110500 -- (-894.347) [-892.920] (-894.215) (-899.341) * (-896.890) (-893.083) (-889.768) [-891.192] -- 0:02:08
111000 -- (-891.287) (-891.524) (-897.492) [-890.944] * (-895.425) [-889.357] (-899.449) (-886.726) -- 0:02:08
111500 -- [-889.846] (-890.419) (-892.249) (-891.435) * (-891.772) [-889.387] (-896.745) (-891.596) -- 0:02:07
112000 -- [-896.472] (-889.389) (-890.365) (-894.166) * (-890.312) [-889.807] (-898.890) (-890.773) -- 0:02:06
112500 -- (-903.425) [-891.940] (-894.332) (-892.699) * [-889.131] (-890.705) (-892.783) (-894.515) -- 0:02:06
113000 -- [-893.462] (-892.560) (-896.313) (-891.936) * (-897.092) (-889.027) (-894.123) [-889.114] -- 0:02:05
113500 -- [-888.204] (-891.929) (-894.636) (-890.886) * (-890.809) (-895.722) (-889.976) [-889.358] -- 0:02:04
114000 -- (-889.247) [-890.024] (-891.893) (-889.813) * [-893.762] (-894.663) (-888.246) (-888.825) -- 0:02:04
114500 -- (-893.865) (-891.347) (-896.892) [-894.724] * (-897.965) (-894.640) [-887.220] (-892.250) -- 0:02:03
115000 -- (-891.752) [-889.167] (-893.045) (-892.988) * [-893.992] (-893.572) (-889.177) (-892.611) -- 0:02:03
Average standard deviation of split frequencies: 0.024383
115500 -- (-897.851) [-890.090] (-895.993) (-888.799) * (-888.966) (-896.051) (-892.208) [-889.927] -- 0:02:02
116000 -- (-890.859) (-892.060) [-893.724] (-891.844) * [-891.996] (-888.413) (-890.144) (-888.660) -- 0:02:01
116500 -- (-889.330) (-893.374) [-893.742] (-893.874) * [-889.619] (-891.607) (-890.408) (-891.949) -- 0:02:01
117000 -- (-892.822) (-892.341) (-894.991) [-895.042] * [-891.694] (-898.095) (-895.126) (-892.947) -- 0:02:08
117500 -- (-892.755) (-890.010) [-892.896] (-901.899) * (-893.797) [-892.510] (-895.647) (-893.239) -- 0:02:07
118000 -- (-894.146) [-891.486] (-892.150) (-891.769) * [-892.117] (-893.587) (-893.449) (-895.492) -- 0:02:07
118500 -- (-896.683) [-889.542] (-890.831) (-892.837) * [-892.207] (-892.010) (-891.362) (-895.246) -- 0:02:06
119000 -- (-894.114) [-893.635] (-890.217) (-895.110) * (-894.367) (-890.000) (-888.740) [-894.493] -- 0:02:05
119500 -- (-890.742) (-889.568) [-895.025] (-894.175) * (-891.042) [-895.010] (-889.435) (-895.456) -- 0:02:05
120000 -- (-893.459) [-888.812] (-896.942) (-898.559) * (-891.233) (-894.110) (-889.105) [-893.761] -- 0:02:04
Average standard deviation of split frequencies: 0.023440
120500 -- [-894.676] (-890.779) (-894.053) (-890.591) * (-891.545) (-890.176) [-887.992] (-893.327) -- 0:02:04
121000 -- (-892.518) (-890.909) [-890.445] (-886.533) * (-893.705) [-887.317] (-895.859) (-894.096) -- 0:02:03
121500 -- (-891.033) (-895.226) (-893.138) [-888.556] * (-895.186) (-891.280) [-888.982] (-887.595) -- 0:02:02
122000 -- (-892.083) [-890.160] (-890.216) (-892.528) * (-889.345) [-892.893] (-893.788) (-891.267) -- 0:02:02
122500 -- (-897.591) [-888.954] (-890.805) (-892.533) * [-889.622] (-896.640) (-892.403) (-891.874) -- 0:02:01
123000 -- (-895.934) (-887.626) (-888.432) [-890.152] * [-889.769] (-898.768) (-894.472) (-895.347) -- 0:02:01
123500 -- [-890.894] (-889.119) (-890.328) (-897.225) * [-890.291] (-896.279) (-892.659) (-890.320) -- 0:02:00
124000 -- (-892.330) (-890.394) [-890.689] (-890.438) * [-892.337] (-889.810) (-898.904) (-892.794) -- 0:02:07
124500 -- (-894.228) (-892.906) [-890.026] (-890.765) * (-892.372) (-896.840) (-893.628) [-895.014] -- 0:02:06
125000 -- [-892.599] (-892.957) (-895.968) (-890.345) * [-897.744] (-893.051) (-893.936) (-891.075) -- 0:02:06
Average standard deviation of split frequencies: 0.026189
125500 -- [-892.566] (-887.000) (-897.664) (-891.565) * (-889.952) (-896.407) [-890.940] (-891.966) -- 0:02:05
126000 -- (-894.786) (-891.907) [-894.605] (-895.285) * (-889.143) [-893.337] (-897.246) (-893.155) -- 0:02:04
126500 -- (-893.084) [-891.886] (-896.021) (-892.669) * [-890.338] (-892.860) (-900.812) (-890.928) -- 0:02:04
127000 -- (-891.565) (-897.207) [-890.177] (-889.857) * (-892.259) [-889.345] (-895.642) (-890.632) -- 0:02:03
127500 -- (-892.784) (-896.101) [-889.990] (-894.999) * (-890.293) (-893.679) (-894.689) [-892.292] -- 0:02:03
128000 -- [-892.109] (-896.367) (-896.740) (-893.340) * [-890.359] (-892.118) (-897.202) (-894.651) -- 0:02:02
128500 -- (-890.622) [-892.322] (-888.679) (-889.594) * (-894.626) [-893.141] (-895.031) (-888.797) -- 0:02:02
129000 -- (-892.546) [-888.395] (-892.851) (-893.669) * (-891.283) [-888.167] (-889.690) (-890.355) -- 0:02:01
129500 -- [-890.219] (-890.777) (-892.728) (-889.851) * (-892.281) (-892.481) [-892.578] (-893.305) -- 0:02:00
130000 -- (-890.401) (-891.199) [-892.122] (-896.759) * [-890.698] (-890.245) (-888.348) (-890.010) -- 0:02:00
Average standard deviation of split frequencies: 0.025254
130500 -- [-890.994] (-889.710) (-894.257) (-893.964) * (-892.789) (-892.172) [-889.962] (-892.821) -- 0:01:59
131000 -- (-888.064) [-891.311] (-892.377) (-899.629) * (-896.133) (-891.641) [-895.196] (-891.763) -- 0:02:06
131500 -- (-891.330) (-890.358) [-893.221] (-894.782) * (-894.439) (-891.879) (-890.630) [-890.531] -- 0:02:05
132000 -- [-892.438] (-886.705) (-893.560) (-892.542) * (-895.171) (-897.835) [-892.998] (-887.653) -- 0:02:04
132500 -- (-895.873) (-890.468) [-888.775] (-894.817) * [-895.875] (-888.776) (-899.165) (-890.824) -- 0:02:04
133000 -- (-891.070) [-888.181] (-895.296) (-897.308) * (-894.116) (-892.748) [-892.331] (-892.792) -- 0:02:03
133500 -- [-890.929] (-887.609) (-893.371) (-890.773) * (-895.578) [-901.038] (-898.408) (-892.289) -- 0:02:03
134000 -- [-890.114] (-891.515) (-893.193) (-887.804) * (-896.963) [-890.150] (-898.964) (-892.691) -- 0:02:02
134500 -- (-888.096) (-888.990) (-892.976) [-888.714] * (-890.726) (-894.136) (-897.249) [-891.675] -- 0:02:02
135000 -- (-890.001) (-890.425) (-890.502) [-891.055] * (-891.595) [-890.494] (-894.691) (-890.059) -- 0:02:01
Average standard deviation of split frequencies: 0.020797
135500 -- (-893.999) [-887.983] (-892.340) (-888.335) * (-893.964) [-893.724] (-899.756) (-890.169) -- 0:02:01
136000 -- (-889.583) (-892.626) [-889.979] (-898.428) * (-893.102) [-889.461] (-897.356) (-888.249) -- 0:02:00
136500 -- [-891.724] (-887.594) (-895.675) (-893.083) * (-889.232) (-892.041) (-895.003) [-892.752] -- 0:02:00
137000 -- (-888.210) [-889.381] (-893.894) (-896.552) * (-888.922) (-892.139) (-902.416) [-892.830] -- 0:01:59
137500 -- (-893.690) (-891.522) [-894.473] (-890.566) * (-893.364) (-893.862) (-898.711) [-890.607] -- 0:01:59
138000 -- (-901.031) (-891.519) [-889.642] (-888.873) * (-891.241) (-895.615) (-896.041) [-894.884] -- 0:02:04
138500 -- (-894.478) [-893.349] (-889.529) (-892.568) * [-897.187] (-893.269) (-894.094) (-892.718) -- 0:02:04
139000 -- (-893.235) (-893.207) [-891.536] (-892.337) * [-892.896] (-888.070) (-897.147) (-893.249) -- 0:02:03
139500 -- (-892.282) [-894.538] (-890.542) (-890.543) * (-890.366) [-889.259] (-900.162) (-892.725) -- 0:02:03
140000 -- (-889.562) (-891.236) [-889.643] (-891.964) * [-890.918] (-890.004) (-900.228) (-892.318) -- 0:02:02
Average standard deviation of split frequencies: 0.020107
140500 -- [-888.514] (-898.224) (-891.429) (-893.147) * (-894.993) [-895.037] (-903.772) (-897.571) -- 0:02:02
141000 -- [-891.942] (-894.379) (-892.197) (-888.645) * [-892.779] (-892.017) (-893.175) (-889.885) -- 0:02:01
141500 -- (-890.821) (-892.041) (-897.095) [-895.847] * [-894.756] (-891.404) (-894.693) (-891.452) -- 0:02:01
142000 -- (-890.536) (-894.516) [-892.828] (-889.920) * [-888.516] (-892.532) (-903.245) (-892.622) -- 0:02:00
142500 -- (-895.451) [-894.427] (-895.466) (-889.476) * (-892.857) (-893.119) (-900.891) [-889.203] -- 0:02:00
143000 -- (-896.710) [-892.495] (-893.696) (-894.856) * (-890.913) (-890.570) (-893.441) [-889.686] -- 0:01:59
143500 -- (-897.289) [-893.050] (-890.550) (-887.528) * [-894.147] (-891.933) (-893.965) (-890.665) -- 0:01:59
144000 -- (-908.747) (-896.174) (-886.713) [-890.376] * [-890.815] (-892.790) (-896.018) (-893.523) -- 0:01:58
144500 -- (-897.848) (-892.833) [-891.295] (-894.903) * (-893.110) (-891.755) [-893.567] (-893.124) -- 0:01:58
145000 -- (-892.408) (-895.331) (-892.180) [-888.739] * (-889.338) (-899.513) (-891.900) [-895.334] -- 0:02:03
Average standard deviation of split frequencies: 0.025830
145500 -- (-890.269) (-888.473) (-889.629) [-888.532] * (-890.402) (-891.804) (-896.998) [-892.255] -- 0:02:03
146000 -- (-894.293) (-891.430) (-889.746) [-892.522] * (-893.032) (-895.977) (-894.745) [-892.534] -- 0:02:02
146500 -- (-896.124) [-891.875] (-894.207) (-891.469) * [-889.392] (-892.942) (-892.165) (-892.706) -- 0:02:02
147000 -- (-898.275) (-889.496) (-889.034) [-890.435] * (-890.405) (-890.404) [-890.337] (-891.265) -- 0:02:01
147500 -- (-889.043) [-891.892] (-891.285) (-895.165) * (-889.093) (-894.764) [-886.817] (-891.536) -- 0:02:01
148000 -- (-892.760) (-891.623) [-887.566] (-891.092) * (-892.651) (-895.005) [-892.890] (-895.782) -- 0:02:00
148500 -- [-899.330] (-893.677) (-894.714) (-895.457) * [-892.483] (-897.303) (-893.186) (-889.800) -- 0:02:00
149000 -- (-890.903) [-889.821] (-895.776) (-892.705) * (-891.992) (-895.804) [-891.120] (-892.370) -- 0:01:59
149500 -- (-895.328) (-891.961) [-892.380] (-894.183) * (-892.642) [-897.604] (-889.450) (-890.484) -- 0:01:59
150000 -- (-893.854) (-896.855) [-890.098] (-892.376) * (-890.535) [-896.974] (-893.068) (-894.113) -- 0:01:58
Average standard deviation of split frequencies: 0.028159
150500 -- (-895.284) (-892.986) (-891.215) [-894.510] * (-891.817) (-900.524) (-895.738) [-891.179] -- 0:01:58
151000 -- (-894.872) (-895.048) [-890.205] (-889.232) * (-888.618) (-893.202) (-893.702) [-893.330] -- 0:01:58
151500 -- (-892.261) (-892.468) (-891.184) [-895.969] * (-891.206) (-893.873) (-894.234) [-889.754] -- 0:01:57
152000 -- (-889.449) (-892.221) (-888.916) [-895.363] * (-895.398) [-891.840] (-896.308) (-892.948) -- 0:01:57
152500 -- [-891.355] (-889.702) (-889.542) (-890.365) * (-893.470) (-894.642) (-895.810) [-892.215] -- 0:02:02
153000 -- (-892.758) (-893.778) [-889.582] (-891.410) * (-892.187) (-892.571) (-892.152) [-888.676] -- 0:02:01
153500 -- (-896.276) (-890.164) (-887.636) [-889.055] * (-890.910) (-896.103) [-891.281] (-892.948) -- 0:02:01
154000 -- (-891.991) (-902.641) (-889.567) [-891.009] * (-894.642) (-891.951) (-895.017) [-893.594] -- 0:02:00
154500 -- [-892.837] (-896.002) (-891.579) (-896.016) * (-896.914) [-892.706] (-895.876) (-895.226) -- 0:02:00
155000 -- (-893.400) (-895.781) (-893.600) [-896.237] * (-892.627) (-891.037) [-892.314] (-890.446) -- 0:01:59
Average standard deviation of split frequencies: 0.024175
155500 -- (-889.101) [-893.545] (-892.154) (-898.088) * [-892.450] (-887.915) (-893.570) (-891.984) -- 0:01:59
156000 -- (-890.691) (-888.664) (-894.189) [-888.880] * (-888.937) (-893.972) [-893.109] (-889.339) -- 0:01:59
156500 -- [-893.550] (-893.395) (-890.917) (-894.949) * (-888.585) [-890.454] (-891.897) (-892.557) -- 0:01:58
157000 -- (-891.345) (-895.154) (-889.738) [-891.697] * (-891.063) [-889.678] (-893.220) (-893.375) -- 0:01:58
157500 -- (-892.200) (-893.167) (-888.698) [-888.587] * (-896.022) (-889.627) (-890.123) [-891.228] -- 0:01:57
158000 -- [-891.362] (-891.815) (-889.399) (-895.116) * (-897.570) (-888.420) (-895.456) [-891.708] -- 0:01:57
158500 -- [-891.778] (-890.305) (-892.291) (-893.342) * (-906.554) [-891.537] (-892.240) (-893.313) -- 0:01:56
159000 -- (-893.179) (-889.593) [-891.471] (-890.976) * (-898.278) (-892.427) [-890.820] (-893.353) -- 0:01:56
159500 -- [-890.032] (-892.224) (-891.832) (-892.379) * [-889.492] (-891.474) (-891.425) (-890.307) -- 0:02:01
160000 -- [-896.571] (-893.716) (-892.812) (-891.457) * (-894.284) (-890.998) [-891.209] (-897.722) -- 0:02:00
Average standard deviation of split frequencies: 0.020538
160500 -- (-891.798) (-894.235) (-889.524) [-889.439] * (-891.661) (-893.189) (-889.718) [-894.026] -- 0:02:00
161000 -- (-888.562) [-892.212] (-888.531) (-890.215) * (-890.696) (-892.029) (-890.089) [-897.411] -- 0:01:59
161500 -- (-896.069) (-890.429) [-892.377] (-889.913) * (-888.398) (-892.716) (-889.551) [-890.417] -- 0:01:59
162000 -- (-902.683) (-891.558) [-889.188] (-892.378) * (-891.023) [-893.941] (-899.119) (-891.593) -- 0:01:58
162500 -- (-899.011) (-900.862) [-890.562] (-896.116) * (-890.682) [-897.017] (-890.548) (-890.065) -- 0:01:58
163000 -- [-896.506] (-892.740) (-889.475) (-891.156) * (-897.440) [-893.876] (-886.639) (-894.219) -- 0:01:58
163500 -- (-894.337) (-888.453) [-896.551] (-888.872) * (-893.430) (-891.331) (-890.901) [-890.595] -- 0:01:57
164000 -- (-891.546) (-889.412) (-894.482) [-889.192] * (-892.624) (-899.629) (-889.872) [-891.114] -- 0:01:57
164500 -- (-890.937) (-892.126) [-889.920] (-891.877) * (-892.714) (-894.753) [-888.900] (-891.859) -- 0:01:56
165000 -- (-895.306) [-890.168] (-890.459) (-890.048) * (-893.359) [-890.466] (-898.318) (-889.354) -- 0:01:56
Average standard deviation of split frequencies: 0.019879
165500 -- (-898.349) (-891.607) (-889.957) [-889.088] * (-891.220) (-892.595) (-894.088) [-889.790] -- 0:01:55
166000 -- (-894.938) [-891.564] (-892.095) (-890.999) * (-891.594) [-888.742] (-895.568) (-893.708) -- 0:01:55
166500 -- (-894.576) [-888.795] (-888.140) (-894.911) * (-892.994) [-891.144] (-890.174) (-893.553) -- 0:02:00
167000 -- (-896.924) (-889.118) [-892.440] (-894.493) * (-894.079) (-896.084) (-890.338) [-888.121] -- 0:01:59
167500 -- (-895.763) [-892.820] (-889.351) (-892.473) * (-893.729) [-892.199] (-892.366) (-896.445) -- 0:01:59
168000 -- (-896.411) (-895.654) [-894.176] (-888.910) * (-888.593) (-889.127) [-887.690] (-893.202) -- 0:01:58
168500 -- (-892.965) (-892.108) [-894.630] (-894.006) * (-893.264) [-893.510] (-891.727) (-894.855) -- 0:01:58
169000 -- [-893.399] (-890.004) (-890.179) (-896.149) * (-893.584) (-888.682) (-888.908) [-894.157] -- 0:01:58
169500 -- (-891.543) (-894.735) [-892.430] (-889.578) * (-892.336) [-893.935] (-891.400) (-892.072) -- 0:01:57
170000 -- (-890.805) [-894.396] (-891.772) (-890.614) * [-890.915] (-896.370) (-890.777) (-889.817) -- 0:01:57
Average standard deviation of split frequencies: 0.016573
170500 -- (-894.795) (-894.258) [-895.970] (-894.343) * (-891.955) (-897.694) [-895.239] (-891.967) -- 0:01:56
171000 -- [-892.115] (-889.638) (-890.116) (-889.096) * (-889.324) (-891.880) (-891.760) [-890.758] -- 0:01:56
171500 -- [-892.243] (-895.579) (-890.399) (-889.317) * (-889.331) (-892.654) [-888.377] (-893.931) -- 0:01:55
172000 -- (-892.412) [-893.412] (-891.735) (-890.541) * (-890.183) [-891.445] (-890.101) (-890.017) -- 0:01:55
172500 -- (-895.421) (-896.658) (-895.476) [-889.148] * (-892.034) (-891.839) [-890.727] (-894.285) -- 0:01:55
173000 -- (-898.533) (-891.665) (-891.729) [-891.275] * [-893.504] (-892.254) (-888.265) (-892.113) -- 0:01:54
173500 -- [-891.434] (-894.906) (-896.509) (-892.172) * (-891.656) (-891.890) (-889.975) [-892.000] -- 0:01:59
174000 -- (-893.400) (-899.010) (-891.898) [-893.102] * [-888.109] (-889.678) (-889.721) (-889.237) -- 0:01:58
174500 -- [-894.324] (-895.273) (-894.886) (-898.367) * (-891.992) [-891.498] (-887.944) (-887.370) -- 0:01:58
175000 -- (-891.894) [-896.241] (-896.178) (-898.818) * (-896.061) (-895.687) (-894.700) [-890.447] -- 0:01:57
Average standard deviation of split frequencies: 0.018749
175500 -- (-890.592) [-893.956] (-890.257) (-892.210) * (-890.723) (-898.017) (-889.054) [-890.644] -- 0:01:57
176000 -- [-891.907] (-892.589) (-890.653) (-891.607) * [-888.840] (-894.491) (-888.929) (-890.127) -- 0:01:57
176500 -- (-889.143) [-897.266] (-898.043) (-893.104) * (-894.772) (-897.244) [-889.593] (-889.622) -- 0:01:56
177000 -- (-890.287) (-894.444) (-894.773) [-897.431] * (-889.897) (-899.314) [-890.713] (-892.826) -- 0:01:56
177500 -- (-892.027) (-894.414) (-892.890) [-892.509] * (-889.863) (-895.180) [-893.256] (-894.471) -- 0:01:55
178000 -- [-889.827] (-892.549) (-894.470) (-891.636) * (-889.037) (-890.405) (-891.946) [-890.683] -- 0:01:55
178500 -- (-890.140) (-892.636) (-891.810) [-890.279] * (-895.490) (-889.079) (-890.740) [-891.055] -- 0:01:55
179000 -- (-892.795) (-891.949) (-890.148) [-892.006] * (-893.231) (-893.886) (-896.357) [-897.587] -- 0:01:54
179500 -- (-897.294) (-893.512) (-896.898) [-889.858] * (-895.044) (-892.530) (-897.196) [-901.085] -- 0:01:54
180000 -- (-891.836) (-892.652) [-894.027] (-892.206) * (-892.892) [-896.152] (-897.941) (-887.918) -- 0:01:53
Average standard deviation of split frequencies: 0.015656
180500 -- [-888.389] (-898.390) (-894.925) (-893.494) * (-893.121) (-891.418) (-894.268) [-890.200] -- 0:01:58
181000 -- (-887.757) (-893.631) (-895.246) [-893.592] * (-894.164) [-891.571] (-889.450) (-888.715) -- 0:01:57
181500 -- [-888.280] (-894.369) (-895.528) (-891.090) * (-893.567) [-891.405] (-898.887) (-889.991) -- 0:01:57
182000 -- (-893.381) (-891.179) (-899.642) [-891.910] * [-894.855] (-891.800) (-892.369) (-897.833) -- 0:01:56
182500 -- [-891.129] (-892.824) (-896.110) (-889.803) * (-892.403) (-893.741) (-890.967) [-891.436] -- 0:01:56
183000 -- (-891.451) [-893.604] (-902.476) (-891.338) * (-901.528) (-893.908) [-893.804] (-889.361) -- 0:01:56
183500 -- (-889.742) (-892.625) [-892.904] (-890.793) * (-902.696) [-892.279] (-893.517) (-892.820) -- 0:01:55
184000 -- (-888.994) (-896.914) [-892.087] (-892.932) * (-895.704) (-888.830) (-892.968) [-890.652] -- 0:01:55
184500 -- (-894.679) (-896.059) (-893.184) [-892.016] * (-895.500) (-893.346) [-891.355] (-892.308) -- 0:01:54
185000 -- (-891.256) (-897.962) [-895.162] (-892.382) * [-894.464] (-890.317) (-889.844) (-891.890) -- 0:01:54
Average standard deviation of split frequencies: 0.015207
185500 -- (-887.759) [-891.010] (-889.262) (-891.422) * (-890.489) (-893.400) [-889.344] (-891.264) -- 0:01:54
186000 -- (-887.638) [-895.016] (-900.235) (-893.286) * (-892.352) (-891.174) (-891.729) [-890.595] -- 0:01:53
186500 -- [-890.427] (-891.856) (-895.262) (-896.211) * (-895.395) [-893.506] (-892.431) (-896.235) -- 0:01:53
187000 -- (-889.042) (-893.530) (-901.189) [-890.710] * (-890.188) (-898.802) (-891.466) [-893.835] -- 0:01:53
187500 -- (-894.476) [-890.219] (-893.052) (-894.421) * [-897.502] (-888.531) (-887.738) (-890.275) -- 0:01:57
188000 -- [-894.315] (-898.173) (-896.385) (-895.898) * (-898.216) (-893.213) [-889.122] (-889.561) -- 0:01:56
188500 -- [-890.583] (-896.965) (-890.332) (-894.151) * [-894.888] (-890.158) (-890.499) (-892.148) -- 0:01:56
189000 -- (-889.457) [-890.150] (-890.499) (-897.838) * (-895.561) [-888.971] (-889.382) (-893.403) -- 0:01:55
189500 -- (-890.324) (-888.288) (-892.013) [-898.894] * [-892.859] (-899.440) (-901.051) (-888.037) -- 0:01:55
190000 -- (-889.754) (-893.711) [-889.296] (-891.866) * (-887.937) (-893.929) (-897.111) [-890.509] -- 0:01:55
Average standard deviation of split frequencies: 0.012362
190500 -- (-887.999) (-891.375) [-894.195] (-892.370) * (-890.592) (-895.413) (-893.351) [-886.814] -- 0:01:54
191000 -- (-891.886) (-889.973) [-893.202] (-891.331) * (-900.320) (-892.675) (-894.197) [-890.834] -- 0:01:54
191500 -- (-892.525) (-893.895) (-894.422) [-890.365] * (-894.998) (-890.901) [-891.950] (-889.437) -- 0:01:53
192000 -- (-892.118) [-888.297] (-889.142) (-894.711) * (-892.426) [-888.479] (-890.666) (-893.023) -- 0:01:53
192500 -- [-896.513] (-890.999) (-889.725) (-894.632) * (-891.255) [-886.542] (-891.820) (-900.006) -- 0:01:53
193000 -- (-891.410) (-895.371) [-892.199] (-895.128) * (-894.731) [-889.459] (-891.872) (-897.747) -- 0:01:52
193500 -- (-890.705) (-895.778) [-888.253] (-900.143) * (-893.769) [-888.066] (-894.157) (-895.476) -- 0:01:52
194000 -- (-889.754) (-897.522) [-890.634] (-893.280) * (-894.627) (-889.888) [-891.630] (-893.525) -- 0:01:52
194500 -- [-891.890] (-891.660) (-894.249) (-900.190) * (-891.324) (-888.859) [-891.316] (-896.342) -- 0:01:51
195000 -- (-886.724) (-893.890) (-889.275) [-890.679] * [-894.908] (-890.938) (-891.564) (-894.546) -- 0:01:55
Average standard deviation of split frequencies: 0.014431
195500 -- (-892.781) [-891.209] (-891.910) (-889.793) * [-891.767] (-895.099) (-894.987) (-893.609) -- 0:01:55
196000 -- [-890.863] (-892.225) (-895.581) (-890.443) * (-890.826) (-889.844) [-890.840] (-890.998) -- 0:01:54
196500 -- (-896.974) (-890.490) (-891.252) [-887.620] * (-890.436) (-893.181) [-892.104] (-890.849) -- 0:01:54
197000 -- [-890.576] (-896.717) (-891.532) (-888.868) * (-893.173) [-890.512] (-890.022) (-887.074) -- 0:01:54
197500 -- (-890.393) [-893.850] (-891.394) (-891.995) * (-888.072) [-890.365] (-890.485) (-893.486) -- 0:01:53
198000 -- (-894.049) (-892.146) (-892.990) [-899.719] * [-892.160] (-889.474) (-890.868) (-895.131) -- 0:01:53
198500 -- (-892.318) (-896.121) (-894.672) [-892.282] * (-895.420) (-896.565) (-892.174) [-888.935] -- 0:01:53
199000 -- (-892.279) [-889.195] (-893.783) (-897.264) * (-890.534) (-891.916) [-888.349] (-896.614) -- 0:01:52
199500 -- (-896.625) [-887.587] (-896.817) (-889.993) * [-890.089] (-894.399) (-891.168) (-901.147) -- 0:01:52
200000 -- (-892.627) [-893.540] (-889.453) (-886.867) * (-896.179) (-893.588) (-889.661) [-894.943] -- 0:01:51
Average standard deviation of split frequencies: 0.014095
200500 -- (-894.229) [-891.989] (-895.418) (-892.755) * [-887.451] (-890.003) (-889.842) (-894.237) -- 0:01:51
201000 -- (-901.576) (-891.508) [-894.074] (-896.228) * (-888.507) [-888.433] (-891.950) (-892.790) -- 0:01:51
201500 -- [-890.284] (-894.651) (-895.485) (-894.751) * (-893.657) (-890.348) [-893.776] (-889.681) -- 0:01:50
202000 -- (-888.123) (-895.309) [-890.488] (-890.164) * [-896.099] (-889.003) (-888.585) (-895.577) -- 0:01:54
202500 -- (-889.230) [-891.280] (-896.388) (-891.501) * (-891.819) [-889.848] (-891.677) (-887.008) -- 0:01:54
203000 -- [-889.186] (-896.965) (-894.356) (-890.034) * (-894.254) (-890.466) (-895.190) [-890.500] -- 0:01:53
203500 -- (-893.429) [-892.526] (-891.332) (-892.080) * (-892.876) (-897.344) [-891.623] (-893.898) -- 0:01:53
204000 -- (-893.001) (-894.827) [-890.674] (-891.571) * (-893.571) [-890.495] (-891.946) (-895.398) -- 0:01:53
204500 -- (-895.946) (-894.674) (-889.366) [-890.819] * [-895.224] (-890.035) (-893.104) (-894.674) -- 0:01:52
205000 -- (-894.624) (-897.132) [-890.317] (-894.031) * (-894.626) (-891.976) [-890.231] (-892.751) -- 0:01:52
Average standard deviation of split frequencies: 0.011442
205500 -- [-890.102] (-894.978) (-888.278) (-894.188) * [-890.172] (-893.245) (-889.870) (-895.314) -- 0:01:52
206000 -- [-892.944] (-889.357) (-892.111) (-890.431) * (-887.722) (-897.779) (-891.266) [-894.542] -- 0:01:51
206500 -- (-891.142) [-890.224] (-897.947) (-890.635) * (-891.247) (-894.979) [-898.391] (-894.464) -- 0:01:51
207000 -- (-890.838) [-892.331] (-897.735) (-889.575) * (-897.971) (-899.623) [-892.353] (-898.787) -- 0:01:51
207500 -- (-894.313) [-888.814] (-893.104) (-889.824) * [-893.574] (-897.085) (-893.582) (-891.150) -- 0:01:50
208000 -- [-893.757] (-892.406) (-892.070) (-890.028) * [-890.072] (-894.547) (-892.799) (-893.443) -- 0:01:50
208500 -- (-895.419) (-893.674) [-892.213] (-891.210) * [-889.443] (-894.303) (-890.525) (-889.504) -- 0:01:50
209000 -- [-900.274] (-892.092) (-895.869) (-893.877) * (-895.082) (-889.911) [-891.959] (-899.183) -- 0:01:53
209500 -- [-896.578] (-889.227) (-894.162) (-895.617) * [-891.964] (-890.029) (-894.101) (-893.095) -- 0:01:53
210000 -- (-893.546) (-886.992) [-891.824] (-894.517) * (-893.650) (-892.096) (-890.366) [-894.234] -- 0:01:52
Average standard deviation of split frequencies: 0.008951
210500 -- (-897.419) (-894.934) (-894.687) [-890.135] * [-888.859] (-895.509) (-897.305) (-889.909) -- 0:01:52
211000 -- [-893.162] (-890.963) (-891.287) (-891.788) * [-891.145] (-891.328) (-897.268) (-894.328) -- 0:01:52
211500 -- (-889.714) [-891.411] (-891.010) (-894.444) * (-888.726) [-888.746] (-901.629) (-896.363) -- 0:01:51
212000 -- [-894.008] (-899.496) (-898.915) (-888.885) * (-890.870) (-891.299) [-893.937] (-891.750) -- 0:01:51
212500 -- [-890.978] (-894.047) (-892.639) (-888.711) * (-892.691) [-891.262] (-896.588) (-893.931) -- 0:01:51
213000 -- (-893.670) (-895.187) [-889.075] (-888.453) * [-889.226] (-890.352) (-893.066) (-894.652) -- 0:01:50
213500 -- [-891.665] (-891.395) (-887.524) (-890.889) * [-891.807] (-888.089) (-898.210) (-893.377) -- 0:01:50
214000 -- (-890.271) (-893.935) [-887.165] (-889.883) * (-894.974) (-892.058) (-897.135) [-892.406] -- 0:01:50
214500 -- [-891.443] (-896.826) (-894.139) (-897.217) * [-890.225] (-890.448) (-894.531) (-889.068) -- 0:01:49
215000 -- (-896.120) (-893.159) [-894.145] (-897.760) * (-889.999) (-891.730) (-898.487) [-889.706] -- 0:01:49
Average standard deviation of split frequencies: 0.008730
215500 -- (-894.953) (-897.774) (-888.762) [-893.954] * [-889.644] (-893.833) (-900.752) (-894.529) -- 0:01:49
216000 -- [-890.895] (-893.782) (-893.342) (-890.574) * [-889.622] (-889.074) (-895.208) (-895.162) -- 0:01:52
216500 -- (-895.798) (-890.538) [-890.005] (-891.427) * (-893.330) (-895.406) (-899.613) [-891.054] -- 0:01:52
217000 -- (-892.248) [-890.950] (-890.207) (-890.737) * (-888.453) [-889.317] (-897.744) (-894.597) -- 0:01:51
217500 -- (-894.588) (-890.356) (-894.739) [-890.097] * (-890.286) (-890.846) (-890.618) [-889.939] -- 0:01:51
218000 -- (-898.622) (-894.865) [-890.425] (-889.160) * (-889.252) [-894.976] (-891.671) (-891.808) -- 0:01:51
218500 -- (-891.272) (-889.755) [-890.679] (-890.214) * (-894.654) [-890.773] (-898.866) (-891.292) -- 0:01:50
219000 -- (-892.939) [-891.167] (-890.751) (-889.906) * (-890.321) (-892.739) [-896.370] (-896.176) -- 0:01:50
219500 -- (-895.057) (-890.702) (-889.891) [-891.810] * (-889.873) (-890.372) (-893.086) [-891.593] -- 0:01:50
220000 -- (-891.070) (-896.231) [-890.281] (-889.388) * (-899.419) (-891.209) (-893.631) [-889.547] -- 0:01:49
Average standard deviation of split frequencies: 0.008545
220500 -- (-894.245) (-891.897) (-890.422) [-890.174] * (-892.571) [-889.074] (-891.557) (-890.695) -- 0:01:49
221000 -- [-892.600] (-896.376) (-891.617) (-893.618) * (-893.359) [-888.446] (-893.976) (-892.296) -- 0:01:49
221500 -- (-891.404) [-891.041] (-887.757) (-896.982) * (-891.896) (-894.069) (-895.311) [-891.017] -- 0:01:48
222000 -- (-896.765) (-888.880) [-891.750] (-899.990) * (-888.113) [-889.602] (-898.704) (-896.132) -- 0:01:48
222500 -- (-895.985) (-893.427) [-889.989] (-894.170) * (-888.094) (-893.223) [-890.391] (-890.912) -- 0:01:48
223000 -- (-896.566) (-890.433) (-892.259) [-893.631] * (-893.026) (-891.825) (-891.851) [-893.173] -- 0:01:51
223500 -- (-889.852) (-893.452) [-890.067] (-892.135) * (-891.257) (-899.475) [-901.911] (-893.277) -- 0:01:51
224000 -- (-888.625) [-893.059] (-897.132) (-889.086) * (-891.384) (-893.322) [-889.687] (-892.519) -- 0:01:50
224500 -- (-898.443) (-889.545) [-895.910] (-890.715) * (-891.463) (-890.780) [-888.907] (-889.747) -- 0:01:50
225000 -- (-892.132) (-891.707) (-891.024) [-889.935] * (-887.591) [-891.236] (-887.822) (-891.757) -- 0:01:50
Average standard deviation of split frequencies: 0.006258
225500 -- (-898.232) (-893.268) (-891.357) [-890.122] * (-893.421) [-889.360] (-887.744) (-897.423) -- 0:01:49
226000 -- (-893.044) (-888.266) [-895.857] (-889.992) * (-894.161) [-894.958] (-891.290) (-905.052) -- 0:01:49
226500 -- [-888.634] (-892.081) (-893.963) (-891.235) * [-894.221] (-894.915) (-895.793) (-894.910) -- 0:01:49
227000 -- (-890.249) (-891.379) (-893.945) [-892.681] * (-892.688) [-895.644] (-890.353) (-900.345) -- 0:01:48
227500 -- (-896.123) [-895.396] (-889.239) (-892.659) * (-894.033) (-891.633) [-890.952] (-898.508) -- 0:01:48
228000 -- (-890.350) (-891.869) [-892.095] (-895.871) * [-888.876] (-889.598) (-903.470) (-909.310) -- 0:01:48
228500 -- (-891.495) (-896.777) [-888.476] (-898.325) * [-889.623] (-892.138) (-896.022) (-897.857) -- 0:01:48
229000 -- (-891.210) [-896.157] (-891.957) (-894.585) * [-888.774] (-891.994) (-895.056) (-894.108) -- 0:01:47
229500 -- (-890.420) [-894.908] (-896.336) (-891.907) * (-886.871) (-889.058) (-897.673) [-895.938] -- 0:01:47
230000 -- (-898.409) [-894.779] (-892.111) (-891.198) * [-890.221] (-890.793) (-893.793) (-893.439) -- 0:01:50
Average standard deviation of split frequencies: 0.008175
230500 -- [-896.212] (-895.310) (-897.321) (-892.789) * (-889.962) (-891.213) [-895.702] (-893.748) -- 0:01:50
231000 -- [-893.582] (-895.799) (-895.107) (-893.000) * [-888.441] (-891.144) (-890.535) (-893.044) -- 0:01:49
231500 -- (-892.942) (-891.136) (-895.924) [-892.063] * [-895.487] (-891.088) (-888.252) (-895.641) -- 0:01:49
232000 -- (-894.326) [-887.160] (-900.423) (-891.560) * [-888.560] (-899.105) (-888.387) (-894.281) -- 0:01:49
232500 -- (-897.359) (-891.212) (-895.203) [-894.794] * (-894.598) (-900.831) (-892.768) [-896.433] -- 0:01:48
233000 -- [-888.948] (-893.922) (-900.419) (-894.141) * (-892.185) (-892.686) (-889.074) [-891.950] -- 0:01:48
233500 -- [-896.128] (-892.574) (-895.701) (-890.404) * (-887.756) (-895.799) [-889.070] (-893.535) -- 0:01:48
234000 -- (-886.628) [-890.415] (-895.645) (-891.335) * (-893.057) (-896.415) [-892.361] (-890.388) -- 0:01:48
234500 -- [-889.356] (-895.476) (-896.540) (-895.529) * [-892.183] (-894.623) (-889.736) (-891.119) -- 0:01:47
235000 -- [-892.318] (-890.026) (-893.079) (-892.299) * (-891.931) (-888.257) (-892.114) [-892.958] -- 0:01:47
Average standard deviation of split frequencies: 0.005992
235500 -- (-898.629) [-895.632] (-894.969) (-891.788) * (-893.462) (-891.610) [-892.814] (-889.120) -- 0:01:47
236000 -- [-889.634] (-890.238) (-889.101) (-890.161) * (-895.088) [-889.381] (-891.139) (-890.164) -- 0:01:46
236500 -- (-893.578) [-889.386] (-889.195) (-887.352) * [-892.341] (-891.539) (-891.739) (-892.355) -- 0:01:46
237000 -- (-889.157) (-890.089) [-890.570] (-894.893) * (-891.165) (-889.336) (-892.026) [-887.717] -- 0:01:46
237500 -- [-893.112] (-889.217) (-892.636) (-890.153) * (-887.783) [-894.579] (-891.892) (-891.769) -- 0:01:49
238000 -- (-892.992) (-889.342) [-888.714] (-901.889) * [-890.208] (-892.608) (-889.736) (-890.184) -- 0:01:48
238500 -- (-889.206) (-888.237) [-892.122] (-893.631) * [-888.500] (-892.947) (-888.962) (-896.997) -- 0:01:48
239000 -- (-891.631) (-889.378) [-886.700] (-889.287) * (-891.455) [-894.394] (-888.691) (-890.420) -- 0:01:48
239500 -- (-893.488) (-888.907) [-889.444] (-893.005) * [-891.404] (-890.401) (-890.760) (-892.956) -- 0:01:47
240000 -- (-893.696) (-894.793) (-891.645) [-893.327] * (-888.823) [-890.115] (-889.615) (-897.883) -- 0:01:47
Average standard deviation of split frequencies: 0.007835
240500 -- (-897.929) (-893.478) (-890.145) [-896.801] * (-890.919) [-891.226] (-890.690) (-892.965) -- 0:01:47
241000 -- (-896.446) (-892.474) [-889.428] (-890.124) * (-888.602) (-892.862) [-891.955] (-888.067) -- 0:01:47
241500 -- (-897.408) (-888.442) [-888.687] (-892.627) * [-891.292] (-893.501) (-892.108) (-888.154) -- 0:01:46
242000 -- [-898.087] (-890.506) (-893.857) (-898.350) * (-892.214) (-896.525) (-891.022) [-890.457] -- 0:01:46
242500 -- [-891.007] (-890.239) (-891.257) (-897.801) * (-890.007) (-888.531) [-887.565] (-888.337) -- 0:01:46
243000 -- [-891.214] (-888.908) (-889.457) (-893.086) * (-889.783) [-890.529] (-890.544) (-889.941) -- 0:01:45
243500 -- (-893.817) [-892.408] (-892.670) (-891.162) * [-894.541] (-888.776) (-891.831) (-894.865) -- 0:01:45
244000 -- (-890.694) [-890.084] (-898.017) (-893.199) * (-891.059) (-891.977) [-888.825] (-893.360) -- 0:01:45
244500 -- (-888.059) (-892.637) (-891.691) [-891.208] * [-890.465] (-896.768) (-888.835) (-892.243) -- 0:01:48
245000 -- (-891.170) (-890.784) (-891.641) [-893.536] * (-888.861) [-892.873] (-891.497) (-896.860) -- 0:01:47
Average standard deviation of split frequencies: 0.007665
245500 -- (-889.937) (-895.256) [-890.180] (-895.012) * (-892.210) (-893.952) [-894.916] (-893.895) -- 0:01:47
246000 -- (-892.759) [-890.254] (-891.283) (-893.142) * (-894.165) (-895.602) (-892.525) [-889.733] -- 0:01:47
246500 -- (-891.276) [-890.052] (-898.595) (-892.252) * [-891.474] (-889.663) (-891.724) (-888.765) -- 0:01:46
247000 -- [-896.877] (-895.760) (-889.166) (-896.222) * (-890.622) [-892.293] (-893.872) (-893.463) -- 0:01:46
247500 -- (-894.247) (-896.072) [-891.582] (-893.578) * (-888.634) [-894.145] (-894.560) (-898.282) -- 0:01:46
248000 -- (-889.920) (-888.195) [-891.872] (-891.071) * (-889.353) (-894.376) [-892.835] (-900.064) -- 0:01:46
248500 -- (-893.400) (-891.769) (-890.684) [-892.029] * (-889.187) [-890.536] (-889.557) (-891.009) -- 0:01:45
249000 -- (-890.942) [-890.612] (-894.690) (-890.200) * [-890.944] (-889.796) (-892.424) (-891.811) -- 0:01:45
249500 -- (-897.514) (-890.870) (-890.621) [-886.462] * (-890.205) (-894.418) (-894.743) [-889.250] -- 0:01:45
250000 -- (-890.840) (-888.427) (-895.868) [-889.188] * (-890.300) (-901.007) (-897.926) [-890.028] -- 0:01:44
Average standard deviation of split frequencies: 0.005642
250500 -- (-893.177) (-886.798) (-891.923) [-892.608] * [-891.063] (-896.138) (-894.332) (-893.774) -- 0:01:44
251000 -- (-886.860) (-896.270) [-888.751] (-891.252) * (-897.374) [-891.100] (-894.618) (-890.902) -- 0:01:44
251500 -- (-892.601) [-890.157] (-892.032) (-896.230) * [-889.224] (-893.853) (-892.669) (-893.418) -- 0:01:47
252000 -- (-889.803) (-889.358) [-887.093] (-893.802) * [-889.633] (-895.029) (-891.787) (-890.104) -- 0:01:46
252500 -- (-889.244) (-892.758) (-891.373) [-892.958] * [-891.113] (-896.790) (-893.504) (-890.111) -- 0:01:46
253000 -- [-897.438] (-898.812) (-896.074) (-890.136) * (-889.765) (-895.866) (-889.855) [-888.612] -- 0:01:46
253500 -- (-896.213) (-898.298) [-896.462] (-892.591) * (-891.077) (-894.127) [-889.518] (-894.238) -- 0:01:46
254000 -- [-889.802] (-891.506) (-892.185) (-895.058) * (-887.647) (-893.661) (-887.001) [-890.641] -- 0:01:45
254500 -- (-891.232) (-890.659) [-888.853] (-892.954) * (-893.776) (-901.864) (-898.238) [-893.786] -- 0:01:45
255000 -- (-897.351) (-892.707) [-888.899] (-892.441) * [-888.801] (-899.622) (-894.193) (-893.809) -- 0:01:45
Average standard deviation of split frequencies: 0.009207
255500 -- (-888.456) (-889.237) [-887.689] (-892.066) * (-892.371) (-892.755) [-891.919] (-899.926) -- 0:01:44
256000 -- (-890.612) (-893.804) (-891.749) [-888.987] * (-894.715) (-891.842) [-891.158] (-892.820) -- 0:01:44
256500 -- (-895.030) (-891.417) (-890.874) [-895.097] * (-894.815) [-893.164] (-893.300) (-889.034) -- 0:01:44
257000 -- (-890.206) (-887.738) [-891.846] (-898.772) * (-887.733) [-903.768] (-890.715) (-896.163) -- 0:01:44
257500 -- [-891.674] (-887.303) (-892.761) (-899.601) * (-891.661) (-895.619) [-896.756] (-896.379) -- 0:01:43
258000 -- (-889.696) (-890.758) [-888.806] (-897.180) * (-892.947) (-895.727) (-890.500) [-888.210] -- 0:01:43
258500 -- [-891.885] (-894.120) (-890.067) (-893.127) * (-890.213) [-894.290] (-888.019) (-895.974) -- 0:01:46
259000 -- (-893.846) (-897.505) [-891.700] (-894.424) * (-893.140) (-896.198) [-888.629] (-897.121) -- 0:01:45
259500 -- (-892.302) [-890.092] (-893.672) (-890.184) * (-893.378) (-893.957) [-891.618] (-892.719) -- 0:01:45
260000 -- (-895.152) (-889.799) (-894.424) [-891.457] * (-886.763) (-888.734) [-891.974] (-890.757) -- 0:01:45
Average standard deviation of split frequencies: 0.007234
260500 -- (-891.709) [-888.235] (-893.315) (-889.955) * [-892.960] (-888.588) (-892.612) (-892.831) -- 0:01:45
261000 -- [-894.436] (-890.894) (-895.372) (-895.564) * (-890.759) (-889.517) [-888.321] (-892.629) -- 0:01:44
261500 -- (-891.793) (-889.981) [-892.683] (-893.229) * (-895.007) (-895.193) (-889.034) [-901.452] -- 0:01:44
262000 -- [-901.004] (-887.205) (-894.536) (-895.241) * (-894.731) (-893.082) [-890.695] (-892.292) -- 0:01:44
262500 -- (-900.705) (-899.372) [-890.774] (-893.869) * (-887.324) [-895.873] (-896.144) (-893.442) -- 0:01:43
263000 -- [-892.975] (-889.585) (-890.910) (-890.785) * [-893.212] (-893.477) (-891.460) (-891.142) -- 0:01:43
263500 -- [-890.273] (-890.584) (-887.979) (-899.051) * (-891.625) (-891.005) [-891.814] (-893.078) -- 0:01:43
264000 -- (-889.444) [-890.561] (-891.100) (-894.343) * (-887.826) (-894.414) (-890.792) [-888.410] -- 0:01:43
264500 -- [-890.594] (-888.528) (-892.550) (-890.278) * [-888.864] (-889.331) (-895.930) (-892.776) -- 0:01:42
265000 -- (-894.087) (-892.491) [-891.718] (-890.993) * (-891.442) [-891.557] (-895.772) (-893.249) -- 0:01:42
Average standard deviation of split frequencies: 0.007089
265500 -- (-894.705) (-890.556) (-889.859) [-891.044] * (-895.392) [-891.005] (-892.407) (-892.315) -- 0:01:45
266000 -- [-894.509] (-886.900) (-889.605) (-892.915) * (-893.448) (-901.866) [-893.075] (-896.235) -- 0:01:44
266500 -- (-889.925) (-892.418) (-890.730) [-889.948] * (-889.425) (-892.078) (-894.193) [-893.553] -- 0:01:44
267000 -- (-899.322) (-891.855) [-889.830] (-889.246) * (-890.311) (-895.216) [-891.593] (-899.080) -- 0:01:44
267500 -- (-894.707) (-895.783) (-887.404) [-888.692] * [-889.106] (-893.712) (-899.812) (-890.891) -- 0:01:44
268000 -- (-892.798) [-899.641] (-889.429) (-889.725) * (-888.540) (-894.109) (-889.597) [-892.171] -- 0:01:43
268500 -- (-894.145) (-894.015) [-891.773] (-891.698) * (-897.685) (-895.095) (-889.439) [-891.803] -- 0:01:43
269000 -- (-887.097) [-889.600] (-890.736) (-888.085) * (-895.495) (-895.139) (-889.507) [-895.872] -- 0:01:43
269500 -- [-893.536] (-895.408) (-894.844) (-890.566) * (-895.437) (-900.628) (-890.132) [-893.875] -- 0:01:43
270000 -- (-893.553) (-888.786) (-892.435) [-896.126] * [-891.494] (-896.344) (-892.601) (-897.223) -- 0:01:42
Average standard deviation of split frequencies: 0.006967
270500 -- (-894.331) (-892.133) (-891.818) [-888.359] * [-891.489] (-895.313) (-892.868) (-895.835) -- 0:01:42
271000 -- (-892.450) [-891.070] (-895.344) (-895.499) * (-890.972) (-897.634) (-893.021) [-894.654] -- 0:01:42
271500 -- (-895.021) (-895.475) (-891.562) [-889.912] * [-889.361] (-895.713) (-893.623) (-896.690) -- 0:01:41
272000 -- [-896.551] (-888.647) (-889.788) (-893.230) * [-886.658] (-890.114) (-891.935) (-896.369) -- 0:01:41
272500 -- (-889.514) (-891.053) (-893.306) [-891.600] * [-892.903] (-892.954) (-893.345) (-892.766) -- 0:01:44
273000 -- (-895.539) [-888.334] (-890.673) (-892.589) * (-893.510) (-890.134) [-890.926] (-894.798) -- 0:01:43
273500 -- (-888.891) (-892.959) (-892.766) [-891.478] * (-894.327) (-891.006) (-893.808) [-887.129] -- 0:01:43
274000 -- (-890.428) [-892.869] (-889.343) (-889.716) * (-890.419) [-893.116] (-893.962) (-897.145) -- 0:01:43
274500 -- [-890.028] (-891.888) (-895.089) (-890.578) * (-903.837) (-893.356) (-890.153) [-894.487] -- 0:01:43
275000 -- (-891.591) [-893.198] (-892.316) (-899.320) * (-899.220) [-892.399] (-892.606) (-889.444) -- 0:01:42
Average standard deviation of split frequencies: 0.008540
275500 -- (-890.928) [-892.139] (-891.733) (-895.180) * (-892.954) (-895.392) (-893.508) [-890.479] -- 0:01:42
276000 -- [-890.559] (-895.218) (-891.773) (-891.394) * (-892.834) (-892.176) (-893.940) [-893.024] -- 0:01:42
276500 -- (-891.434) [-896.388] (-889.828) (-890.711) * (-889.682) (-895.517) (-893.133) [-895.890] -- 0:01:42
277000 -- [-893.769] (-891.947) (-893.983) (-892.306) * [-887.280] (-895.508) (-888.751) (-892.833) -- 0:01:41
277500 -- (-891.806) (-895.878) (-894.853) [-892.661] * (-891.649) (-887.757) [-888.195] (-893.947) -- 0:01:41
278000 -- [-892.558] (-891.757) (-891.581) (-895.610) * (-886.805) (-889.649) [-894.575] (-891.950) -- 0:01:41
278500 -- (-888.949) (-893.965) [-890.038] (-891.639) * (-889.009) (-895.350) (-897.908) [-892.617] -- 0:01:41
279000 -- [-891.077] (-888.679) (-891.550) (-892.030) * (-900.058) [-893.903] (-896.283) (-889.596) -- 0:01:40
279500 -- (-892.183) [-888.973] (-891.168) (-892.738) * (-892.722) (-893.117) [-894.984] (-889.304) -- 0:01:43
280000 -- (-897.363) (-887.577) (-889.021) [-888.053] * (-890.479) (-890.748) [-896.916] (-891.746) -- 0:01:42
Average standard deviation of split frequencies: 0.006718
280500 -- [-893.057] (-890.842) (-892.688) (-887.846) * (-890.778) [-894.567] (-893.514) (-889.578) -- 0:01:42
281000 -- (-895.335) (-892.746) [-891.165] (-891.264) * [-892.156] (-894.114) (-889.344) (-893.072) -- 0:01:42
281500 -- (-892.070) (-895.277) (-889.870) [-891.885] * [-889.135] (-891.089) (-891.221) (-893.555) -- 0:01:42
282000 -- [-889.958] (-894.436) (-890.494) (-887.620) * (-891.812) [-888.277] (-889.887) (-898.327) -- 0:01:41
282500 -- [-896.630] (-892.462) (-890.768) (-892.479) * [-888.445] (-891.285) (-889.127) (-895.908) -- 0:01:41
283000 -- (-896.677) (-891.589) (-895.408) [-896.557] * (-891.726) (-890.318) [-892.527] (-894.057) -- 0:01:41
283500 -- [-890.630] (-894.355) (-894.693) (-890.962) * [-891.883] (-898.289) (-894.420) (-897.653) -- 0:01:41
284000 -- [-891.506] (-890.773) (-894.774) (-888.890) * [-889.994] (-894.251) (-896.598) (-890.827) -- 0:01:40
284500 -- (-891.218) [-892.380] (-892.681) (-889.972) * [-893.220] (-892.694) (-890.772) (-891.193) -- 0:01:40
285000 -- (-890.500) (-889.350) [-892.160] (-896.074) * (-889.642) (-892.510) (-892.317) [-890.992] -- 0:01:40
Average standard deviation of split frequencies: 0.008241
285500 -- (-893.538) [-891.842] (-894.989) (-890.787) * (-893.096) [-892.005] (-889.812) (-889.004) -- 0:01:40
286000 -- (-889.135) (-887.530) [-894.020] (-893.434) * (-892.230) (-890.406) (-894.366) [-891.820] -- 0:01:39
286500 -- (-895.754) (-896.188) [-888.164] (-889.342) * (-894.885) (-891.188) [-889.970] (-886.976) -- 0:01:42
287000 -- [-894.506] (-893.289) (-888.357) (-888.569) * (-892.641) (-892.659) (-894.105) [-890.628] -- 0:01:41
287500 -- (-902.592) (-894.522) (-895.848) [-890.467] * (-889.552) [-890.667] (-896.563) (-892.067) -- 0:01:41
288000 -- (-892.356) (-894.564) (-898.756) [-893.312] * [-893.914] (-890.655) (-898.465) (-895.753) -- 0:01:41
288500 -- [-890.255] (-896.838) (-894.950) (-900.408) * (-891.633) (-891.650) [-892.219] (-896.177) -- 0:01:41
289000 -- (-889.461) (-892.870) [-894.963] (-889.114) * (-889.500) (-888.863) [-895.979] (-894.048) -- 0:01:40
289500 -- [-891.300] (-887.179) (-892.519) (-894.652) * (-891.656) (-895.083) [-891.390] (-894.602) -- 0:01:40
290000 -- (-887.621) (-893.550) [-891.446] (-889.974) * (-892.865) (-889.515) [-896.559] (-895.625) -- 0:01:40
Average standard deviation of split frequencies: 0.006487
290500 -- (-893.716) (-892.103) [-890.281] (-888.759) * [-889.096] (-889.126) (-897.262) (-892.651) -- 0:01:40
291000 -- (-890.871) [-890.767] (-891.590) (-896.992) * [-890.471] (-890.533) (-896.952) (-896.090) -- 0:01:39
291500 -- [-886.797] (-897.483) (-898.817) (-899.088) * [-888.895] (-894.934) (-889.797) (-894.046) -- 0:01:39
292000 -- (-891.083) (-889.110) (-892.876) [-888.545] * (-897.591) [-890.967] (-891.894) (-895.153) -- 0:01:39
292500 -- (-891.827) [-892.440] (-892.467) (-890.881) * (-893.113) (-891.350) [-896.474] (-890.869) -- 0:01:39
293000 -- (-893.704) (-892.936) (-894.098) [-893.934] * [-892.718] (-894.244) (-892.707) (-891.835) -- 0:01:38
293500 -- (-893.253) (-892.440) [-892.417] (-899.663) * (-890.286) [-889.571] (-895.461) (-897.924) -- 0:01:41
294000 -- (-891.706) (-892.233) [-889.256] (-894.942) * [-891.916] (-889.719) (-894.798) (-897.062) -- 0:01:40
294500 -- (-888.079) [-892.434] (-890.862) (-895.485) * (-890.740) (-889.631) (-896.843) [-893.085] -- 0:01:40
295000 -- (-890.449) [-890.565] (-893.277) (-891.798) * (-891.727) (-900.820) (-890.852) [-888.811] -- 0:01:40
Average standard deviation of split frequencies: 0.007963
295500 -- (-890.127) (-897.202) [-894.701] (-890.086) * (-891.488) (-894.063) [-892.478] (-892.143) -- 0:01:40
296000 -- (-893.581) (-895.102) (-892.430) [-890.367] * (-890.183) [-893.017] (-892.217) (-893.885) -- 0:01:39
296500 -- (-893.966) (-894.361) [-888.889] (-888.946) * (-893.998) [-897.036] (-891.855) (-889.456) -- 0:01:39
297000 -- [-889.719] (-893.670) (-892.661) (-892.440) * [-889.576] (-890.858) (-891.880) (-894.573) -- 0:01:39
297500 -- (-892.223) (-890.976) [-889.967] (-893.578) * [-892.181] (-890.720) (-891.268) (-892.477) -- 0:01:39
298000 -- (-893.951) (-890.435) [-895.670] (-892.831) * [-889.488] (-894.118) (-894.830) (-893.313) -- 0:01:38
298500 -- (-890.500) (-888.104) [-888.682] (-890.806) * (-893.446) (-893.969) [-892.419] (-896.515) -- 0:01:38
299000 -- (-895.471) (-889.983) [-890.587] (-888.825) * [-892.341] (-897.481) (-892.596) (-896.607) -- 0:01:38
299500 -- (-889.647) (-893.342) (-887.692) [-891.129] * (-897.638) [-892.332] (-891.442) (-898.192) -- 0:01:38
300000 -- [-895.421] (-890.014) (-887.127) (-897.203) * (-891.392) [-890.850] (-896.713) (-890.424) -- 0:01:37
Average standard deviation of split frequencies: 0.004704
300500 -- [-888.793] (-892.679) (-891.787) (-897.263) * (-892.686) (-889.901) [-893.976] (-891.110) -- 0:01:40
301000 -- [-892.102] (-890.150) (-897.731) (-894.917) * (-895.446) [-892.054] (-894.768) (-893.331) -- 0:01:39
301500 -- (-892.822) (-895.191) (-890.367) [-890.176] * (-898.139) [-891.244] (-897.090) (-892.429) -- 0:01:39
302000 -- (-891.111) (-889.838) [-889.348] (-892.434) * (-896.224) (-893.048) (-890.607) [-890.981] -- 0:01:39
302500 -- [-891.243] (-890.572) (-889.943) (-893.238) * (-888.135) (-893.848) [-890.753] (-891.043) -- 0:01:39
303000 -- (-896.551) [-891.622] (-898.338) (-897.171) * (-897.858) [-893.054] (-892.158) (-888.557) -- 0:01:38
303500 -- (-892.389) (-899.617) (-889.072) [-892.426] * (-893.512) (-890.475) (-896.535) [-890.801] -- 0:01:38
304000 -- [-893.110] (-892.332) (-894.881) (-892.823) * (-895.452) [-889.173] (-893.695) (-889.097) -- 0:01:38
304500 -- (-892.072) (-897.550) (-896.366) [-891.445] * [-890.338] (-890.873) (-895.188) (-893.854) -- 0:01:38
305000 -- (-892.362) [-892.257] (-897.430) (-893.728) * (-892.498) (-890.848) [-892.818] (-891.640) -- 0:01:37
Average standard deviation of split frequencies: 0.004622
305500 -- (-890.429) [-888.116] (-895.669) (-892.001) * (-891.526) (-891.220) (-889.249) [-898.289] -- 0:01:37
306000 -- [-890.973] (-892.908) (-893.520) (-898.247) * (-892.504) [-891.852] (-896.589) (-889.782) -- 0:01:37
306500 -- (-891.065) [-890.899] (-896.750) (-894.097) * (-893.704) (-893.667) (-895.912) [-891.517] -- 0:01:37
307000 -- (-893.218) (-892.662) (-892.086) [-892.528] * (-890.712) [-889.707] (-894.398) (-891.234) -- 0:01:37
307500 -- (-891.193) [-890.623] (-891.351) (-891.106) * (-891.193) (-892.002) (-895.229) [-888.315] -- 0:01:39
308000 -- (-893.156) [-890.203] (-897.872) (-893.110) * [-891.685] (-896.982) (-891.268) (-891.180) -- 0:01:38
308500 -- (-892.381) (-889.577) [-891.533] (-897.408) * (-894.857) (-892.231) [-893.094] (-890.224) -- 0:01:38
309000 -- (-893.880) [-891.169] (-892.090) (-891.711) * (-889.225) (-889.463) (-893.637) [-891.946] -- 0:01:38
309500 -- (-894.607) [-892.549] (-892.171) (-899.746) * (-889.774) [-893.113] (-887.618) (-896.828) -- 0:01:38
310000 -- (-892.649) [-890.814] (-893.633) (-906.479) * (-890.854) (-891.677) (-889.505) [-893.767] -- 0:01:37
Average standard deviation of split frequencies: 0.001517
310500 -- (-886.636) (-890.726) [-892.926] (-898.850) * (-889.155) (-890.239) [-890.482] (-894.673) -- 0:01:37
311000 -- (-890.774) [-892.292] (-893.067) (-891.630) * (-891.257) (-895.938) [-890.824] (-888.938) -- 0:01:37
311500 -- (-896.512) (-891.208) [-893.303] (-894.387) * (-894.303) (-899.115) (-894.016) [-894.619] -- 0:01:37
312000 -- [-890.660] (-892.112) (-888.228) (-893.685) * [-887.961] (-892.123) (-891.150) (-892.606) -- 0:01:37
312500 -- (-893.175) [-889.091] (-892.137) (-890.403) * (-890.485) (-890.123) (-889.878) [-890.874] -- 0:01:36
313000 -- (-889.343) (-893.044) (-891.339) [-891.760] * [-892.764] (-890.057) (-889.844) (-893.060) -- 0:01:36
313500 -- (-890.856) (-889.394) (-889.764) [-889.858] * (-895.171) [-890.931] (-894.994) (-890.712) -- 0:01:36
314000 -- [-888.184] (-893.793) (-889.310) (-893.702) * (-900.407) [-892.606] (-887.507) (-892.352) -- 0:01:36
314500 -- (-890.630) (-889.086) [-890.009] (-893.846) * (-901.472) (-888.279) (-893.376) [-890.463] -- 0:01:38
315000 -- (-900.303) [-893.951] (-894.316) (-890.882) * (-895.489) (-891.181) (-893.706) [-891.030] -- 0:01:37
Average standard deviation of split frequencies: 0.001492
315500 -- (-893.337) [-895.174] (-889.379) (-889.779) * (-895.762) [-891.657] (-896.394) (-892.053) -- 0:01:37
316000 -- [-890.815] (-894.544) (-892.455) (-893.451) * (-889.370) (-891.316) (-890.003) [-891.887] -- 0:01:37
316500 -- (-888.680) (-890.318) [-895.644] (-893.693) * (-892.081) [-888.941] (-890.268) (-892.973) -- 0:01:37
317000 -- (-888.734) [-893.005] (-891.151) (-892.746) * (-894.176) [-892.348] (-890.522) (-887.799) -- 0:01:36
317500 -- (-891.187) [-893.444] (-894.944) (-889.607) * (-891.348) (-891.852) [-892.597] (-892.751) -- 0:01:36
318000 -- (-891.670) (-897.007) [-892.624] (-893.264) * (-889.071) (-894.383) [-891.532] (-892.766) -- 0:01:36
318500 -- (-891.271) (-893.325) (-889.229) [-889.910] * (-891.297) [-890.983] (-890.416) (-890.885) -- 0:01:36
319000 -- (-893.670) [-894.576] (-889.831) (-891.619) * [-893.080] (-891.596) (-894.119) (-891.089) -- 0:01:36
319500 -- [-894.577] (-890.486) (-888.194) (-895.100) * (-890.892) [-889.651] (-895.161) (-893.356) -- 0:01:35
320000 -- (-899.090) [-895.217] (-887.342) (-891.949) * (-893.528) [-892.305] (-890.853) (-894.944) -- 0:01:35
Average standard deviation of split frequencies: 0.001470
320500 -- (-891.350) (-890.022) (-889.640) [-897.259] * (-897.924) (-891.956) [-890.060] (-890.328) -- 0:01:35
321000 -- [-892.149] (-888.259) (-891.367) (-891.902) * (-895.023) (-892.256) [-888.161] (-893.231) -- 0:01:35
321500 -- (-896.259) (-893.562) (-889.408) [-889.630] * (-895.230) (-886.994) [-891.663] (-890.576) -- 0:01:37
322000 -- [-889.206] (-894.171) (-888.636) (-890.373) * (-889.877) [-894.169] (-888.929) (-890.969) -- 0:01:36
322500 -- (-890.510) (-895.729) [-891.245] (-889.677) * (-888.324) (-894.725) [-888.239] (-890.561) -- 0:01:36
323000 -- [-893.655] (-897.385) (-889.331) (-892.952) * (-896.538) [-893.482] (-890.422) (-892.729) -- 0:01:36
323500 -- (-891.130) [-891.002] (-888.410) (-887.586) * (-891.397) [-891.644] (-895.794) (-894.144) -- 0:01:36
324000 -- (-894.841) (-893.349) [-891.956] (-892.058) * (-893.081) (-893.668) [-892.258] (-887.633) -- 0:01:35
324500 -- (-892.662) (-889.398) (-890.150) [-888.167] * (-907.349) (-897.447) [-893.923] (-890.369) -- 0:01:35
325000 -- (-894.642) (-891.868) [-891.907] (-894.743) * (-893.610) (-896.829) (-891.490) [-888.932] -- 0:01:35
Average standard deviation of split frequencies: 0.002892
325500 -- (-896.774) [-890.483] (-889.332) (-894.532) * (-893.801) [-893.827] (-894.404) (-895.134) -- 0:01:35
326000 -- (-892.684) [-893.510] (-888.695) (-892.523) * (-898.127) (-894.832) (-888.869) [-888.773] -- 0:01:35
326500 -- (-889.806) (-891.032) (-891.236) [-889.635] * (-891.979) (-895.198) (-887.325) [-895.840] -- 0:01:34
327000 -- (-890.762) [-888.750] (-891.224) (-891.333) * (-893.642) [-889.114] (-892.051) (-893.833) -- 0:01:34
327500 -- (-889.138) (-895.508) [-889.552] (-890.878) * (-894.273) (-892.016) [-888.899] (-893.039) -- 0:01:34
328000 -- (-891.067) [-890.376] (-891.399) (-894.127) * (-889.734) [-889.729] (-892.400) (-892.219) -- 0:01:34
328500 -- (-892.142) (-892.681) [-890.793] (-892.572) * [-888.034] (-892.237) (-890.363) (-891.490) -- 0:01:36
329000 -- [-892.834] (-890.661) (-895.400) (-891.018) * (-892.902) (-889.808) (-894.566) [-887.511] -- 0:01:35
329500 -- (-893.041) (-893.611) [-890.831] (-891.089) * [-892.901] (-888.745) (-892.794) (-891.841) -- 0:01:35
330000 -- (-896.169) (-892.480) [-896.535] (-894.223) * (-893.902) (-895.529) (-894.927) [-894.172] -- 0:01:35
Average standard deviation of split frequencies: 0.004277
330500 -- (-891.955) (-897.685) [-893.866] (-892.616) * (-890.419) (-891.397) (-894.443) [-899.015] -- 0:01:35
331000 -- (-890.478) (-891.218) [-894.296] (-894.636) * (-894.129) (-893.601) (-892.536) [-896.032] -- 0:01:34
331500 -- (-891.173) [-891.403] (-895.430) (-893.593) * (-895.551) (-895.187) [-890.993] (-893.646) -- 0:01:34
332000 -- (-892.016) [-894.652] (-894.727) (-893.783) * (-899.013) (-893.319) [-894.010] (-893.692) -- 0:01:34
332500 -- (-892.266) (-891.913) [-893.273] (-890.669) * (-897.511) (-889.646) (-892.284) [-897.605] -- 0:01:34
333000 -- (-892.596) (-891.028) (-899.126) [-895.480] * (-893.748) [-897.839] (-893.365) (-892.445) -- 0:01:34
333500 -- (-891.615) (-893.059) [-893.888] (-889.705) * (-894.356) (-895.061) [-893.485] (-893.743) -- 0:01:33
334000 -- [-890.031] (-904.044) (-900.914) (-895.461) * (-890.925) [-890.057] (-892.848) (-891.055) -- 0:01:33
334500 -- [-892.231] (-889.287) (-892.840) (-896.740) * (-896.782) (-899.015) [-891.738] (-890.089) -- 0:01:33
335000 -- [-890.928] (-892.272) (-890.108) (-894.857) * (-891.947) (-889.793) (-890.053) [-887.570] -- 0:01:33
Average standard deviation of split frequencies: 0.004209
335500 -- (-888.635) [-890.194] (-891.285) (-892.119) * [-893.390] (-892.554) (-891.646) (-892.050) -- 0:01:35
336000 -- (-893.659) [-890.578] (-898.074) (-891.398) * (-892.137) (-895.016) (-888.935) [-890.817] -- 0:01:34
336500 -- (-891.917) [-888.599] (-889.363) (-896.179) * (-892.001) [-890.156] (-894.300) (-891.607) -- 0:01:34
337000 -- (-892.263) [-890.488] (-891.181) (-891.246) * (-897.038) [-889.712] (-898.255) (-890.971) -- 0:01:34
337500 -- (-893.684) [-888.313] (-894.035) (-895.151) * [-888.343] (-892.294) (-892.772) (-890.602) -- 0:01:34
338000 -- (-893.201) [-889.337] (-891.567) (-889.273) * (-895.866) (-893.033) [-889.796] (-888.124) -- 0:01:34
338500 -- [-893.226] (-889.264) (-894.363) (-888.829) * [-890.464] (-889.213) (-888.471) (-890.243) -- 0:01:33
339000 -- (-891.652) [-891.682] (-891.246) (-892.109) * (-894.995) (-892.323) (-889.750) [-888.186] -- 0:01:33
339500 -- (-899.829) (-889.867) [-889.710] (-889.345) * (-892.175) (-891.157) (-892.524) [-890.026] -- 0:01:33
340000 -- (-896.051) (-891.571) (-897.034) [-886.676] * (-891.861) (-893.272) [-896.128] (-891.580) -- 0:01:33
Average standard deviation of split frequencies: 0.008303
340500 -- (-890.891) [-889.452] (-889.364) (-892.439) * (-891.924) (-890.240) [-892.110] (-891.723) -- 0:01:32
341000 -- (-892.784) [-888.280] (-890.564) (-891.818) * [-893.156] (-893.030) (-891.933) (-890.488) -- 0:01:32
341500 -- (-895.233) (-888.575) (-891.346) [-893.092] * (-896.813) [-888.481] (-885.318) (-890.781) -- 0:01:32
342000 -- (-892.129) [-891.845] (-897.414) (-889.860) * (-898.688) (-892.054) (-891.278) [-893.523] -- 0:01:32
342500 -- (-892.033) (-897.764) (-890.331) [-891.782] * (-893.955) [-894.963] (-893.780) (-894.192) -- 0:01:32
343000 -- (-902.260) (-890.642) [-892.011] (-888.202) * [-891.804] (-888.550) (-892.672) (-890.576) -- 0:01:33
343500 -- (-894.711) [-889.587] (-894.102) (-895.756) * (-894.259) (-894.071) [-894.146] (-894.008) -- 0:01:33
344000 -- (-890.069) (-895.237) (-894.202) [-894.949] * (-895.222) (-897.093) (-900.183) [-891.063] -- 0:01:33
344500 -- (-891.270) [-889.545] (-896.486) (-896.986) * (-896.250) (-899.789) [-892.991] (-890.595) -- 0:01:33
345000 -- [-892.362] (-896.709) (-891.262) (-894.506) * (-890.150) (-900.635) (-894.173) [-894.096] -- 0:01:33
Average standard deviation of split frequencies: 0.008175
345500 -- (-891.470) (-895.770) [-895.771] (-894.591) * (-894.715) (-900.153) [-897.932] (-895.624) -- 0:01:32
346000 -- (-894.189) (-900.251) (-895.664) [-891.594] * (-890.060) (-901.997) (-893.668) [-889.978] -- 0:01:32
346500 -- (-891.615) (-893.255) [-892.416] (-894.190) * (-890.539) [-894.238] (-893.462) (-892.882) -- 0:01:32
347000 -- [-900.437] (-893.905) (-896.053) (-890.613) * (-890.061) (-894.417) [-893.670] (-896.877) -- 0:01:32
347500 -- (-893.158) [-890.572] (-891.599) (-891.758) * (-899.400) (-896.742) [-900.281] (-894.114) -- 0:01:32
348000 -- (-894.142) (-892.158) (-890.158) [-892.838] * (-891.938) [-889.227] (-893.212) (-894.270) -- 0:01:31
348500 -- (-889.632) [-892.940] (-890.625) (-891.256) * (-895.458) (-892.877) (-890.065) [-896.518] -- 0:01:31
349000 -- (-889.583) (-890.475) (-895.512) [-890.532] * (-890.134) (-891.789) [-890.332] (-895.713) -- 0:01:31
349500 -- [-891.435] (-887.274) (-895.494) (-891.107) * (-892.676) [-892.977] (-888.959) (-892.746) -- 0:01:33
350000 -- (-891.048) (-888.621) (-890.232) [-892.090] * (-892.437) (-897.337) (-892.806) [-892.377] -- 0:01:32
Average standard deviation of split frequencies: 0.009410
350500 -- (-895.474) (-890.594) [-892.045] (-890.585) * (-891.850) (-891.682) (-890.924) [-890.186] -- 0:01:32
351000 -- (-893.445) (-895.061) [-891.884] (-899.057) * [-889.041] (-892.203) (-896.654) (-891.873) -- 0:01:32
351500 -- [-891.900] (-898.895) (-894.639) (-892.650) * (-892.144) (-893.080) [-890.566] (-900.513) -- 0:01:32
352000 -- (-899.241) [-892.262] (-895.312) (-895.922) * (-889.781) (-893.605) [-888.478] (-891.942) -- 0:01:32
352500 -- (-894.564) (-893.849) [-893.376] (-899.211) * [-893.083] (-898.996) (-896.541) (-892.447) -- 0:01:31
353000 -- (-891.345) [-889.452] (-889.161) (-893.782) * [-890.867] (-893.842) (-890.175) (-894.148) -- 0:01:31
353500 -- [-889.575] (-891.506) (-898.501) (-891.388) * (-897.588) [-890.187] (-889.914) (-899.126) -- 0:01:31
354000 -- (-890.442) (-891.183) [-894.300] (-888.853) * (-892.913) (-893.117) [-889.376] (-896.176) -- 0:01:31
354500 -- [-890.908] (-889.616) (-888.678) (-892.481) * [-890.246] (-892.425) (-900.832) (-891.787) -- 0:01:31
355000 -- (-893.294) (-893.160) [-892.141] (-892.264) * [-894.514] (-895.067) (-888.533) (-893.585) -- 0:01:30
Average standard deviation of split frequencies: 0.009269
355500 -- (-890.198) (-896.341) [-893.633] (-894.128) * (-892.871) (-891.763) [-889.208] (-892.588) -- 0:01:30
356000 -- (-889.829) [-892.226] (-894.141) (-893.839) * (-891.285) (-888.803) [-891.309] (-892.415) -- 0:01:30
356500 -- (-892.899) [-891.747] (-894.091) (-892.741) * (-896.130) (-892.775) [-891.766] (-895.731) -- 0:01:30
357000 -- (-888.289) (-895.936) [-887.549] (-891.381) * (-892.200) [-891.061] (-891.458) (-898.365) -- 0:01:31
357500 -- [-897.163] (-896.457) (-891.330) (-895.769) * [-891.493] (-895.595) (-891.177) (-895.269) -- 0:01:31
358000 -- (-891.993) (-890.368) (-894.213) [-888.474] * (-898.352) [-891.292] (-889.709) (-896.359) -- 0:01:31
358500 -- (-889.087) (-898.310) (-891.728) [-892.155] * [-890.370] (-893.339) (-889.658) (-896.542) -- 0:01:31
359000 -- (-892.459) (-899.271) [-891.828] (-891.943) * [-894.754] (-893.627) (-892.419) (-891.339) -- 0:01:31
359500 -- (-901.857) (-897.970) (-900.540) [-891.717] * (-890.342) [-893.675] (-893.360) (-894.154) -- 0:01:30
360000 -- (-893.859) (-892.485) (-895.436) [-887.240] * (-888.303) [-887.508] (-895.789) (-889.557) -- 0:01:30
Average standard deviation of split frequencies: 0.007842
360500 -- (-893.631) [-894.695] (-893.992) (-892.118) * (-890.621) (-891.390) [-892.694] (-892.037) -- 0:01:30
361000 -- (-894.852) (-892.690) (-897.137) [-897.958] * (-892.859) (-901.871) [-893.941] (-897.952) -- 0:01:30
361500 -- (-889.660) (-895.933) [-895.668] (-898.475) * [-891.897] (-897.090) (-896.937) (-894.501) -- 0:01:30
362000 -- (-898.467) (-893.529) (-899.019) [-893.464] * [-895.670] (-891.045) (-890.631) (-890.130) -- 0:01:29
362500 -- (-893.146) (-889.166) [-895.058] (-893.254) * (-892.895) (-896.616) [-891.803] (-892.326) -- 0:01:29
363000 -- [-896.446] (-894.569) (-893.737) (-893.438) * [-888.163] (-888.582) (-892.889) (-890.785) -- 0:01:29
363500 -- [-888.484] (-890.450) (-898.271) (-890.785) * [-894.680] (-899.427) (-896.756) (-892.794) -- 0:01:29
364000 -- (-894.898) (-897.574) [-889.571] (-890.662) * [-887.638] (-891.896) (-894.681) (-890.855) -- 0:01:30
364500 -- [-893.042] (-897.702) (-892.341) (-892.319) * [-895.773] (-893.297) (-891.754) (-887.612) -- 0:01:30
365000 -- (-892.894) (-891.364) (-888.303) [-896.919] * (-891.416) [-894.671] (-889.930) (-892.973) -- 0:01:30
Average standard deviation of split frequencies: 0.007728
365500 -- (-892.061) (-894.383) (-888.751) [-893.933] * [-897.082] (-896.009) (-893.737) (-892.719) -- 0:01:30
366000 -- (-889.616) (-892.271) [-889.438] (-891.676) * (-894.688) (-894.454) (-896.483) [-889.406] -- 0:01:30
366500 -- (-892.753) (-896.866) [-893.128] (-894.719) * [-888.892] (-892.939) (-892.779) (-889.004) -- 0:01:29
367000 -- (-890.937) (-893.674) (-896.535) [-893.273] * [-888.710] (-892.214) (-892.932) (-889.961) -- 0:01:29
367500 -- (-893.427) [-890.991] (-891.702) (-891.991) * [-890.172] (-888.148) (-888.530) (-895.020) -- 0:01:29
368000 -- (-894.348) (-887.745) (-892.708) [-893.451] * (-890.532) (-891.099) [-893.570] (-899.112) -- 0:01:29
368500 -- [-889.691] (-891.975) (-899.205) (-891.106) * [-890.922] (-892.715) (-891.021) (-896.207) -- 0:01:29
369000 -- [-892.356] (-890.072) (-893.216) (-889.487) * [-892.663] (-894.809) (-891.120) (-888.651) -- 0:01:28
369500 -- [-898.518] (-890.575) (-898.601) (-891.002) * [-891.623] (-891.164) (-888.864) (-892.867) -- 0:01:28
370000 -- (-892.206) (-894.623) [-892.888] (-889.747) * (-890.191) [-889.298] (-889.514) (-895.856) -- 0:01:28
Average standard deviation of split frequencies: 0.006359
370500 -- (-891.355) [-891.367] (-896.851) (-889.831) * (-887.673) (-895.311) (-894.629) [-889.635] -- 0:01:28
371000 -- [-887.734] (-890.263) (-897.027) (-890.378) * (-889.879) [-893.903] (-892.032) (-887.218) -- 0:01:29
371500 -- [-891.473] (-892.012) (-897.119) (-892.206) * [-892.015] (-893.427) (-891.828) (-894.151) -- 0:01:29
372000 -- (-898.753) (-891.151) (-888.777) [-890.891] * (-895.522) [-895.637] (-892.144) (-890.532) -- 0:01:29
372500 -- (-888.735) (-898.535) [-888.661] (-891.076) * (-892.861) (-896.782) (-894.782) [-891.867] -- 0:01:29
373000 -- (-887.505) [-891.657] (-898.352) (-889.176) * (-895.063) (-892.478) [-892.313] (-891.170) -- 0:01:29
373500 -- (-891.356) [-893.736] (-895.652) (-887.425) * (-888.022) (-892.633) [-892.549] (-888.626) -- 0:01:28
374000 -- (-893.355) [-897.515] (-893.851) (-898.170) * (-890.563) (-898.341) [-894.681] (-892.844) -- 0:01:28
374500 -- (-888.531) [-889.537] (-889.775) (-890.412) * [-893.240] (-892.837) (-894.746) (-889.731) -- 0:01:28
375000 -- (-898.435) (-888.947) (-889.693) [-889.031] * (-894.002) (-890.817) [-888.509] (-896.506) -- 0:01:28
Average standard deviation of split frequencies: 0.005015
375500 -- (-889.252) [-891.619] (-895.708) (-890.795) * (-900.464) [-896.137] (-891.592) (-895.199) -- 0:01:28
376000 -- (-895.014) (-895.522) (-889.322) [-895.266] * [-890.375] (-899.520) (-890.163) (-897.737) -- 0:01:27
376500 -- (-892.571) [-892.161] (-896.848) (-893.611) * (-893.894) (-895.442) [-890.653] (-891.491) -- 0:01:27
377000 -- (-897.381) (-890.022) [-892.223] (-896.433) * (-893.557) [-892.597] (-890.631) (-890.737) -- 0:01:27
377500 -- (-892.017) [-891.407] (-892.454) (-891.195) * [-891.732] (-891.761) (-895.150) (-891.271) -- 0:01:27
378000 -- [-889.844] (-894.130) (-893.581) (-887.987) * (-892.702) [-890.785] (-889.069) (-889.699) -- 0:01:28
378500 -- (-892.386) (-893.075) [-897.210] (-894.969) * (-893.982) (-889.950) (-888.410) [-893.513] -- 0:01:28
379000 -- (-890.154) [-892.784] (-889.029) (-892.169) * (-892.295) (-891.135) [-889.114] (-894.349) -- 0:01:28
379500 -- (-889.338) [-891.763] (-894.220) (-891.415) * (-889.190) (-889.252) (-891.571) [-891.222] -- 0:01:28
380000 -- (-895.667) (-892.486) (-890.868) [-892.971] * (-890.923) (-890.769) (-893.426) [-891.703] -- 0:01:28
Average standard deviation of split frequencies: 0.003715
380500 -- [-891.563] (-892.437) (-892.312) (-891.005) * [-894.574] (-889.895) (-891.184) (-890.027) -- 0:01:27
381000 -- (-891.583) (-888.260) (-890.022) [-895.203] * (-894.547) (-892.749) (-891.514) [-886.779] -- 0:01:27
381500 -- (-889.166) [-889.839] (-892.205) (-887.796) * (-900.506) [-892.988] (-890.657) (-892.616) -- 0:01:27
382000 -- (-890.499) (-892.494) [-891.979] (-892.763) * (-894.208) [-890.053] (-892.487) (-898.480) -- 0:01:27
382500 -- (-889.668) (-888.694) [-890.450] (-895.711) * (-894.257) (-892.479) (-895.580) [-897.103] -- 0:01:27
383000 -- [-893.145] (-890.676) (-899.385) (-892.333) * [-894.191] (-893.894) (-889.968) (-891.366) -- 0:01:26
383500 -- (-893.818) (-888.647) [-894.686] (-896.087) * (-890.143) (-891.319) [-894.491] (-894.060) -- 0:01:26
384000 -- [-890.565] (-891.119) (-887.320) (-899.131) * [-888.743] (-896.502) (-891.517) (-893.304) -- 0:01:26
384500 -- (-895.612) [-891.044] (-889.710) (-890.891) * (-890.548) (-894.467) (-890.282) [-892.791] -- 0:01:26
385000 -- (-896.148) (-895.919) [-887.559] (-889.927) * [-889.544] (-897.183) (-893.981) (-892.703) -- 0:01:27
Average standard deviation of split frequencies: 0.003664
385500 -- (-893.035) [-892.891] (-886.935) (-889.681) * (-892.664) (-891.942) [-890.670] (-890.936) -- 0:01:27
386000 -- (-896.921) (-894.305) [-890.473] (-895.864) * [-889.232] (-893.427) (-897.990) (-896.173) -- 0:01:27
386500 -- [-891.298] (-887.894) (-893.387) (-892.349) * (-892.472) (-889.518) [-895.150] (-889.445) -- 0:01:27
387000 -- (-893.386) [-894.760] (-894.576) (-893.996) * [-889.148] (-891.262) (-893.056) (-892.605) -- 0:01:27
387500 -- (-887.639) (-896.346) [-892.067] (-892.298) * [-892.308] (-892.730) (-895.338) (-891.179) -- 0:01:26
388000 -- (-889.488) (-897.022) [-893.893] (-896.227) * (-889.746) (-889.941) [-893.092] (-894.107) -- 0:01:26
388500 -- (-889.568) (-888.505) [-901.149] (-895.216) * [-891.903] (-889.725) (-890.957) (-893.453) -- 0:01:26
389000 -- (-896.548) [-889.726] (-891.847) (-892.251) * (-896.236) (-892.196) (-890.411) [-890.204] -- 0:01:26
389500 -- (-890.626) (-895.000) [-891.644] (-889.972) * (-901.229) (-895.184) (-895.655) [-888.853] -- 0:01:26
390000 -- (-887.572) (-891.584) (-896.673) [-889.865] * (-898.380) [-892.446] (-892.204) (-891.999) -- 0:01:26
Average standard deviation of split frequencies: 0.003620
390500 -- (-897.631) (-893.269) [-892.794] (-893.818) * (-900.673) [-892.338] (-894.944) (-891.567) -- 0:01:25
391000 -- (-896.968) (-890.965) [-896.118] (-895.951) * (-897.824) [-889.687] (-889.205) (-890.805) -- 0:01:25
391500 -- (-893.550) (-887.470) [-889.720] (-888.139) * (-898.129) [-890.247] (-889.147) (-893.197) -- 0:01:25
392000 -- (-893.043) (-890.428) [-900.794] (-896.712) * (-892.272) (-893.229) [-888.882] (-891.116) -- 0:01:26
392500 -- (-900.065) [-890.953] (-895.579) (-894.060) * (-899.849) (-890.714) (-890.951) [-891.105] -- 0:01:26
393000 -- (-899.250) (-894.662) (-892.140) [-892.890] * (-898.702) (-895.545) [-893.410] (-892.710) -- 0:01:26
393500 -- (-889.683) (-898.325) [-893.459] (-892.274) * (-900.414) (-894.867) [-893.915] (-887.207) -- 0:01:26
394000 -- (-890.850) [-896.424] (-894.111) (-896.733) * (-902.037) (-894.449) (-898.201) [-891.817] -- 0:01:26
394500 -- (-891.107) [-889.267] (-897.932) (-891.381) * (-891.821) (-892.350) (-890.078) [-890.172] -- 0:01:25
395000 -- (-894.461) (-890.336) (-894.173) [-888.426] * (-894.003) [-900.606] (-893.308) (-888.947) -- 0:01:25
Average standard deviation of split frequencies: 0.004762
395500 -- (-893.316) (-890.265) [-888.601] (-891.942) * [-900.063] (-894.694) (-897.732) (-887.188) -- 0:01:25
396000 -- (-895.461) (-892.526) [-890.617] (-894.688) * [-894.962] (-897.092) (-900.199) (-892.593) -- 0:01:25
396500 -- [-890.392] (-895.355) (-887.324) (-894.602) * (-889.428) [-897.248] (-898.505) (-894.269) -- 0:01:25
397000 -- (-891.259) (-889.614) [-887.543] (-898.338) * [-890.074] (-892.035) (-891.574) (-890.235) -- 0:01:25
397500 -- [-892.156] (-892.866) (-889.840) (-895.549) * (-891.071) (-892.585) (-891.619) [-888.769] -- 0:01:24
398000 -- [-890.122] (-897.435) (-892.221) (-898.195) * [-892.451] (-891.586) (-892.898) (-901.866) -- 0:01:24
398500 -- (-890.344) (-896.057) [-887.730] (-900.290) * (-890.624) (-890.930) (-895.170) [-894.736] -- 0:01:24
399000 -- (-887.719) (-894.744) [-892.590] (-897.044) * (-890.186) [-891.687] (-894.337) (-889.800) -- 0:01:25
399500 -- [-893.011] (-892.670) (-890.362) (-898.506) * (-891.678) [-888.484] (-892.084) (-892.099) -- 0:01:25
400000 -- (-893.736) (-888.355) [-895.147] (-896.098) * (-893.723) (-894.628) [-891.626] (-890.511) -- 0:01:25
Average standard deviation of split frequencies: 0.003530
400500 -- [-890.508] (-894.483) (-895.116) (-890.497) * [-891.105] (-893.157) (-892.189) (-894.758) -- 0:01:25
401000 -- (-887.068) (-891.089) (-892.943) [-890.326] * [-892.788] (-893.811) (-894.978) (-889.643) -- 0:01:25
401500 -- (-893.572) [-889.264] (-892.373) (-899.134) * (-892.027) (-892.561) [-894.015] (-891.804) -- 0:01:24
402000 -- [-888.006] (-889.755) (-893.814) (-890.107) * [-889.492] (-891.477) (-892.262) (-895.370) -- 0:01:24
402500 -- (-891.111) (-892.395) (-893.236) [-889.432] * [-890.769] (-890.600) (-892.286) (-890.680) -- 0:01:24
403000 -- (-895.717) [-889.247] (-890.461) (-889.504) * (-899.017) (-899.520) (-891.288) [-888.358] -- 0:01:24
403500 -- (-893.663) [-887.528] (-890.737) (-894.062) * (-889.453) [-890.025] (-892.848) (-890.665) -- 0:01:24
404000 -- (-890.453) [-891.414] (-890.508) (-892.043) * (-890.957) (-895.012) (-892.109) [-888.964] -- 0:01:24
404500 -- (-890.812) [-890.107] (-893.483) (-893.361) * (-898.308) [-887.994] (-890.686) (-890.684) -- 0:01:23
405000 -- (-893.168) [-892.574] (-892.982) (-888.728) * (-892.945) [-888.653] (-890.489) (-889.806) -- 0:01:23
Average standard deviation of split frequencies: 0.003483
405500 -- (-892.674) (-892.855) [-896.910] (-897.834) * (-893.819) (-888.976) (-893.347) [-891.047] -- 0:01:23
406000 -- (-893.344) (-891.104) (-891.360) [-892.054] * [-894.074] (-892.730) (-893.844) (-894.382) -- 0:01:24
406500 -- (-898.971) (-889.320) [-889.195] (-894.192) * (-892.900) (-889.957) [-894.476] (-899.085) -- 0:01:24
407000 -- [-895.561] (-895.841) (-888.885) (-892.918) * (-892.617) (-889.800) [-893.197] (-897.680) -- 0:01:24
407500 -- (-892.812) (-898.451) [-889.761] (-889.375) * [-889.773] (-891.693) (-890.007) (-890.987) -- 0:01:24
408000 -- (-892.103) (-897.935) (-889.746) [-888.589] * (-892.043) (-892.716) (-890.988) [-889.574] -- 0:01:24
408500 -- (-889.338) (-893.359) [-893.572] (-891.313) * (-893.626) [-889.095] (-891.875) (-890.323) -- 0:01:23
409000 -- (-889.369) (-889.692) [-887.652] (-891.121) * [-895.082] (-895.945) (-893.248) (-892.510) -- 0:01:23
409500 -- [-889.932] (-890.297) (-888.161) (-889.102) * (-892.165) (-891.392) [-892.998] (-887.367) -- 0:01:23
410000 -- (-888.548) (-893.129) [-889.401] (-892.953) * (-889.849) (-895.023) (-888.298) [-890.423] -- 0:01:23
Average standard deviation of split frequencies: 0.003444
410500 -- (-889.234) [-890.284] (-893.777) (-890.279) * (-891.260) (-894.327) (-890.483) [-898.089] -- 0:01:23
411000 -- (-890.630) (-890.075) [-891.141] (-897.461) * (-895.431) (-887.102) [-893.257] (-893.321) -- 0:01:23
411500 -- (-890.738) (-889.474) [-890.110] (-891.566) * (-891.738) (-896.696) [-894.133] (-893.234) -- 0:01:22
412000 -- (-891.052) (-894.506) (-888.319) [-889.958] * (-892.576) [-894.111] (-897.344) (-896.715) -- 0:01:22
412500 -- [-892.516] (-889.125) (-891.795) (-891.186) * (-895.104) [-890.739] (-895.899) (-892.698) -- 0:01:22
413000 -- (-893.303) [-891.279] (-890.343) (-890.891) * (-892.155) [-890.959] (-889.672) (-891.482) -- 0:01:23
413500 -- (-892.551) [-889.289] (-888.236) (-896.078) * [-896.769] (-891.225) (-892.760) (-894.187) -- 0:01:23
414000 -- (-894.386) [-888.357] (-890.776) (-893.004) * [-900.161] (-890.284) (-898.646) (-894.054) -- 0:01:23
414500 -- (-896.060) (-894.354) [-893.813] (-894.789) * (-891.671) [-893.410] (-893.328) (-903.155) -- 0:01:23
415000 -- (-892.678) (-891.675) (-892.014) [-893.341] * [-889.273] (-897.328) (-890.246) (-899.968) -- 0:01:23
Average standard deviation of split frequencies: 0.001133
415500 -- (-893.748) [-891.160] (-894.287) (-890.373) * (-892.682) (-891.175) (-893.455) [-892.306] -- 0:01:22
416000 -- (-890.539) [-887.992] (-898.663) (-890.720) * (-888.667) (-891.820) (-890.762) [-896.050] -- 0:01:22
416500 -- (-894.010) (-892.643) (-898.008) [-901.358] * (-896.931) (-897.455) (-894.135) [-894.460] -- 0:01:22
417000 -- (-894.330) (-896.224) [-895.178] (-895.750) * (-891.658) (-894.754) (-897.073) [-896.379] -- 0:01:22
417500 -- (-890.938) [-891.098] (-894.417) (-895.543) * [-891.729] (-892.056) (-896.279) (-891.287) -- 0:01:22
418000 -- (-890.840) (-893.188) (-892.821) [-890.215] * (-896.114) [-890.617] (-902.043) (-895.698) -- 0:01:22
418500 -- (-897.126) (-891.531) [-891.760] (-891.126) * (-897.974) (-890.065) (-895.649) [-887.920] -- 0:01:21
419000 -- (-898.554) (-897.218) [-891.275] (-890.579) * (-895.464) [-889.870] (-893.049) (-891.263) -- 0:01:21
419500 -- (-897.204) (-895.771) (-891.999) [-889.412] * (-898.083) [-898.962] (-894.366) (-893.446) -- 0:01:21
420000 -- (-897.513) [-890.897] (-893.679) (-893.290) * (-895.636) (-895.451) [-890.152] (-890.799) -- 0:01:22
Average standard deviation of split frequencies: 0.001121
420500 -- (-893.141) (-893.841) (-892.241) [-891.018] * [-891.494] (-890.741) (-889.943) (-890.079) -- 0:01:22
421000 -- (-890.981) (-888.505) [-892.226] (-894.282) * (-891.979) [-892.502] (-891.079) (-891.393) -- 0:01:22
421500 -- (-893.473) (-891.030) (-890.400) [-890.657] * (-894.036) [-890.012] (-888.983) (-893.266) -- 0:01:22
422000 -- (-889.864) (-888.093) [-891.572] (-899.372) * (-891.536) (-888.438) [-890.420] (-895.925) -- 0:01:22
422500 -- (-893.263) [-892.291] (-894.007) (-899.798) * (-893.200) [-890.529] (-890.865) (-893.378) -- 0:01:22
423000 -- (-895.256) (-890.112) (-889.055) [-891.816] * (-893.621) (-892.510) [-894.544] (-891.945) -- 0:01:21
423500 -- (-892.274) [-889.874] (-894.725) (-888.733) * [-892.757] (-894.453) (-890.547) (-892.228) -- 0:01:21
424000 -- (-890.887) (-898.521) [-897.241] (-888.801) * (-891.272) [-891.098] (-891.704) (-891.213) -- 0:01:21
424500 -- (-893.441) (-888.855) (-891.755) [-890.019] * (-888.135) (-897.481) [-892.536] (-888.213) -- 0:01:21
425000 -- (-891.097) (-890.325) [-892.996] (-891.596) * (-890.140) (-893.044) [-895.415] (-896.691) -- 0:01:21
Average standard deviation of split frequencies: 0.001107
425500 -- [-893.120] (-889.665) (-893.894) (-904.458) * (-890.142) [-895.831] (-893.022) (-891.793) -- 0:01:21
426000 -- (-888.311) (-891.156) [-889.387] (-896.051) * (-892.193) [-895.262] (-890.695) (-890.551) -- 0:01:20
426500 -- (-892.079) (-891.417) (-890.210) [-891.470] * (-895.170) (-889.843) (-895.279) [-892.901] -- 0:01:20
427000 -- (-889.233) (-891.983) (-891.101) [-890.539] * [-891.789] (-890.896) (-892.527) (-893.606) -- 0:01:21
427500 -- (-894.805) [-893.794] (-890.345) (-894.641) * (-892.631) (-891.787) (-894.356) [-887.847] -- 0:01:21
428000 -- (-896.192) [-889.290] (-898.880) (-890.971) * (-891.585) (-889.925) [-890.441] (-889.081) -- 0:01:21
428500 -- (-892.212) (-891.188) (-899.203) [-889.458] * (-893.523) (-894.137) (-891.016) [-891.005] -- 0:01:21
429000 -- [-892.785] (-892.299) (-894.106) (-890.290) * (-892.934) (-896.624) (-896.253) [-889.127] -- 0:01:21
429500 -- (-890.415) (-894.957) (-900.151) [-889.543] * (-891.847) [-893.379] (-890.273) (-889.113) -- 0:01:21
430000 -- (-892.787) (-892.962) [-893.113] (-894.998) * (-889.067) [-890.163] (-886.826) (-893.100) -- 0:01:20
Average standard deviation of split frequencies: 0.001095
430500 -- (-889.270) [-890.685] (-891.199) (-890.926) * (-893.138) [-892.399] (-891.395) (-896.185) -- 0:01:20
431000 -- (-895.917) (-893.021) (-890.436) [-891.373] * (-895.502) [-889.371] (-890.817) (-888.536) -- 0:01:20
431500 -- (-894.339) (-897.093) [-887.504] (-890.190) * (-891.198) [-891.510] (-896.343) (-890.419) -- 0:01:20
432000 -- (-894.544) (-897.734) [-892.274] (-893.907) * (-893.778) (-891.128) (-889.258) [-888.192] -- 0:01:20
432500 -- (-889.915) (-900.620) (-896.840) [-889.836] * (-889.340) [-893.961] (-891.013) (-889.790) -- 0:01:20
433000 -- (-893.903) [-893.354] (-892.695) (-890.809) * [-893.661] (-889.926) (-891.681) (-891.177) -- 0:01:19
433500 -- (-899.622) (-899.207) [-889.337] (-891.689) * (-895.968) [-887.617] (-892.223) (-887.385) -- 0:01:19
434000 -- [-891.158] (-898.901) (-892.387) (-892.561) * (-894.976) (-892.744) [-892.611] (-890.300) -- 0:01:20
434500 -- (-894.670) (-898.614) [-887.981] (-893.812) * [-892.088] (-888.806) (-894.205) (-896.447) -- 0:01:20
435000 -- (-893.683) (-900.308) (-894.746) [-891.374] * (-895.229) (-890.589) (-892.163) [-889.837] -- 0:01:20
Average standard deviation of split frequencies: 0.002162
435500 -- (-888.016) (-890.630) (-894.590) [-890.285] * (-896.073) (-894.731) [-889.621] (-892.925) -- 0:01:20
436000 -- (-892.059) (-892.318) (-900.428) [-893.117] * (-895.409) [-894.074] (-892.152) (-889.203) -- 0:01:20
436500 -- [-891.430] (-894.458) (-893.289) (-887.181) * (-893.293) (-889.115) (-894.300) [-891.813] -- 0:01:20
437000 -- [-890.605] (-889.255) (-893.742) (-886.254) * (-895.886) [-890.957] (-889.553) (-891.873) -- 0:01:19
437500 -- (-888.110) (-889.655) (-887.787) [-887.407] * [-896.594] (-893.010) (-889.555) (-892.810) -- 0:01:19
438000 -- (-891.830) (-896.325) [-892.551] (-892.050) * (-889.187) (-895.198) [-889.195] (-889.112) -- 0:01:19
438500 -- (-891.553) (-889.353) (-887.655) [-888.438] * [-893.526] (-894.582) (-890.418) (-889.771) -- 0:01:19
439000 -- [-890.471] (-895.338) (-891.613) (-898.117) * (-891.200) [-891.474] (-895.300) (-891.557) -- 0:01:19
439500 -- (-893.574) (-890.292) [-889.494] (-892.170) * (-891.598) [-894.069] (-889.748) (-891.677) -- 0:01:19
440000 -- (-895.596) (-891.144) (-892.664) [-889.967] * [-891.577] (-892.459) (-891.791) (-893.115) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
440500 -- [-887.874] (-892.385) (-893.163) (-889.819) * (-889.497) (-890.138) [-892.782] (-893.501) -- 0:01:18
441000 -- (-895.766) [-899.948] (-892.246) (-892.898) * (-890.149) [-893.042] (-898.961) (-889.398) -- 0:01:18
441500 -- (-894.902) (-895.848) [-892.132] (-897.218) * [-887.814] (-892.030) (-894.892) (-894.028) -- 0:01:19
442000 -- (-890.634) (-894.693) (-894.668) [-892.867] * (-890.495) (-894.126) [-888.593] (-889.017) -- 0:01:19
442500 -- (-893.109) (-897.255) [-891.143] (-897.388) * [-890.391] (-889.379) (-889.675) (-896.795) -- 0:01:19
443000 -- [-896.748] (-893.157) (-890.995) (-895.008) * (-891.386) (-900.509) (-893.711) [-892.750] -- 0:01:19
443500 -- (-898.459) (-893.174) [-893.868] (-894.990) * [-890.352] (-901.532) (-893.873) (-886.916) -- 0:01:19
444000 -- (-893.431) (-896.183) [-890.166] (-893.194) * (-890.904) (-894.947) (-891.870) [-889.854] -- 0:01:18
444500 -- (-895.528) [-896.329] (-890.924) (-891.872) * (-894.191) [-892.416] (-891.889) (-895.501) -- 0:01:18
445000 -- (-892.860) (-893.633) (-891.758) [-891.909] * (-889.414) [-892.735] (-894.759) (-889.258) -- 0:01:18
Average standard deviation of split frequencies: 0.001057
445500 -- (-894.079) (-895.567) [-888.713] (-887.676) * (-896.183) [-891.529] (-896.610) (-891.668) -- 0:01:18
446000 -- [-891.994] (-894.656) (-890.929) (-889.383) * (-891.351) (-893.517) (-892.214) [-892.363] -- 0:01:18
446500 -- (-899.580) [-897.009] (-890.865) (-890.149) * (-894.389) (-893.493) (-894.414) [-891.924] -- 0:01:18
447000 -- (-895.485) [-889.802] (-889.279) (-897.862) * (-890.816) (-893.435) (-892.391) [-897.676] -- 0:01:17
447500 -- (-892.726) (-889.160) [-892.904] (-894.203) * (-893.483) (-889.038) (-896.967) [-896.656] -- 0:01:17
448000 -- (-891.868) (-893.042) [-894.221] (-891.401) * [-890.786] (-888.197) (-892.082) (-899.638) -- 0:01:17
448500 -- (-891.660) (-894.102) [-891.459] (-895.855) * (-895.144) (-892.102) [-889.807] (-892.295) -- 0:01:18
449000 -- [-890.465] (-898.337) (-898.777) (-893.296) * (-889.878) [-892.164] (-888.635) (-897.942) -- 0:01:18
449500 -- (-893.793) (-894.076) (-895.175) [-890.252] * (-892.998) (-893.413) [-893.307] (-895.739) -- 0:01:18
450000 -- (-889.725) (-896.663) (-890.884) [-890.339] * [-897.997] (-888.245) (-888.978) (-889.262) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
450500 -- [-889.150] (-892.654) (-888.526) (-893.642) * (-892.895) (-888.619) [-894.288] (-890.899) -- 0:01:18
451000 -- (-893.412) (-890.729) (-891.650) [-890.001] * (-893.328) (-893.842) (-895.085) [-890.213] -- 0:01:17
451500 -- (-891.706) (-887.820) (-889.553) [-886.462] * (-892.151) [-893.130] (-890.997) (-897.136) -- 0:01:17
452000 -- (-889.105) (-894.052) [-892.011] (-890.336) * (-891.869) [-892.263] (-888.448) (-893.398) -- 0:01:17
452500 -- (-893.844) (-890.349) [-893.901] (-891.512) * [-891.089] (-894.276) (-890.462) (-901.888) -- 0:01:17
453000 -- (-893.595) (-893.661) (-891.118) [-890.503] * (-889.060) (-893.593) [-892.204] (-898.827) -- 0:01:17
453500 -- (-891.480) [-889.315] (-896.345) (-889.369) * (-888.764) [-891.287] (-888.773) (-896.572) -- 0:01:17
454000 -- (-894.916) [-894.439] (-898.103) (-889.662) * (-891.336) (-891.440) (-891.105) [-892.801] -- 0:01:16
454500 -- [-892.437] (-897.210) (-895.322) (-892.611) * (-895.019) (-894.418) (-891.680) [-894.011] -- 0:01:16
455000 -- (-891.771) (-891.859) (-894.551) [-890.922] * (-893.772) (-891.795) (-895.276) [-889.661] -- 0:01:17
Average standard deviation of split frequencies: 0.002068
455500 -- (-892.816) [-892.652] (-888.627) (-897.163) * (-890.446) [-891.541] (-897.329) (-897.330) -- 0:01:17
456000 -- [-895.359] (-891.090) (-892.955) (-902.499) * (-892.028) [-889.423] (-897.186) (-897.315) -- 0:01:17
456500 -- (-894.722) (-890.971) [-889.385] (-893.170) * (-890.104) (-890.483) [-893.059] (-888.020) -- 0:01:17
457000 -- (-894.542) (-888.093) (-891.542) [-889.410] * [-894.835] (-900.350) (-890.520) (-891.031) -- 0:01:17
457500 -- (-892.096) [-890.562] (-897.646) (-888.946) * (-890.154) (-893.780) [-894.912] (-894.768) -- 0:01:17
458000 -- (-891.923) [-890.598] (-894.239) (-896.205) * [-890.489] (-894.634) (-890.706) (-893.040) -- 0:01:16
458500 -- (-895.508) (-891.419) [-892.610] (-900.055) * (-894.199) [-891.282] (-892.015) (-891.491) -- 0:01:16
459000 -- (-892.324) (-894.981) [-890.588] (-887.014) * [-893.360] (-896.529) (-891.317) (-891.382) -- 0:01:16
459500 -- (-890.767) (-891.010) [-890.301] (-894.742) * (-897.467) [-893.646] (-892.751) (-902.189) -- 0:01:16
460000 -- (-895.297) [-892.041] (-891.852) (-893.298) * [-890.388] (-889.534) (-890.877) (-896.217) -- 0:01:16
Average standard deviation of split frequencies: 0.001023
460500 -- (-892.275) [-896.341] (-892.952) (-893.592) * (-895.518) (-895.007) [-892.037] (-893.031) -- 0:01:16
461000 -- [-889.812] (-888.682) (-896.255) (-896.347) * (-896.954) (-902.061) [-888.705] (-896.999) -- 0:01:15
461500 -- [-900.412] (-888.556) (-893.312) (-890.735) * [-893.330] (-894.587) (-889.988) (-893.271) -- 0:01:15
462000 -- (-888.727) [-888.898] (-895.564) (-895.378) * (-889.432) (-893.739) (-895.580) [-896.299] -- 0:01:15
462500 -- (-891.738) (-892.667) [-890.611] (-891.023) * [-889.173] (-897.754) (-890.835) (-895.869) -- 0:01:16
463000 -- (-892.356) [-893.800] (-893.121) (-894.649) * (-886.058) (-893.594) [-893.006] (-895.625) -- 0:01:16
463500 -- [-891.025] (-899.233) (-891.132) (-893.285) * (-900.240) (-892.834) [-891.357] (-892.684) -- 0:01:16
464000 -- (-895.075) (-894.117) (-892.877) [-888.780] * [-896.197] (-893.643) (-893.381) (-893.792) -- 0:01:16
464500 -- (-893.980) (-893.969) [-891.648] (-888.793) * [-890.743] (-894.898) (-893.772) (-898.812) -- 0:01:16
465000 -- [-891.562] (-893.156) (-894.531) (-889.831) * [-889.493] (-890.146) (-890.439) (-898.443) -- 0:01:15
Average standard deviation of split frequencies: 0.001012
465500 -- [-891.458] (-896.597) (-892.101) (-889.921) * (-889.899) [-892.216] (-892.338) (-895.704) -- 0:01:15
466000 -- (-892.028) [-890.268] (-891.873) (-893.307) * (-890.090) (-892.151) [-893.872] (-894.554) -- 0:01:15
466500 -- (-891.874) [-893.300] (-899.270) (-896.124) * [-891.587] (-891.356) (-895.890) (-892.471) -- 0:01:15
467000 -- [-893.316] (-892.955) (-889.567) (-894.491) * [-889.043] (-889.046) (-891.468) (-893.242) -- 0:01:15
467500 -- (-889.885) (-891.080) (-899.794) [-896.123] * [-900.213] (-889.322) (-889.399) (-892.250) -- 0:01:15
468000 -- [-888.539] (-892.315) (-890.864) (-892.411) * (-895.667) [-892.870] (-889.125) (-896.835) -- 0:01:15
468500 -- [-888.441] (-893.657) (-893.743) (-893.497) * (-889.230) (-893.013) (-889.928) [-892.932] -- 0:01:14
469000 -- (-890.778) (-893.063) [-891.843] (-893.381) * (-888.519) (-896.471) (-893.327) [-893.622] -- 0:01:14
469500 -- (-888.866) (-892.859) [-889.647] (-888.680) * (-892.274) (-892.937) (-890.847) [-887.258] -- 0:01:15
470000 -- (-893.520) [-893.201] (-888.690) (-887.699) * (-892.103) [-890.580] (-889.555) (-899.215) -- 0:01:15
Average standard deviation of split frequencies: 0.001002
470500 -- [-890.205] (-891.627) (-894.771) (-889.686) * (-894.890) [-895.260] (-895.044) (-890.894) -- 0:01:15
471000 -- [-891.741] (-894.303) (-891.723) (-893.521) * [-890.518] (-892.061) (-892.346) (-892.108) -- 0:01:15
471500 -- (-891.801) (-891.337) (-894.953) [-893.764] * (-894.627) [-894.325] (-890.228) (-895.243) -- 0:01:15
472000 -- [-891.620] (-897.259) (-893.628) (-896.411) * [-895.083] (-889.054) (-892.021) (-899.504) -- 0:01:14
472500 -- (-901.744) (-893.579) (-892.604) [-893.352] * (-889.675) [-892.698] (-894.351) (-893.677) -- 0:01:14
473000 -- (-892.006) (-892.664) (-887.868) [-898.507] * (-891.921) (-899.978) (-890.246) [-892.524] -- 0:01:14
473500 -- [-891.881] (-895.481) (-894.472) (-896.572) * (-889.496) (-894.750) (-893.122) [-889.311] -- 0:01:14
474000 -- (-889.504) [-887.966] (-894.070) (-895.245) * [-890.591] (-891.356) (-890.225) (-891.510) -- 0:01:14
474500 -- (-895.563) (-894.295) (-898.321) [-899.580] * [-897.430] (-891.491) (-898.573) (-888.687) -- 0:01:14
475000 -- (-893.830) (-890.572) (-894.302) [-891.120] * (-897.731) (-892.650) (-892.406) [-889.513] -- 0:01:14
Average standard deviation of split frequencies: 0.000990
475500 -- [-891.611] (-890.333) (-891.972) (-891.053) * [-894.091] (-890.364) (-894.395) (-897.430) -- 0:01:13
476000 -- (-892.091) [-890.107] (-892.762) (-889.916) * (-890.813) (-890.103) [-890.801] (-903.119) -- 0:01:13
476500 -- [-888.744] (-890.273) (-889.229) (-892.693) * (-899.864) (-891.193) [-893.253] (-888.542) -- 0:01:14
477000 -- (-895.443) (-888.386) [-889.052] (-893.260) * (-891.930) (-890.256) [-891.468] (-890.277) -- 0:01:14
477500 -- (-892.689) [-893.522] (-893.357) (-887.848) * (-893.386) [-893.384] (-892.477) (-891.979) -- 0:01:14
478000 -- (-888.060) (-890.334) [-889.591] (-891.303) * [-893.818] (-890.080) (-890.575) (-894.973) -- 0:01:14
478500 -- [-892.110] (-894.061) (-891.910) (-894.816) * (-900.310) (-892.053) [-891.546] (-895.084) -- 0:01:14
479000 -- [-893.284] (-895.129) (-892.691) (-891.052) * (-897.457) [-891.539] (-890.444) (-891.358) -- 0:01:13
479500 -- [-894.694] (-887.953) (-891.811) (-894.249) * (-893.468) (-891.642) [-895.106] (-891.110) -- 0:01:13
480000 -- [-890.032] (-891.584) (-891.752) (-892.156) * (-892.204) [-888.718] (-891.382) (-892.014) -- 0:01:13
Average standard deviation of split frequencies: 0.000981
480500 -- (-895.964) (-889.572) (-896.996) [-892.518] * (-888.185) [-892.639] (-899.137) (-894.986) -- 0:01:13
481000 -- (-894.358) (-893.577) [-890.292] (-890.603) * [-890.333] (-891.098) (-901.345) (-889.841) -- 0:01:13
481500 -- [-887.717] (-894.669) (-889.524) (-893.624) * [-893.575] (-888.510) (-890.439) (-896.470) -- 0:01:13
482000 -- (-893.993) [-889.490] (-890.058) (-895.443) * [-889.683] (-892.369) (-891.657) (-895.386) -- 0:01:13
482500 -- (-892.744) [-888.704] (-894.795) (-890.257) * [-892.018] (-892.764) (-890.245) (-892.715) -- 0:01:12
483000 -- (-889.881) [-890.710] (-893.253) (-896.811) * [-890.474] (-891.376) (-894.108) (-887.469) -- 0:01:12
483500 -- (-894.546) (-889.957) [-891.307] (-893.700) * (-892.901) [-890.168] (-897.745) (-889.274) -- 0:01:13
484000 -- (-888.820) [-890.887] (-892.261) (-887.877) * [-892.524] (-890.273) (-895.712) (-893.412) -- 0:01:13
484500 -- (-896.952) (-891.836) (-892.151) [-889.955] * (-891.060) [-888.914] (-895.697) (-890.299) -- 0:01:13
485000 -- (-891.075) [-890.625] (-895.076) (-889.019) * [-893.033] (-889.905) (-892.081) (-890.602) -- 0:01:13
Average standard deviation of split frequencies: 0.000970
485500 -- (-889.992) (-893.819) (-891.300) [-892.139] * (-889.275) (-892.838) (-890.811) [-889.336] -- 0:01:13
486000 -- [-893.474] (-889.915) (-898.904) (-890.156) * (-894.707) [-891.003] (-892.556) (-892.159) -- 0:01:12
486500 -- (-893.182) (-895.388) (-891.082) [-894.290] * (-893.853) (-891.670) (-896.287) [-890.393] -- 0:01:12
487000 -- (-891.645) (-891.552) [-893.755] (-889.685) * [-892.035] (-896.062) (-890.785) (-891.735) -- 0:01:12
487500 -- (-891.073) (-889.633) (-896.687) [-891.923] * (-890.233) (-893.595) (-891.419) [-894.745] -- 0:01:12
488000 -- [-888.110] (-902.520) (-901.654) (-893.363) * (-892.529) (-894.384) (-890.136) [-892.381] -- 0:01:12
488500 -- (-894.277) (-897.909) (-896.533) [-889.555] * (-889.786) [-894.054] (-888.479) (-889.760) -- 0:01:12
489000 -- [-889.087] (-891.173) (-892.635) (-892.030) * (-892.591) (-890.160) (-889.932) [-891.182] -- 0:01:12
489500 -- [-888.457] (-895.257) (-888.785) (-890.269) * (-888.956) (-890.819) [-888.250] (-902.414) -- 0:01:11
490000 -- [-890.658] (-897.768) (-897.209) (-893.250) * (-898.425) (-894.168) (-895.062) [-899.736] -- 0:01:11
Average standard deviation of split frequencies: 0.000961
490500 -- [-891.590] (-894.255) (-889.973) (-889.417) * (-896.348) [-890.714] (-897.970) (-888.584) -- 0:01:12
491000 -- [-889.335] (-890.837) (-888.836) (-892.192) * [-890.690] (-890.081) (-892.838) (-894.482) -- 0:01:12
491500 -- [-887.089] (-892.987) (-891.494) (-891.318) * [-894.081] (-899.113) (-886.944) (-888.724) -- 0:01:12
492000 -- (-893.240) [-890.753] (-892.366) (-897.128) * [-890.812] (-888.937) (-892.588) (-891.882) -- 0:01:12
492500 -- (-890.794) [-891.893] (-891.165) (-894.232) * (-887.402) [-891.355] (-891.220) (-895.131) -- 0:01:12
493000 -- (-889.028) (-897.231) [-891.179] (-896.337) * (-893.748) [-888.957] (-895.250) (-892.397) -- 0:01:11
493500 -- (-888.019) [-895.780] (-896.503) (-891.143) * (-888.875) [-891.863] (-898.412) (-893.977) -- 0:01:11
494000 -- [-893.492] (-888.410) (-893.162) (-889.307) * (-889.994) [-890.340] (-894.870) (-896.918) -- 0:01:11
494500 -- [-889.102] (-894.875) (-892.621) (-891.536) * (-889.293) [-890.462] (-903.406) (-888.946) -- 0:01:11
495000 -- (-892.861) (-887.186) (-895.025) [-888.439] * (-891.046) [-893.529] (-897.956) (-892.472) -- 0:01:11
Average standard deviation of split frequencies: 0.001901
495500 -- (-897.937) (-893.606) (-889.477) [-891.817] * [-892.994] (-895.033) (-898.390) (-890.300) -- 0:01:11
496000 -- (-894.366) (-889.547) [-891.039] (-895.442) * [-890.242] (-896.655) (-895.847) (-891.829) -- 0:01:11
496500 -- (-892.660) [-891.155] (-890.027) (-896.030) * (-894.925) (-891.993) (-892.775) [-888.048] -- 0:01:10
497000 -- [-892.665] (-896.467) (-899.552) (-887.716) * (-895.529) [-891.371] (-890.953) (-893.489) -- 0:01:10
497500 -- (-889.339) (-891.218) [-894.319] (-894.942) * [-892.918] (-893.718) (-891.157) (-891.876) -- 0:01:11
498000 -- [-889.564] (-892.971) (-896.353) (-893.650) * (-892.246) [-893.719] (-894.752) (-893.252) -- 0:01:11
498500 -- [-890.273] (-891.990) (-889.511) (-892.389) * (-890.489) (-888.650) (-898.774) [-890.814] -- 0:01:11
499000 -- (-889.641) [-888.012] (-899.315) (-891.545) * [-891.983] (-893.260) (-891.738) (-893.712) -- 0:01:11
499500 -- [-894.649] (-890.330) (-891.634) (-891.137) * [-889.978] (-889.880) (-889.747) (-896.580) -- 0:01:11
500000 -- [-893.676] (-890.865) (-896.682) (-893.473) * [-890.048] (-895.159) (-890.953) (-891.399) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
500500 -- (-893.018) [-890.304] (-894.835) (-902.150) * (-900.128) [-891.273] (-892.292) (-891.810) -- 0:01:10
501000 -- (-897.169) [-890.652] (-895.648) (-891.398) * (-889.153) [-893.863] (-888.787) (-888.591) -- 0:01:10
501500 -- (-890.886) [-889.769] (-890.563) (-889.808) * (-893.887) (-896.671) [-891.835] (-897.890) -- 0:01:10
502000 -- (-892.322) (-893.199) (-891.094) [-892.115] * [-897.729] (-890.728) (-898.761) (-892.788) -- 0:01:10
502500 -- (-901.179) [-889.236] (-894.870) (-890.046) * [-891.287] (-895.540) (-898.922) (-893.290) -- 0:01:10
503000 -- (-893.834) (-890.403) [-892.515] (-898.161) * (-895.347) (-898.493) [-889.552] (-894.921) -- 0:01:10
503500 -- (-890.706) (-889.937) [-891.023] (-890.879) * (-896.410) (-888.640) [-893.047] (-892.795) -- 0:01:10
504000 -- (-889.655) (-889.315) [-895.763] (-897.075) * (-893.016) (-896.829) [-891.212] (-897.575) -- 0:01:09
504500 -- (-893.967) (-893.479) [-894.036] (-897.917) * (-894.897) (-896.532) [-888.492] (-891.295) -- 0:01:10
505000 -- (-896.728) [-889.185] (-890.777) (-889.383) * (-894.022) [-890.274] (-888.917) (-898.925) -- 0:01:10
Average standard deviation of split frequencies: 0.000932
505500 -- (-891.399) (-892.591) (-897.173) [-891.287] * [-891.630] (-886.833) (-894.557) (-889.878) -- 0:01:10
506000 -- [-887.153] (-889.461) (-894.834) (-894.052) * (-889.778) [-891.898] (-892.852) (-895.205) -- 0:01:10
506500 -- (-890.645) (-888.705) [-890.634] (-895.254) * (-889.744) [-891.483] (-890.874) (-894.247) -- 0:01:10
507000 -- (-889.229) [-893.290] (-891.736) (-893.522) * [-890.398] (-891.036) (-897.102) (-896.871) -- 0:01:10
507500 -- [-890.686] (-892.216) (-890.361) (-889.638) * (-886.797) (-894.860) [-893.047] (-899.201) -- 0:01:09
508000 -- (-892.064) (-901.362) [-892.346] (-891.398) * [-887.991] (-897.697) (-887.026) (-898.562) -- 0:01:09
508500 -- [-891.285] (-896.590) (-893.607) (-895.757) * (-889.761) [-892.214] (-888.831) (-897.645) -- 0:01:09
509000 -- [-892.182] (-890.791) (-891.080) (-890.307) * (-895.235) (-891.895) [-887.415] (-899.182) -- 0:01:09
509500 -- (-891.034) (-892.756) (-894.223) [-894.677] * (-892.764) [-892.269] (-890.502) (-897.974) -- 0:01:09
510000 -- (-891.793) (-891.995) (-897.162) [-895.991] * (-888.137) [-892.658] (-887.911) (-894.080) -- 0:01:09
Average standard deviation of split frequencies: 0.000923
510500 -- (-898.800) (-898.038) [-898.369] (-901.958) * (-894.420) [-891.897] (-892.626) (-895.733) -- 0:01:09
511000 -- [-899.746] (-894.440) (-894.730) (-903.171) * (-893.687) [-893.000] (-889.577) (-892.330) -- 0:01:08
511500 -- (-891.566) [-895.225] (-890.365) (-888.980) * (-892.247) (-894.264) (-889.511) [-891.431] -- 0:01:09
512000 -- (-889.338) (-894.697) [-891.229] (-900.345) * (-888.221) (-894.378) [-889.987] (-895.369) -- 0:01:09
512500 -- [-889.769] (-894.978) (-890.814) (-896.055) * (-889.011) (-890.166) [-890.289] (-888.361) -- 0:01:09
513000 -- (-889.486) (-890.538) [-890.250] (-890.984) * (-890.144) [-889.308] (-890.524) (-895.481) -- 0:01:09
513500 -- [-897.367] (-893.581) (-887.661) (-894.194) * (-896.343) [-891.624] (-891.794) (-893.222) -- 0:01:09
514000 -- [-892.194] (-892.527) (-893.015) (-893.168) * (-897.177) (-888.484) (-890.778) [-896.269] -- 0:01:09
514500 -- [-890.842] (-896.904) (-889.356) (-892.262) * [-888.266] (-891.553) (-891.234) (-897.568) -- 0:01:08
515000 -- (-890.545) (-895.916) (-895.711) [-892.655] * (-891.709) (-890.499) [-890.293] (-890.704) -- 0:01:08
Average standard deviation of split frequencies: 0.000914
515500 -- [-896.409] (-888.378) (-892.268) (-892.894) * (-892.365) (-895.696) [-896.083] (-888.819) -- 0:01:08
516000 -- [-893.911] (-889.208) (-891.850) (-897.029) * (-896.311) (-892.396) (-889.953) [-890.265] -- 0:01:08
516500 -- [-891.328] (-892.393) (-894.343) (-890.231) * (-897.473) (-898.935) (-896.764) [-892.024] -- 0:01:08
517000 -- (-892.529) [-892.334] (-890.786) (-894.057) * (-891.192) [-886.557] (-893.952) (-889.649) -- 0:01:08
517500 -- (-890.172) (-897.317) (-893.151) [-890.165] * (-890.041) [-890.328] (-898.346) (-892.167) -- 0:01:08
518000 -- [-889.945] (-894.104) (-890.134) (-896.366) * (-889.591) (-889.913) (-891.688) [-890.311] -- 0:01:07
518500 -- (-899.552) (-894.252) (-893.407) [-894.538] * (-888.384) (-899.143) [-895.063] (-892.879) -- 0:01:08
519000 -- (-894.703) (-891.364) (-891.721) [-891.092] * [-888.058] (-894.203) (-892.447) (-890.309) -- 0:01:08
519500 -- [-894.448] (-893.786) (-891.201) (-892.031) * [-891.284] (-896.939) (-889.666) (-891.085) -- 0:01:08
520000 -- (-894.744) (-894.911) [-890.902] (-895.638) * (-888.684) (-893.486) [-890.296] (-891.095) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
520500 -- (-894.196) (-896.137) [-893.277] (-894.926) * (-887.718) (-894.552) [-888.744] (-889.535) -- 0:01:08
521000 -- (-897.765) (-895.333) [-893.904] (-893.829) * [-890.222] (-893.261) (-887.799) (-894.177) -- 0:01:08
521500 -- [-892.919] (-889.280) (-892.390) (-896.055) * [-889.427] (-891.420) (-894.213) (-892.217) -- 0:01:07
522000 -- (-894.359) [-895.032] (-891.332) (-889.820) * (-889.923) (-888.201) [-890.966] (-887.726) -- 0:01:07
522500 -- (-893.378) [-889.598] (-894.991) (-894.114) * (-890.128) (-889.664) [-889.917] (-896.353) -- 0:01:07
523000 -- (-890.290) (-892.257) (-891.987) [-891.245] * (-900.145) (-893.947) [-888.949] (-890.562) -- 0:01:07
523500 -- (-891.710) [-889.714] (-892.445) (-891.713) * (-898.473) (-891.722) (-893.230) [-893.867] -- 0:01:07
524000 -- [-890.802] (-891.189) (-895.599) (-893.481) * (-893.540) [-890.223] (-898.482) (-890.604) -- 0:01:07
524500 -- (-896.061) [-890.299] (-896.779) (-896.011) * (-890.285) [-888.790] (-891.915) (-894.770) -- 0:01:07
525000 -- (-891.478) [-891.025] (-893.474) (-893.619) * [-890.671] (-892.930) (-892.482) (-897.021) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
525500 -- (-892.382) [-894.012] (-889.526) (-891.193) * (-890.420) (-890.113) [-889.440] (-896.610) -- 0:01:07
526000 -- (-901.806) (-898.742) (-893.001) [-891.080] * (-890.808) [-889.187] (-896.022) (-902.127) -- 0:01:07
526500 -- (-895.665) (-890.911) (-892.066) [-895.227] * (-889.751) (-889.903) [-889.924] (-901.775) -- 0:01:07
527000 -- [-888.952] (-891.343) (-892.735) (-891.535) * (-895.044) (-890.679) (-888.500) [-892.455] -- 0:01:07
527500 -- (-890.747) [-889.243] (-888.263) (-890.552) * [-892.439] (-889.459) (-886.543) (-895.749) -- 0:01:07
528000 -- [-892.057] (-892.557) (-891.587) (-896.729) * [-888.845] (-892.158) (-888.875) (-895.533) -- 0:01:07
528500 -- (-898.142) (-895.742) [-889.691] (-892.878) * (-891.541) (-888.156) [-890.789] (-889.422) -- 0:01:06
529000 -- (-893.136) [-893.571] (-898.257) (-889.003) * [-893.374] (-889.073) (-891.041) (-897.910) -- 0:01:06
529500 -- (-896.836) [-889.047] (-896.013) (-896.285) * (-887.673) (-890.252) [-894.828] (-901.990) -- 0:01:06
530000 -- (-894.551) (-894.371) (-895.567) [-903.649] * (-895.123) (-890.124) [-887.606] (-895.815) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
530500 -- [-892.462] (-896.297) (-890.829) (-898.206) * (-895.922) [-888.549] (-894.403) (-891.714) -- 0:01:06
531000 -- (-894.544) (-894.643) (-892.347) [-901.630] * (-893.025) [-891.856] (-892.175) (-905.014) -- 0:01:06
531500 -- [-890.491] (-892.947) (-891.284) (-897.305) * (-892.349) (-893.306) (-892.192) [-890.455] -- 0:01:06
532000 -- (-895.093) (-895.672) [-897.424] (-893.560) * [-893.566] (-890.068) (-891.653) (-903.414) -- 0:01:05
532500 -- (-895.585) [-889.854] (-892.738) (-891.770) * (-895.426) [-890.479] (-891.208) (-895.342) -- 0:01:05
533000 -- [-893.385] (-892.900) (-895.020) (-890.156) * (-893.655) [-894.253] (-895.338) (-892.982) -- 0:01:06
533500 -- (-889.027) (-898.593) [-891.853] (-891.057) * (-897.337) [-893.123] (-894.635) (-895.891) -- 0:01:06
534000 -- (-889.323) [-890.003] (-894.529) (-893.979) * (-891.665) (-892.616) [-893.104] (-890.561) -- 0:01:06
534500 -- (-890.597) (-891.294) (-896.003) [-896.088] * [-895.219] (-890.567) (-893.091) (-893.517) -- 0:01:06
535000 -- [-890.314] (-890.471) (-896.758) (-895.749) * (-889.438) [-889.725] (-892.155) (-896.142) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
535500 -- [-888.432] (-889.769) (-890.780) (-894.603) * (-897.470) [-887.855] (-892.361) (-893.365) -- 0:01:05
536000 -- [-891.933] (-897.995) (-890.498) (-889.671) * (-890.834) (-890.867) [-893.230] (-893.515) -- 0:01:05
536500 -- (-891.542) [-894.361] (-891.862) (-890.061) * [-891.711] (-895.536) (-892.548) (-892.970) -- 0:01:05
537000 -- (-897.972) (-893.641) (-894.397) [-892.812] * (-895.015) (-896.443) (-893.006) [-889.192] -- 0:01:05
537500 -- (-899.566) [-893.914] (-889.839) (-892.300) * (-892.486) (-898.158) [-889.661] (-901.028) -- 0:01:05
538000 -- [-903.682] (-889.792) (-886.816) (-895.276) * (-889.583) (-889.271) (-890.318) [-895.395] -- 0:01:05
538500 -- [-895.796] (-897.916) (-889.970) (-892.944) * [-891.650] (-890.539) (-894.636) (-892.236) -- 0:01:05
539000 -- [-892.202] (-889.914) (-891.103) (-888.003) * [-899.147] (-890.867) (-890.788) (-896.117) -- 0:01:05
539500 -- (-900.397) [-893.533] (-892.136) (-889.920) * [-892.826] (-890.049) (-893.912) (-893.456) -- 0:01:04
540000 -- (-891.149) (-891.539) [-894.235] (-894.031) * (-895.152) (-889.597) (-890.825) [-889.057] -- 0:01:05
Average standard deviation of split frequencies: 0.000872
540500 -- [-890.882] (-894.616) (-891.344) (-898.122) * (-891.410) (-888.292) [-892.456] (-890.666) -- 0:01:05
541000 -- [-888.587] (-889.021) (-892.412) (-889.118) * (-893.428) (-892.291) [-890.405] (-892.654) -- 0:01:05
541500 -- [-895.370] (-887.909) (-890.781) (-893.945) * (-895.674) (-893.792) [-894.132] (-890.650) -- 0:01:05
542000 -- (-892.761) (-886.826) [-890.357] (-890.134) * [-888.025] (-894.484) (-895.564) (-889.267) -- 0:01:05
542500 -- [-890.529] (-889.403) (-890.844) (-896.388) * [-893.037] (-896.759) (-893.725) (-891.937) -- 0:01:04
543000 -- (-888.828) (-894.102) [-889.905] (-893.398) * (-897.532) (-897.336) (-892.012) [-889.892] -- 0:01:04
543500 -- (-895.274) (-893.732) [-889.619] (-889.352) * (-894.273) [-890.151] (-897.018) (-889.332) -- 0:01:04
544000 -- (-896.986) (-902.383) [-886.936] (-891.552) * [-893.305] (-892.328) (-891.649) (-891.331) -- 0:01:04
544500 -- (-893.720) [-892.980] (-894.270) (-896.425) * (-893.670) (-895.821) [-891.458] (-896.211) -- 0:01:04
545000 -- (-894.597) [-889.862] (-891.422) (-894.570) * (-893.094) [-890.857] (-887.719) (-893.213) -- 0:01:04
Average standard deviation of split frequencies: 0.000863
545500 -- [-888.986] (-892.562) (-890.300) (-899.460) * [-894.313] (-890.944) (-890.814) (-891.859) -- 0:01:04
546000 -- (-891.444) (-896.222) (-892.097) [-892.057] * (-893.447) (-893.328) (-894.258) [-895.579] -- 0:01:04
546500 -- (-892.493) (-894.510) (-889.622) [-891.063] * (-897.031) [-894.356] (-894.880) (-892.406) -- 0:01:03
547000 -- (-900.160) [-890.663] (-894.743) (-888.579) * (-891.729) (-892.044) [-889.013] (-897.997) -- 0:01:04
547500 -- (-890.949) (-893.133) [-890.080] (-889.398) * [-890.250] (-897.798) (-893.732) (-889.768) -- 0:01:04
548000 -- [-891.473] (-892.738) (-892.002) (-888.174) * [-889.756] (-893.189) (-889.132) (-890.037) -- 0:01:04
548500 -- (-892.766) (-891.882) [-893.012] (-889.872) * [-895.544] (-900.615) (-891.815) (-891.677) -- 0:01:04
549000 -- (-898.764) (-896.751) (-897.028) [-887.485] * [-891.857] (-889.306) (-892.323) (-892.759) -- 0:01:04
549500 -- (-899.251) [-890.096] (-890.474) (-893.036) * (-894.316) [-889.575] (-889.047) (-890.394) -- 0:01:03
550000 -- (-897.426) (-888.934) [-891.621] (-893.376) * (-891.540) [-893.072] (-893.202) (-895.125) -- 0:01:03
Average standard deviation of split frequencies: 0.000856
550500 -- [-891.617] (-895.792) (-887.850) (-899.028) * (-892.485) [-891.845] (-891.319) (-892.426) -- 0:01:03
551000 -- [-891.546] (-888.895) (-890.404) (-891.487) * (-891.063) [-892.059] (-892.791) (-895.546) -- 0:01:03
551500 -- (-901.878) [-892.165] (-892.706) (-894.971) * (-889.093) [-897.157] (-898.816) (-899.207) -- 0:01:03
552000 -- [-889.281] (-892.806) (-894.593) (-893.836) * [-892.033] (-889.375) (-893.189) (-891.027) -- 0:01:03
552500 -- (-891.638) [-889.248] (-889.590) (-899.440) * (-899.187) (-891.324) [-893.404] (-891.755) -- 0:01:03
553000 -- [-890.502] (-895.202) (-888.223) (-894.514) * (-898.875) (-892.167) [-891.297] (-888.426) -- 0:01:03
553500 -- (-894.250) [-894.798] (-891.158) (-896.002) * (-893.023) (-891.743) (-890.991) [-892.349] -- 0:01:02
554000 -- [-890.711] (-894.359) (-893.785) (-895.015) * (-893.534) (-891.190) [-892.145] (-891.354) -- 0:01:03
554500 -- (-893.475) (-889.676) [-891.214] (-891.016) * (-892.243) [-891.209] (-890.684) (-890.346) -- 0:01:03
555000 -- [-894.848] (-889.295) (-889.020) (-890.827) * (-893.664) [-887.053] (-896.101) (-888.560) -- 0:01:03
Average standard deviation of split frequencies: 0.000848
555500 -- (-894.289) (-889.471) (-893.815) [-894.598] * [-890.633] (-890.980) (-890.104) (-887.710) -- 0:01:03
556000 -- (-890.114) (-888.235) [-890.118] (-898.313) * (-893.572) (-894.030) (-890.456) [-892.741] -- 0:01:03
556500 -- (-895.620) (-890.612) [-892.477] (-896.843) * [-889.714] (-888.902) (-896.568) (-897.538) -- 0:01:02
557000 -- (-890.932) (-887.507) (-891.226) [-899.065] * (-889.873) [-892.770] (-893.372) (-894.483) -- 0:01:02
557500 -- (-892.067) [-893.252] (-891.651) (-894.863) * [-888.028] (-895.933) (-893.297) (-893.316) -- 0:01:02
558000 -- [-890.587] (-891.826) (-894.425) (-893.983) * (-890.222) [-890.447] (-892.763) (-891.329) -- 0:01:02
558500 -- [-890.095] (-888.658) (-893.198) (-896.912) * [-895.634] (-895.817) (-898.206) (-894.476) -- 0:01:02
559000 -- [-890.069] (-895.312) (-890.982) (-896.398) * (-889.854) [-894.638] (-895.237) (-890.384) -- 0:01:02
559500 -- [-889.862] (-889.968) (-895.403) (-898.091) * [-887.593] (-896.793) (-890.507) (-891.146) -- 0:01:02
560000 -- (-894.064) (-891.966) (-893.123) [-888.642] * (-896.925) (-896.372) [-893.808] (-897.670) -- 0:01:02
Average standard deviation of split frequencies: 0.001682
560500 -- (-888.779) (-898.280) [-890.452] (-897.275) * (-894.148) [-892.837] (-889.882) (-897.125) -- 0:01:02
561000 -- (-889.640) [-895.962] (-889.093) (-892.124) * (-902.020) [-888.245] (-894.678) (-892.740) -- 0:01:02
561500 -- [-898.027] (-892.199) (-888.416) (-891.309) * (-892.262) (-890.058) [-890.084] (-889.437) -- 0:01:02
562000 -- (-893.062) (-895.688) [-894.556] (-891.754) * (-890.795) [-892.244] (-891.344) (-891.000) -- 0:01:02
562500 -- [-889.020] (-899.470) (-891.044) (-892.358) * [-891.085] (-889.923) (-895.008) (-897.209) -- 0:01:02
563000 -- (-890.189) (-892.721) (-891.356) [-890.966] * (-890.811) (-891.087) (-890.638) [-889.513] -- 0:01:02
563500 -- (-895.343) [-895.008] (-896.366) (-891.951) * (-889.762) [-888.752] (-893.640) (-891.229) -- 0:01:01
564000 -- (-889.801) (-890.893) (-889.397) [-889.320] * [-897.243] (-888.350) (-893.129) (-891.187) -- 0:01:01
564500 -- (-892.787) (-892.507) (-890.691) [-892.090] * (-890.029) [-893.343] (-891.564) (-894.726) -- 0:01:01
565000 -- (-891.078) (-892.281) (-891.201) [-894.780] * [-889.149] (-890.785) (-891.816) (-895.016) -- 0:01:01
Average standard deviation of split frequencies: 0.002499
565500 -- (-895.000) [-896.003] (-892.776) (-892.194) * (-892.188) [-889.271] (-891.565) (-893.461) -- 0:01:01
566000 -- (-887.958) (-893.326) (-893.436) [-888.147] * (-894.016) (-889.555) (-891.632) [-895.801] -- 0:01:01
566500 -- [-889.946] (-893.354) (-889.107) (-890.895) * (-892.015) [-890.998] (-891.951) (-891.115) -- 0:01:01
567000 -- (-893.370) [-897.173] (-891.879) (-894.683) * [-887.437] (-893.177) (-894.136) (-893.036) -- 0:01:01
567500 -- (-892.025) [-889.294] (-890.199) (-894.670) * (-900.058) (-890.943) (-893.155) [-892.806] -- 0:01:01
568000 -- (-890.463) (-894.127) (-894.410) [-895.953] * (-890.758) [-896.363] (-893.755) (-894.043) -- 0:01:01
568500 -- [-894.400] (-890.478) (-891.898) (-901.867) * [-892.690] (-893.093) (-899.572) (-892.850) -- 0:01:01
569000 -- (-889.519) [-889.543] (-898.927) (-893.677) * (-891.548) [-895.934] (-894.435) (-896.314) -- 0:01:01
569500 -- [-891.813] (-889.605) (-891.810) (-896.860) * (-888.777) [-890.045] (-890.669) (-889.343) -- 0:01:01
570000 -- [-897.283] (-895.798) (-901.598) (-889.075) * [-888.663] (-890.148) (-894.972) (-890.370) -- 0:01:01
Average standard deviation of split frequencies: 0.002478
570500 -- (-892.472) (-888.378) (-895.622) [-888.338] * [-893.377] (-892.425) (-891.595) (-893.544) -- 0:01:00
571000 -- (-888.079) [-889.192] (-898.118) (-892.704) * (-888.286) (-891.402) [-895.159] (-893.204) -- 0:01:00
571500 -- (-888.625) (-891.854) (-900.839) [-888.443] * (-889.922) (-891.624) [-892.669] (-889.272) -- 0:01:00
572000 -- [-890.795] (-893.386) (-898.661) (-895.554) * (-891.595) (-890.914) [-887.895] (-890.275) -- 0:01:00
572500 -- (-896.062) (-893.161) (-894.527) [-894.116] * (-891.534) [-890.302] (-897.237) (-890.507) -- 0:01:00
573000 -- (-897.753) (-896.454) (-895.837) [-888.283] * (-890.448) (-892.808) [-896.423] (-894.920) -- 0:01:00
573500 -- (-892.673) [-891.083] (-897.081) (-894.371) * (-887.987) (-891.357) [-890.388] (-896.930) -- 0:01:00
574000 -- (-889.796) [-888.575] (-897.436) (-898.398) * (-888.894) [-893.166] (-890.397) (-898.774) -- 0:01:00
574500 -- (-893.353) [-891.722] (-893.120) (-894.914) * (-890.436) (-890.587) (-898.229) [-898.160] -- 0:01:00
575000 -- (-895.119) (-888.581) (-890.381) [-890.170] * (-895.025) [-888.337] (-901.295) (-895.247) -- 0:01:00
Average standard deviation of split frequencies: 0.001637
575500 -- (-897.267) (-889.550) (-892.358) [-889.438] * [-889.990] (-892.525) (-895.043) (-891.863) -- 0:01:00
576000 -- [-888.692] (-892.739) (-891.470) (-890.940) * (-893.909) (-887.405) [-893.398] (-893.428) -- 0:01:00
576500 -- (-891.260) [-887.980] (-893.180) (-891.956) * [-887.966] (-888.320) (-892.004) (-890.630) -- 0:01:00
577000 -- [-890.261] (-891.778) (-894.756) (-892.685) * (-900.052) (-888.735) [-891.800] (-891.875) -- 0:01:00
577500 -- (-899.485) (-890.212) [-893.960] (-890.781) * (-894.717) [-890.799] (-896.076) (-889.494) -- 0:00:59
578000 -- [-892.591] (-893.192) (-895.218) (-892.674) * (-891.822) (-890.438) [-891.101] (-892.711) -- 0:00:59
578500 -- (-893.972) [-886.463] (-889.169) (-895.703) * (-895.601) [-891.609] (-890.622) (-896.529) -- 0:00:59
579000 -- [-889.349] (-890.031) (-896.642) (-897.605) * (-891.155) (-893.001) [-888.788] (-898.480) -- 0:00:59
579500 -- (-892.295) [-889.376] (-894.110) (-894.369) * [-891.885] (-894.809) (-895.266) (-891.498) -- 0:00:59
580000 -- (-891.694) [-890.575] (-889.302) (-893.827) * [-901.922] (-899.490) (-891.470) (-891.595) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
580500 -- (-894.980) (-887.449) (-890.109) [-891.998] * (-892.188) (-890.688) (-891.416) [-892.544] -- 0:00:59
581000 -- (-893.334) (-891.380) (-892.054) [-892.655] * (-898.085) [-893.093] (-891.707) (-892.756) -- 0:00:59
581500 -- (-892.005) [-888.017] (-889.913) (-894.666) * (-898.928) (-889.504) (-889.040) [-888.080] -- 0:00:59
582000 -- [-886.965] (-895.807) (-889.137) (-891.653) * [-891.899] (-893.129) (-894.487) (-888.315) -- 0:00:59
582500 -- (-887.608) [-890.719] (-895.009) (-892.441) * (-896.926) (-892.315) (-892.654) [-894.383] -- 0:00:59
583000 -- (-894.253) (-891.042) [-887.968] (-889.997) * (-897.749) (-895.900) (-901.205) [-893.278] -- 0:00:59
583500 -- [-891.943] (-893.720) (-889.396) (-889.042) * (-891.781) [-892.746] (-894.241) (-894.079) -- 0:00:59
584000 -- (-891.482) [-898.213] (-890.063) (-893.853) * (-892.082) (-888.723) (-898.631) [-893.623] -- 0:00:59
584500 -- (-895.884) (-890.482) [-890.279] (-895.858) * (-891.925) (-891.700) [-892.135] (-891.863) -- 0:00:59
585000 -- [-887.567] (-892.884) (-891.757) (-890.421) * [-889.980] (-893.972) (-890.359) (-894.903) -- 0:00:58
Average standard deviation of split frequencies: 0.001609
585500 -- (-890.198) (-889.279) [-893.312] (-891.503) * (-891.771) (-892.804) [-894.150] (-896.079) -- 0:00:58
586000 -- (-894.457) (-901.695) (-893.778) [-887.133] * [-889.996] (-893.801) (-893.567) (-894.700) -- 0:00:58
586500 -- (-896.337) [-896.319] (-888.388) (-895.338) * (-890.603) [-889.020] (-894.069) (-893.895) -- 0:00:58
587000 -- (-892.547) [-899.541] (-886.021) (-891.857) * (-894.526) [-891.293] (-892.128) (-888.940) -- 0:00:58
587500 -- (-893.659) (-895.757) [-894.501] (-896.209) * (-891.439) [-889.471] (-895.751) (-888.746) -- 0:00:58
588000 -- (-890.098) (-894.420) [-889.703] (-889.343) * (-890.075) (-893.478) (-896.575) [-890.243] -- 0:00:58
588500 -- (-891.181) (-892.700) [-888.054] (-890.200) * (-891.072) [-890.517] (-898.262) (-889.086) -- 0:00:58
589000 -- (-890.600) [-892.120] (-890.091) (-895.250) * (-892.049) [-888.518] (-894.634) (-891.948) -- 0:00:58
589500 -- [-889.191] (-890.706) (-901.672) (-892.773) * (-893.271) (-894.623) (-892.264) [-892.336] -- 0:00:58
590000 -- [-894.931] (-893.486) (-892.684) (-891.955) * (-894.791) (-889.538) [-891.761] (-889.799) -- 0:00:58
Average standard deviation of split frequencies: 0.002394
590500 -- (-891.312) (-890.547) (-894.517) [-891.179] * (-892.407) [-894.041] (-889.629) (-891.871) -- 0:00:58
591000 -- (-891.191) (-891.437) (-898.674) [-890.827] * (-897.012) (-903.586) [-897.425] (-898.142) -- 0:00:58
591500 -- [-892.943] (-889.869) (-895.557) (-901.662) * (-900.984) [-891.420] (-895.323) (-888.385) -- 0:00:58
592000 -- [-888.449] (-889.901) (-894.798) (-894.853) * (-891.443) (-889.180) [-889.747] (-896.395) -- 0:00:57
592500 -- (-894.816) [-892.120] (-893.470) (-890.434) * (-892.976) (-891.090) [-893.082] (-894.807) -- 0:00:57
593000 -- (-892.393) (-891.498) (-895.186) [-890.292] * [-891.002] (-896.895) (-889.937) (-889.780) -- 0:00:57
593500 -- (-891.924) (-895.831) [-891.994] (-891.950) * (-893.461) [-891.540] (-887.938) (-888.991) -- 0:00:57
594000 -- [-888.527] (-889.416) (-895.899) (-893.750) * (-892.970) (-893.338) [-891.543] (-894.439) -- 0:00:57
594500 -- (-889.327) (-890.023) (-890.166) [-892.759] * (-890.419) (-899.839) [-896.100] (-894.343) -- 0:00:57
595000 -- [-892.352] (-888.693) (-893.561) (-892.043) * [-889.319] (-898.589) (-891.587) (-888.186) -- 0:00:57
Average standard deviation of split frequencies: 0.004746
595500 -- (-894.024) [-890.072] (-892.510) (-897.516) * [-888.790] (-895.013) (-895.843) (-890.453) -- 0:00:57
596000 -- (-893.282) (-893.090) [-890.177] (-892.671) * (-893.303) (-900.660) (-892.556) [-890.096] -- 0:00:57
596500 -- [-893.309] (-891.728) (-894.202) (-899.132) * (-888.786) [-893.819] (-895.200) (-888.316) -- 0:00:57
597000 -- (-906.066) (-888.306) (-889.898) [-890.535] * [-889.069] (-903.400) (-897.167) (-889.622) -- 0:00:57
597500 -- (-906.533) (-895.333) [-890.361] (-894.560) * (-889.806) (-899.037) [-893.422] (-889.402) -- 0:00:57
598000 -- (-900.237) [-891.536] (-890.778) (-892.870) * (-892.012) (-892.098) [-889.414] (-892.552) -- 0:00:57
598500 -- (-899.371) [-890.190] (-890.119) (-896.665) * (-891.326) (-889.918) (-889.843) [-896.955] -- 0:00:57
599000 -- (-893.618) (-887.736) [-890.367] (-899.387) * (-894.015) (-899.442) [-891.149] (-891.479) -- 0:00:56
599500 -- (-897.997) (-892.997) (-890.825) [-896.328] * [-887.559] (-898.417) (-891.219) (-894.764) -- 0:00:56
600000 -- [-897.949] (-892.927) (-889.603) (-893.507) * (-894.019) (-894.308) [-893.522] (-895.613) -- 0:00:56
Average standard deviation of split frequencies: 0.004709
600500 -- (-893.627) [-892.678] (-888.284) (-892.905) * (-893.521) (-892.549) (-893.138) [-888.028] -- 0:00:56
601000 -- (-892.027) (-888.784) [-888.328] (-894.006) * (-894.249) (-895.837) [-889.868] (-891.245) -- 0:00:56
601500 -- (-888.461) [-890.533] (-891.190) (-891.368) * (-892.414) (-899.159) (-892.833) [-893.341] -- 0:00:56
602000 -- (-891.642) (-891.247) [-892.618] (-893.542) * (-895.536) (-899.321) (-894.070) [-888.281] -- 0:00:56
602500 -- [-890.608] (-890.464) (-893.404) (-893.080) * (-894.567) [-895.068] (-903.458) (-892.308) -- 0:00:56
603000 -- [-896.824] (-894.722) (-896.442) (-888.142) * (-890.584) (-900.820) [-891.011] (-890.688) -- 0:00:56
603500 -- (-895.605) (-891.680) [-888.159] (-895.494) * (-894.982) (-895.981) (-892.092) [-892.520] -- 0:00:56
604000 -- (-891.576) (-893.172) (-895.030) [-891.247] * (-890.689) [-893.136] (-892.118) (-894.672) -- 0:00:56
604500 -- (-891.684) [-891.589] (-893.361) (-894.173) * (-890.846) (-896.802) [-891.360] (-894.322) -- 0:00:56
605000 -- (-891.680) (-889.730) (-892.753) [-895.098] * (-890.975) (-894.524) (-892.845) [-890.241] -- 0:00:56
Average standard deviation of split frequencies: 0.003889
605500 -- (-893.004) (-896.454) [-891.360] (-895.295) * (-891.187) (-894.536) [-897.471] (-891.255) -- 0:00:56
606000 -- [-890.909] (-897.817) (-893.602) (-890.169) * [-888.635] (-895.842) (-889.758) (-893.334) -- 0:00:55
606500 -- (-893.671) [-893.126] (-893.722) (-887.740) * (-889.772) (-894.679) [-891.410] (-898.013) -- 0:00:55
607000 -- (-889.637) [-888.603] (-894.596) (-892.624) * (-889.628) (-897.891) (-894.494) [-898.403] -- 0:00:55
607500 -- (-892.490) (-891.237) (-890.357) [-891.730] * (-889.373) (-895.258) [-895.708] (-891.057) -- 0:00:55
608000 -- [-887.430] (-892.079) (-890.990) (-890.657) * (-895.454) (-894.752) [-891.962] (-891.272) -- 0:00:55
608500 -- (-888.202) (-893.909) (-891.810) [-892.589] * [-895.942] (-893.610) (-889.000) (-892.330) -- 0:00:55
609000 -- (-895.223) (-892.784) (-894.515) [-892.788] * (-890.370) [-892.111] (-890.899) (-892.035) -- 0:00:55
609500 -- [-893.599] (-889.407) (-895.763) (-891.303) * (-890.622) [-890.300] (-893.005) (-888.275) -- 0:00:55
610000 -- (-898.517) (-896.475) (-890.887) [-889.446] * (-892.147) (-892.317) (-891.610) [-889.576] -- 0:00:55
Average standard deviation of split frequencies: 0.004632
610500 -- [-895.337] (-889.877) (-890.741) (-890.673) * (-894.720) (-887.756) (-895.500) [-889.390] -- 0:00:55
611000 -- (-891.540) (-898.351) [-893.456] (-895.415) * (-893.837) [-889.116] (-890.273) (-891.282) -- 0:00:55
611500 -- (-891.081) [-890.666] (-889.138) (-894.201) * (-895.403) (-891.000) [-889.158] (-890.206) -- 0:00:55
612000 -- (-888.310) (-890.604) [-895.013] (-892.444) * (-898.399) (-896.527) [-888.526] (-894.279) -- 0:00:55
612500 -- (-891.090) [-892.844] (-899.396) (-893.270) * (-892.027) (-892.042) (-890.507) [-890.330] -- 0:00:55
613000 -- [-892.468] (-891.484) (-893.893) (-897.701) * (-890.165) (-889.325) [-889.558] (-893.619) -- 0:00:54
613500 -- (-896.693) (-887.839) [-889.683] (-891.990) * (-892.582) (-895.996) [-888.716] (-894.393) -- 0:00:54
614000 -- (-898.252) (-894.749) (-894.045) [-889.771] * (-889.037) (-891.131) [-889.328] (-890.933) -- 0:00:54
614500 -- (-895.358) (-894.557) [-889.742] (-892.189) * (-890.456) [-891.801] (-894.771) (-894.432) -- 0:00:54
615000 -- (-891.050) (-898.298) (-889.836) [-889.860] * (-889.705) (-890.179) (-899.474) [-892.152] -- 0:00:54
Average standard deviation of split frequencies: 0.006887
615500 -- [-892.439] (-890.959) (-891.308) (-896.570) * (-889.905) (-888.411) (-894.448) [-887.523] -- 0:00:54
616000 -- (-891.061) [-889.101] (-891.343) (-897.459) * (-894.934) [-889.722] (-889.845) (-891.242) -- 0:00:54
616500 -- (-894.462) (-893.740) [-893.995] (-895.588) * (-892.627) (-891.158) (-892.079) [-892.258] -- 0:00:54
617000 -- (-891.392) (-891.592) [-890.291] (-897.637) * [-894.540] (-888.814) (-894.588) (-893.951) -- 0:00:54
617500 -- (-891.951) (-896.294) [-892.922] (-895.880) * (-890.797) (-887.493) [-892.913] (-889.305) -- 0:00:54
618000 -- (-892.534) (-891.532) [-892.923] (-894.629) * (-891.252) (-891.050) (-892.923) [-889.444] -- 0:00:54
618500 -- [-891.452] (-892.497) (-892.488) (-891.365) * [-894.345] (-893.603) (-898.411) (-892.851) -- 0:00:54
619000 -- (-890.366) (-888.658) [-898.756] (-890.358) * (-894.475) (-889.132) [-895.413] (-892.386) -- 0:00:54
619500 -- (-893.168) (-890.413) (-901.023) [-893.631] * (-891.435) [-891.464] (-898.105) (-890.391) -- 0:00:54
620000 -- (-891.245) [-891.118] (-903.238) (-894.879) * (-886.882) [-893.712] (-890.577) (-895.799) -- 0:00:53
Average standard deviation of split frequencies: 0.006836
620500 -- (-889.836) (-889.451) [-892.932] (-893.871) * (-894.082) (-890.634) (-895.885) [-894.425] -- 0:00:53
621000 -- (-887.347) (-892.129) [-890.871] (-898.012) * (-890.728) (-899.153) (-890.789) [-895.363] -- 0:00:53
621500 -- (-891.431) [-891.593] (-892.004) (-894.289) * [-890.441] (-900.367) (-894.136) (-893.305) -- 0:00:53
622000 -- (-893.974) [-893.970] (-892.009) (-892.737) * (-892.317) [-890.467] (-892.659) (-893.391) -- 0:00:53
622500 -- (-896.204) [-893.964] (-892.396) (-899.661) * [-890.060] (-890.966) (-891.594) (-889.808) -- 0:00:53
623000 -- [-896.979] (-893.982) (-889.730) (-903.520) * [-889.919] (-890.500) (-891.371) (-892.747) -- 0:00:53
623500 -- (-893.146) (-894.753) [-889.740] (-902.188) * (-893.044) (-890.249) (-892.736) [-895.627] -- 0:00:53
624000 -- (-893.578) [-890.395] (-890.285) (-897.476) * [-888.776] (-892.744) (-891.263) (-893.710) -- 0:00:53
624500 -- (-895.545) [-893.964] (-891.340) (-897.646) * (-888.310) (-893.655) [-890.814] (-893.483) -- 0:00:53
625000 -- [-892.096] (-898.254) (-897.571) (-892.818) * (-890.175) (-896.958) [-894.004] (-892.392) -- 0:00:53
Average standard deviation of split frequencies: 0.004518
625500 -- (-888.406) (-891.085) (-891.786) [-892.033] * [-889.148] (-898.066) (-890.988) (-889.478) -- 0:00:53
626000 -- (-888.712) (-894.432) (-888.102) [-890.650] * (-896.702) (-892.842) [-891.007] (-888.220) -- 0:00:53
626500 -- (-894.192) [-890.583] (-899.445) (-891.636) * (-890.235) (-892.976) (-889.346) [-888.717] -- 0:00:53
627000 -- (-893.042) (-894.171) [-890.941] (-893.671) * [-890.051] (-896.222) (-894.819) (-889.152) -- 0:00:52
627500 -- [-889.871] (-891.990) (-896.119) (-896.090) * (-894.299) (-889.510) [-890.408] (-888.956) -- 0:00:52
628000 -- [-896.300] (-893.102) (-894.276) (-894.711) * (-890.146) [-890.392] (-893.379) (-894.459) -- 0:00:52
628500 -- (-893.970) [-890.477] (-891.904) (-904.882) * (-890.630) [-890.357] (-891.418) (-894.546) -- 0:00:52
629000 -- (-892.675) (-892.190) [-892.250] (-898.701) * (-892.062) [-890.779] (-898.742) (-894.877) -- 0:00:52
629500 -- (-895.029) [-893.056] (-892.885) (-896.506) * [-888.576] (-896.459) (-901.305) (-888.698) -- 0:00:52
630000 -- (-889.306) (-892.230) (-897.762) [-891.705] * (-888.937) (-890.106) [-895.004] (-894.675) -- 0:00:52
Average standard deviation of split frequencies: 0.004485
630500 -- (-888.851) (-894.898) (-891.011) [-891.846] * (-894.006) (-896.345) [-894.595] (-887.149) -- 0:00:52
631000 -- (-890.884) [-889.965] (-890.548) (-892.011) * (-895.314) (-895.655) (-890.087) [-889.679] -- 0:00:52
631500 -- (-888.492) (-890.187) [-890.340] (-891.753) * (-894.735) (-892.869) (-891.454) [-886.768] -- 0:00:52
632000 -- (-890.652) (-887.170) (-891.991) [-892.382] * [-890.566] (-891.558) (-894.126) (-896.624) -- 0:00:52
632500 -- (-894.855) (-892.210) (-892.545) [-892.796] * (-891.267) [-890.360] (-892.211) (-892.809) -- 0:00:52
633000 -- [-890.225] (-889.922) (-888.922) (-899.982) * (-890.912) (-890.309) [-892.464] (-896.035) -- 0:00:52
633500 -- (-890.329) (-891.493) [-899.754] (-892.828) * (-891.046) (-891.907) [-888.887] (-888.777) -- 0:00:52
634000 -- (-889.753) [-893.350] (-891.336) (-893.446) * [-891.568] (-893.615) (-894.068) (-895.352) -- 0:00:51
634500 -- (-889.738) (-891.449) [-890.343] (-895.090) * (-895.863) (-891.455) [-890.837] (-891.936) -- 0:00:51
635000 -- (-891.387) (-896.906) [-890.557] (-896.808) * (-893.814) (-890.059) (-891.751) [-890.825] -- 0:00:51
Average standard deviation of split frequencies: 0.003706
635500 -- [-896.054] (-895.671) (-898.846) (-896.961) * (-895.638) [-890.633] (-892.266) (-888.087) -- 0:00:51
636000 -- (-891.508) (-894.369) (-893.600) [-891.863] * (-890.179) (-891.128) [-890.994] (-893.727) -- 0:00:51
636500 -- (-894.709) (-888.864) (-900.409) [-893.812] * (-890.359) (-895.950) (-892.877) [-893.524] -- 0:00:51
637000 -- (-891.504) (-894.330) (-897.156) [-889.395] * (-889.982) (-894.044) [-889.063] (-891.136) -- 0:00:51
637500 -- [-889.926] (-890.051) (-893.651) (-892.764) * (-894.444) (-891.902) (-893.480) [-899.110] -- 0:00:51
638000 -- (-888.772) (-890.159) (-893.811) [-889.194] * (-894.024) [-891.302] (-893.096) (-889.789) -- 0:00:51
638500 -- (-893.358) (-892.384) [-890.381] (-894.127) * [-891.222] (-892.444) (-895.131) (-886.383) -- 0:00:51
639000 -- [-895.739] (-891.922) (-893.726) (-893.532) * (-889.156) [-894.917] (-894.713) (-891.080) -- 0:00:51
639500 -- (-891.549) (-893.480) (-893.222) [-889.918] * [-894.167] (-891.430) (-890.768) (-887.828) -- 0:00:51
640000 -- [-892.610] (-888.014) (-898.273) (-893.814) * (-890.674) (-893.274) [-891.726] (-892.971) -- 0:00:51
Average standard deviation of split frequencies: 0.003679
640500 -- (-891.204) (-890.219) (-895.149) [-895.813] * (-892.267) (-898.774) [-889.088] (-896.073) -- 0:00:51
641000 -- [-888.936] (-890.910) (-890.503) (-893.103) * [-894.130] (-890.549) (-895.989) (-894.786) -- 0:00:50
641500 -- [-892.397] (-895.342) (-896.486) (-890.070) * [-888.081] (-891.095) (-893.337) (-892.163) -- 0:00:50
642000 -- (-893.863) (-890.820) (-898.792) [-891.127] * (-896.052) (-895.447) [-887.945] (-889.855) -- 0:00:50
642500 -- (-892.086) (-891.178) [-892.400] (-893.939) * (-888.226) (-894.706) [-889.577] (-890.075) -- 0:00:50
643000 -- (-895.552) (-891.098) [-892.907] (-893.014) * [-890.509] (-899.037) (-894.788) (-890.690) -- 0:00:50
643500 -- (-892.102) (-889.983) (-894.737) [-902.571] * (-890.733) (-893.250) (-891.585) [-894.691] -- 0:00:50
644000 -- [-891.291] (-895.203) (-889.965) (-901.153) * (-887.610) (-899.734) [-892.624] (-889.811) -- 0:00:50
644500 -- (-890.348) (-901.389) [-893.294] (-894.921) * (-895.569) (-893.140) [-890.755] (-893.775) -- 0:00:50
645000 -- [-892.793] (-897.854) (-896.081) (-892.615) * [-890.247] (-900.420) (-887.883) (-891.487) -- 0:00:50
Average standard deviation of split frequencies: 0.005108
645500 -- (-892.450) (-890.356) [-896.034] (-896.486) * (-888.148) (-894.653) [-891.693] (-887.684) -- 0:00:50
646000 -- (-891.364) (-889.604) (-889.303) [-894.716] * (-890.207) [-890.342] (-894.594) (-888.975) -- 0:00:50
646500 -- (-892.780) [-888.829] (-888.719) (-894.987) * (-888.093) (-893.347) (-889.812) [-891.611] -- 0:00:50
647000 -- (-891.352) [-889.636] (-890.544) (-894.852) * (-891.116) (-891.036) (-889.146) [-895.820] -- 0:00:50
647500 -- [-893.532] (-890.157) (-897.439) (-900.173) * [-891.868] (-893.504) (-895.533) (-893.802) -- 0:00:50
648000 -- (-891.634) (-889.268) (-892.801) [-893.093] * (-891.184) [-893.284] (-894.559) (-893.416) -- 0:00:49
648500 -- (-899.817) (-896.261) [-894.576] (-896.404) * (-887.770) (-890.550) (-898.753) [-891.040] -- 0:00:49
649000 -- (-891.670) (-892.712) (-893.399) [-892.013] * (-898.138) [-894.333] (-894.727) (-892.722) -- 0:00:49
649500 -- (-891.344) (-893.023) [-891.035] (-892.055) * (-893.010) (-893.697) [-892.101] (-890.074) -- 0:00:49
650000 -- [-892.527] (-889.464) (-889.931) (-889.899) * (-896.319) [-889.316] (-893.667) (-891.787) -- 0:00:49
Average standard deviation of split frequencies: 0.005796
650500 -- (-898.390) (-887.769) (-892.561) [-891.560] * (-891.988) [-890.687] (-891.932) (-890.528) -- 0:00:49
651000 -- (-894.420) [-891.073] (-896.685) (-896.231) * (-895.227) [-888.218] (-894.255) (-894.330) -- 0:00:49
651500 -- (-890.425) (-892.762) (-895.691) [-891.343] * (-894.085) [-893.559] (-895.600) (-891.530) -- 0:00:49
652000 -- (-897.575) [-897.507] (-895.349) (-892.407) * (-891.611) [-888.555] (-892.703) (-891.064) -- 0:00:49
652500 -- (-900.856) [-888.641] (-893.710) (-889.610) * (-890.079) [-889.141] (-893.369) (-896.021) -- 0:00:49
653000 -- (-893.645) (-888.427) (-892.438) [-891.149] * (-888.829) (-891.041) (-890.076) [-890.912] -- 0:00:49
653500 -- (-891.933) [-889.532] (-891.479) (-894.091) * (-887.304) (-893.090) (-902.009) [-890.973] -- 0:00:49
654000 -- (-894.200) (-895.039) (-891.515) [-889.651] * (-893.155) (-887.035) (-888.087) [-893.461] -- 0:00:49
654500 -- (-892.959) [-893.071] (-892.077) (-889.998) * (-891.958) [-889.438] (-889.014) (-893.012) -- 0:00:49
655000 -- [-891.367] (-895.828) (-896.787) (-889.263) * [-892.750] (-896.087) (-890.452) (-890.687) -- 0:00:48
Average standard deviation of split frequencies: 0.005749
655500 -- [-889.494] (-893.459) (-892.561) (-890.813) * [-888.848] (-899.985) (-890.924) (-891.066) -- 0:00:48
656000 -- (-890.407) (-889.476) (-893.230) [-893.472] * (-900.471) (-893.804) (-895.016) [-893.154] -- 0:00:48
656500 -- [-891.569] (-893.361) (-889.373) (-891.354) * (-895.640) (-893.966) [-890.787] (-889.857) -- 0:00:48
657000 -- (-892.646) (-892.749) [-890.199] (-891.040) * [-891.391] (-897.960) (-897.862) (-895.046) -- 0:00:48
657500 -- (-898.333) (-892.475) (-894.557) [-892.034] * (-887.711) (-895.376) (-894.900) [-896.258] -- 0:00:48
658000 -- (-894.727) (-894.845) (-893.331) [-891.131] * (-895.366) (-893.795) (-893.220) [-889.675] -- 0:00:48
658500 -- [-897.270] (-891.657) (-891.135) (-896.277) * (-894.718) [-892.465] (-889.591) (-890.611) -- 0:00:48
659000 -- (-890.982) (-888.508) (-900.990) [-895.861] * [-892.021] (-895.648) (-891.534) (-891.690) -- 0:00:48
659500 -- [-891.630] (-893.207) (-887.857) (-905.311) * (-894.463) (-896.769) (-890.659) [-891.939] -- 0:00:48
660000 -- [-892.375] (-893.323) (-890.009) (-894.709) * (-895.329) (-894.329) [-895.399] (-888.843) -- 0:00:48
Average standard deviation of split frequencies: 0.005708
660500 -- (-889.668) [-898.916] (-889.566) (-892.151) * (-893.120) [-893.951] (-888.587) (-890.822) -- 0:00:48
661000 -- (-895.036) [-893.420] (-895.958) (-894.972) * (-893.054) [-891.810] (-893.393) (-888.943) -- 0:00:48
661500 -- (-890.930) (-892.900) (-893.208) [-890.410] * (-900.673) (-889.974) [-893.744] (-892.922) -- 0:00:48
662000 -- (-888.132) (-891.380) [-889.973] (-889.383) * (-892.229) [-896.920] (-892.454) (-889.030) -- 0:00:47
662500 -- [-892.429] (-892.412) (-895.788) (-893.210) * [-893.641] (-893.814) (-890.522) (-895.397) -- 0:00:47
663000 -- (-890.000) (-891.336) (-893.830) [-892.104] * [-893.661] (-894.567) (-888.788) (-893.032) -- 0:00:47
663500 -- (-894.865) (-893.799) (-891.841) [-890.145] * (-895.199) (-891.674) (-894.567) [-895.130] -- 0:00:47
664000 -- [-892.819] (-889.240) (-891.404) (-892.214) * (-894.352) (-891.044) (-894.560) [-893.584] -- 0:00:48
664500 -- (-893.212) (-893.340) (-895.372) [-891.699] * (-892.162) [-890.805] (-892.210) (-889.768) -- 0:00:47
665000 -- [-887.373] (-892.430) (-894.504) (-890.967) * [-897.045] (-892.283) (-892.299) (-897.512) -- 0:00:47
Average standard deviation of split frequencies: 0.006370
665500 -- (-889.498) (-895.087) [-891.731] (-893.275) * (-895.339) (-894.135) [-892.387] (-893.640) -- 0:00:47
666000 -- (-893.752) (-889.254) [-891.833] (-892.426) * (-889.317) (-898.080) (-889.566) [-894.358] -- 0:00:47
666500 -- (-892.291) (-893.727) [-890.365] (-891.149) * [-890.334] (-891.576) (-894.774) (-888.668) -- 0:00:47
667000 -- [-888.596] (-892.606) (-891.656) (-893.091) * (-896.193) [-887.464] (-891.072) (-890.606) -- 0:00:47
667500 -- (-891.967) (-896.290) (-889.961) [-889.144] * (-894.465) [-894.753] (-889.851) (-895.304) -- 0:00:47
668000 -- (-895.061) (-891.331) (-891.456) [-888.794] * (-889.220) (-898.727) [-888.514] (-899.423) -- 0:00:47
668500 -- (-892.449) (-889.230) [-890.311] (-892.229) * [-893.173] (-892.562) (-892.743) (-890.559) -- 0:00:47
669000 -- (-895.340) [-890.144] (-896.725) (-890.117) * (-893.448) (-890.787) (-890.395) [-896.449] -- 0:00:47
669500 -- (-893.975) [-888.956] (-896.151) (-889.314) * (-895.462) (-889.252) (-890.097) [-891.426] -- 0:00:46
670000 -- (-890.702) [-891.951] (-889.426) (-889.423) * [-892.567] (-894.354) (-888.830) (-894.982) -- 0:00:46
Average standard deviation of split frequencies: 0.005623
670500 -- (-890.131) (-892.980) (-894.309) [-892.340] * (-890.140) [-895.182] (-894.403) (-897.860) -- 0:00:46
671000 -- (-893.362) (-889.644) (-890.356) [-888.587] * [-890.604] (-890.671) (-897.139) (-894.213) -- 0:00:47
671500 -- (-894.657) (-889.564) [-889.111] (-894.763) * (-893.531) (-893.397) [-893.847] (-891.447) -- 0:00:46
672000 -- (-892.488) (-892.123) [-889.135] (-890.782) * [-893.761] (-890.930) (-889.533) (-892.734) -- 0:00:46
672500 -- (-888.469) (-892.602) [-897.535] (-890.754) * [-890.113] (-891.502) (-900.104) (-893.374) -- 0:00:46
673000 -- (-893.381) (-890.157) [-890.366] (-888.769) * [-892.131] (-890.138) (-892.706) (-891.086) -- 0:00:46
673500 -- (-893.546) [-894.200] (-894.223) (-888.096) * [-887.410] (-886.928) (-894.400) (-893.351) -- 0:00:46
674000 -- [-889.687] (-888.079) (-897.458) (-893.555) * (-888.297) (-895.464) (-896.653) [-889.468] -- 0:00:46
674500 -- (-893.278) (-892.232) (-890.091) [-890.138] * (-889.322) [-894.331] (-891.181) (-895.203) -- 0:00:46
675000 -- (-892.624) [-888.268] (-895.265) (-894.802) * (-891.391) (-891.119) [-890.017] (-892.905) -- 0:00:46
Average standard deviation of split frequencies: 0.004881
675500 -- (-892.577) (-890.046) (-893.372) [-895.953] * [-893.455] (-894.193) (-898.752) (-889.952) -- 0:00:46
676000 -- (-891.424) (-895.599) [-889.025] (-896.430) * (-889.903) [-887.077] (-897.291) (-895.242) -- 0:00:46
676500 -- (-896.271) [-890.976] (-889.435) (-894.069) * (-890.975) [-888.513] (-891.242) (-895.271) -- 0:00:45
677000 -- [-891.129] (-891.012) (-890.323) (-903.669) * (-890.942) [-893.894] (-892.547) (-895.261) -- 0:00:45
677500 -- [-895.350] (-892.807) (-893.026) (-890.520) * (-896.079) [-892.849] (-890.559) (-896.812) -- 0:00:45
678000 -- (-890.397) [-891.083] (-894.461) (-890.672) * (-895.843) (-894.093) (-888.054) [-889.073] -- 0:00:46
678500 -- (-893.357) (-892.490) (-893.675) [-889.474] * (-889.920) [-892.710] (-891.594) (-891.079) -- 0:00:45
679000 -- [-890.306] (-895.025) (-889.502) (-892.585) * (-891.688) (-891.813) (-892.612) [-889.928] -- 0:00:45
679500 -- [-889.346] (-893.802) (-891.684) (-887.977) * [-890.443] (-897.229) (-895.804) (-894.404) -- 0:00:45
680000 -- [-889.177] (-893.131) (-889.820) (-891.604) * (-895.159) [-890.928] (-891.602) (-895.122) -- 0:00:45
Average standard deviation of split frequencies: 0.004848
680500 -- (-893.413) (-892.040) [-893.004] (-892.660) * [-889.896] (-890.766) (-891.619) (-894.844) -- 0:00:45
681000 -- (-893.940) (-893.423) [-889.515] (-891.938) * (-894.052) [-889.885] (-894.662) (-891.620) -- 0:00:45
681500 -- (-895.968) (-890.704) (-889.490) [-890.279] * [-891.611] (-892.795) (-895.689) (-891.262) -- 0:00:45
682000 -- (-896.651) [-888.953] (-892.959) (-894.075) * [-891.479] (-891.368) (-895.398) (-892.364) -- 0:00:45
682500 -- (-895.862) (-892.700) [-891.914] (-892.806) * [-891.693] (-896.442) (-891.503) (-898.587) -- 0:00:45
683000 -- (-887.603) [-887.751] (-894.391) (-893.227) * (-888.866) (-891.902) (-893.863) [-902.787] -- 0:00:45
683500 -- (-892.017) (-889.771) (-893.189) [-889.331] * (-888.663) [-891.503] (-889.283) (-893.762) -- 0:00:44
684000 -- (-893.974) (-894.879) (-895.341) [-891.060] * (-891.495) (-888.927) [-889.992] (-894.487) -- 0:00:44
684500 -- (-891.748) [-892.391] (-893.085) (-892.917) * (-896.057) (-892.765) (-892.560) [-892.803] -- 0:00:44
685000 -- [-893.475] (-895.246) (-889.318) (-890.685) * (-901.734) (-890.080) [-887.885] (-889.420) -- 0:00:45
Average standard deviation of split frequencies: 0.004810
685500 -- [-889.163] (-894.921) (-889.691) (-896.932) * (-898.556) [-894.139] (-889.663) (-898.283) -- 0:00:44
686000 -- (-888.493) (-890.806) [-889.867] (-894.841) * (-899.404) [-894.728] (-890.328) (-894.908) -- 0:00:44
686500 -- (-894.312) [-894.733] (-891.579) (-893.396) * (-893.630) (-892.357) (-889.841) [-894.706] -- 0:00:44
687000 -- (-891.293) [-893.981] (-890.489) (-891.859) * (-891.081) (-888.564) (-891.343) [-896.303] -- 0:00:44
687500 -- (-892.227) (-890.497) [-889.933] (-901.749) * (-891.349) [-887.760] (-889.954) (-894.716) -- 0:00:44
688000 -- [-894.360] (-892.447) (-895.469) (-896.893) * (-890.695) (-891.382) (-888.809) [-894.006] -- 0:00:44
688500 -- (-889.134) [-888.379] (-891.284) (-896.990) * (-893.212) (-888.295) (-890.964) [-889.408] -- 0:00:44
689000 -- (-890.512) (-901.234) [-895.729] (-894.997) * (-897.182) [-894.024] (-892.569) (-896.295) -- 0:00:44
689500 -- [-894.363] (-896.766) (-888.105) (-890.072) * (-891.760) [-888.008] (-888.795) (-894.465) -- 0:00:44
690000 -- (-894.065) (-897.201) [-889.462] (-892.924) * [-890.582] (-889.441) (-891.181) (-890.713) -- 0:00:44
Average standard deviation of split frequencies: 0.006143
690500 -- (-890.413) (-896.126) (-897.255) [-887.194] * (-892.204) (-890.975) [-897.588] (-891.760) -- 0:00:43
691000 -- (-887.433) (-891.456) [-899.187] (-891.288) * (-891.420) [-889.758] (-891.930) (-890.499) -- 0:00:43
691500 -- [-888.162] (-894.791) (-894.131) (-894.535) * (-887.655) (-888.726) [-888.725] (-891.439) -- 0:00:43
692000 -- (-890.309) [-891.878] (-893.042) (-892.415) * (-890.274) (-890.343) (-888.444) [-889.177] -- 0:00:44
692500 -- [-893.360] (-892.676) (-891.157) (-893.056) * (-891.659) (-891.670) (-893.853) [-893.327] -- 0:00:43
693000 -- (-896.695) (-888.192) [-890.998] (-892.159) * (-895.786) (-895.274) [-892.468] (-896.076) -- 0:00:43
693500 -- [-894.418] (-894.344) (-893.439) (-894.160) * (-895.729) [-894.920] (-892.373) (-893.177) -- 0:00:43
694000 -- (-895.141) (-890.630) [-888.834] (-897.843) * (-891.172) (-897.210) [-888.815] (-889.708) -- 0:00:43
694500 -- (-892.035) (-888.573) [-893.503] (-890.268) * [-890.870] (-896.479) (-893.146) (-891.786) -- 0:00:43
695000 -- (-890.657) (-891.286) [-893.741] (-894.488) * [-890.756] (-894.999) (-890.697) (-886.556) -- 0:00:43
Average standard deviation of split frequencies: 0.005418
695500 -- (-893.572) (-894.518) [-892.395] (-890.651) * (-897.727) (-893.214) (-895.684) [-890.371] -- 0:00:43
696000 -- (-890.699) (-894.176) [-888.904] (-892.079) * (-891.769) [-891.282] (-892.389) (-889.693) -- 0:00:43
696500 -- (-893.216) [-893.910] (-891.687) (-890.992) * (-892.661) (-892.455) (-888.407) [-892.558] -- 0:00:43
697000 -- [-890.301] (-889.743) (-901.830) (-894.569) * (-896.150) (-893.475) [-889.716] (-892.346) -- 0:00:43
697500 -- (-893.493) [-896.140] (-896.220) (-893.516) * [-892.683] (-889.689) (-892.428) (-890.496) -- 0:00:42
698000 -- [-893.082] (-893.011) (-893.638) (-894.860) * (-889.279) [-896.801] (-892.619) (-890.744) -- 0:00:42
698500 -- (-897.328) (-892.533) [-890.153] (-895.673) * (-892.015) (-895.158) [-894.093] (-887.847) -- 0:00:43
699000 -- (-893.097) (-892.153) [-892.745] (-892.848) * (-890.813) (-890.513) (-894.218) [-891.446] -- 0:00:43
699500 -- [-891.508] (-890.889) (-890.671) (-897.455) * (-890.415) (-894.315) (-890.256) [-890.073] -- 0:00:42
700000 -- (-892.132) [-893.331] (-889.151) (-897.510) * (-894.614) (-898.113) (-888.661) [-898.317] -- 0:00:42
Average standard deviation of split frequencies: 0.003364
700500 -- (-894.047) [-891.802] (-900.134) (-894.800) * (-898.937) (-899.353) [-889.953] (-893.493) -- 0:00:42
701000 -- (-892.802) [-893.474] (-892.235) (-895.835) * (-891.862) (-890.182) [-891.339] (-891.944) -- 0:00:42
701500 -- [-887.567] (-894.397) (-889.524) (-898.499) * [-888.844] (-896.616) (-890.753) (-900.349) -- 0:00:42
702000 -- (-892.320) (-894.028) (-894.815) [-893.962] * (-894.892) (-893.276) (-892.383) [-892.378] -- 0:00:42
702500 -- [-888.952] (-895.390) (-890.567) (-894.040) * (-894.057) (-898.393) (-896.510) [-891.740] -- 0:00:42
703000 -- (-896.929) [-889.460] (-889.963) (-892.920) * (-894.107) [-887.595] (-893.658) (-890.925) -- 0:00:42
703500 -- (-896.408) (-894.783) (-893.816) [-895.772] * [-891.628] (-892.469) (-893.315) (-891.184) -- 0:00:42
704000 -- (-893.371) [-888.521] (-891.249) (-897.900) * (-893.471) (-894.819) (-890.489) [-888.730] -- 0:00:42
704500 -- [-892.394] (-893.478) (-890.533) (-896.980) * [-890.153] (-893.165) (-890.841) (-889.881) -- 0:00:41
705000 -- (-889.864) [-893.175] (-889.541) (-891.589) * [-890.077] (-893.273) (-890.140) (-894.628) -- 0:00:41
Average standard deviation of split frequencies: 0.003339
705500 -- (-889.328) [-889.917] (-889.776) (-890.633) * [-891.681] (-892.762) (-887.724) (-891.172) -- 0:00:42
706000 -- [-889.994] (-893.115) (-891.911) (-892.444) * (-895.884) (-895.284) [-894.267] (-899.134) -- 0:00:42
706500 -- (-896.937) (-891.456) [-889.516] (-891.575) * (-896.624) (-891.933) (-891.842) [-891.433] -- 0:00:41
707000 -- (-888.785) (-893.266) (-891.544) [-889.233] * (-891.798) (-887.728) (-891.029) [-893.167] -- 0:00:41
707500 -- [-893.174] (-891.726) (-894.418) (-889.591) * [-892.782] (-892.965) (-895.864) (-890.058) -- 0:00:41
708000 -- (-887.992) (-892.133) [-891.318] (-894.424) * [-890.217] (-893.309) (-891.313) (-891.583) -- 0:00:41
708500 -- (-897.592) [-890.794] (-891.650) (-892.351) * (-894.509) (-887.114) (-892.240) [-890.660] -- 0:00:41
709000 -- (-891.669) [-888.283] (-895.951) (-890.538) * (-892.326) (-887.712) (-894.753) [-890.246] -- 0:00:41
709500 -- (-891.728) (-897.165) [-891.686] (-898.300) * (-895.319) (-888.192) [-892.825] (-890.837) -- 0:00:41
710000 -- (-890.425) (-890.582) [-894.929] (-892.944) * [-893.039] (-889.302) (-889.934) (-886.706) -- 0:00:41
Average standard deviation of split frequencies: 0.002653
710500 -- [-890.183] (-894.483) (-891.317) (-893.565) * [-891.955] (-888.392) (-890.361) (-890.738) -- 0:00:41
711000 -- (-890.908) (-895.651) [-894.238] (-900.559) * (-904.782) (-890.939) [-890.338] (-897.469) -- 0:00:41
711500 -- [-894.642] (-888.148) (-891.480) (-896.851) * (-896.464) (-892.114) (-891.091) [-891.490] -- 0:00:40
712000 -- [-890.463] (-897.752) (-895.269) (-893.688) * (-889.523) [-892.748] (-888.587) (-895.993) -- 0:00:40
712500 -- (-898.197) (-897.689) [-894.216] (-891.499) * (-892.457) (-894.635) [-892.159] (-890.583) -- 0:00:41
713000 -- (-896.183) [-891.254] (-895.057) (-891.021) * (-894.219) (-894.405) [-887.632] (-896.198) -- 0:00:41
713500 -- [-892.279] (-893.369) (-900.873) (-888.378) * (-890.357) (-893.386) (-893.080) [-892.177] -- 0:00:40
714000 -- (-900.743) (-891.921) (-897.576) [-892.682] * [-890.632] (-895.475) (-895.251) (-893.589) -- 0:00:40
714500 -- (-889.102) [-888.525] (-893.085) (-893.262) * [-895.581] (-896.257) (-892.920) (-894.916) -- 0:00:40
715000 -- (-892.153) (-890.257) [-891.344] (-891.306) * (-896.690) (-897.204) [-893.841] (-889.569) -- 0:00:40
Average standard deviation of split frequencies: 0.001975
715500 -- (-897.864) [-893.947] (-888.837) (-890.267) * (-891.054) (-893.179) (-893.603) [-889.259] -- 0:00:40
716000 -- (-892.003) (-893.685) [-889.265] (-889.312) * [-892.083] (-894.982) (-893.895) (-890.930) -- 0:00:40
716500 -- (-896.387) (-889.474) [-890.036] (-892.245) * [-889.355] (-895.595) (-894.027) (-890.407) -- 0:00:40
717000 -- (-890.386) [-890.164] (-890.575) (-892.739) * (-889.530) (-889.472) [-892.401] (-891.953) -- 0:00:40
717500 -- (-888.385) (-890.996) (-889.389) [-889.163] * (-895.440) (-890.080) (-893.083) [-890.815] -- 0:00:40
718000 -- (-890.193) (-891.214) (-889.782) [-898.355] * (-891.854) [-891.134] (-891.660) (-898.021) -- 0:00:40
718500 -- (-893.710) (-893.596) (-891.849) [-894.026] * (-890.488) (-896.431) [-888.402] (-894.380) -- 0:00:39
719000 -- (-893.603) (-897.253) (-894.337) [-892.982] * (-891.129) [-886.989] (-894.766) (-896.450) -- 0:00:39
719500 -- [-891.361] (-893.043) (-891.341) (-893.744) * (-890.920) (-891.417) [-891.366] (-893.942) -- 0:00:40
720000 -- [-890.403] (-895.243) (-892.573) (-894.563) * (-892.522) (-893.562) [-890.647] (-894.726) -- 0:00:40
Average standard deviation of split frequencies: 0.001962
720500 -- (-891.813) (-896.537) (-893.210) [-890.410] * [-892.621] (-893.545) (-891.622) (-895.898) -- 0:00:39
721000 -- [-893.538] (-891.211) (-898.409) (-893.134) * (-892.549) [-891.009] (-895.317) (-901.331) -- 0:00:39
721500 -- (-891.882) (-890.716) [-892.065] (-889.922) * (-893.546) (-895.500) (-893.677) [-890.373] -- 0:00:39
722000 -- (-895.413) (-893.726) [-891.089] (-889.983) * (-891.035) [-894.037] (-890.921) (-889.415) -- 0:00:39
722500 -- (-889.336) [-892.205] (-898.473) (-894.892) * (-892.126) [-889.734] (-889.570) (-890.158) -- 0:00:39
723000 -- (-899.544) [-889.358] (-891.511) (-890.368) * (-888.284) [-892.330] (-896.101) (-890.418) -- 0:00:39
723500 -- (-895.446) [-890.884] (-891.342) (-894.271) * (-889.701) (-893.880) (-894.313) [-892.398] -- 0:00:39
724000 -- (-888.255) (-889.268) [-892.766] (-890.108) * [-888.120] (-891.274) (-891.641) (-892.197) -- 0:00:39
724500 -- (-888.433) [-890.732] (-895.424) (-891.926) * (-891.185) [-890.044] (-899.131) (-897.388) -- 0:00:39
725000 -- (-894.092) (-895.987) [-892.044] (-893.529) * (-891.491) (-890.563) (-895.957) [-890.019] -- 0:00:39
Average standard deviation of split frequencies: 0.001948
725500 -- [-893.914] (-894.964) (-897.557) (-889.552) * (-889.623) (-890.817) [-895.511] (-896.697) -- 0:00:38
726000 -- [-892.173] (-890.821) (-892.855) (-891.639) * (-889.156) (-889.019) [-890.014] (-889.305) -- 0:00:38
726500 -- (-891.685) [-889.417] (-887.124) (-892.538) * (-889.003) (-895.689) [-893.401] (-889.879) -- 0:00:39
727000 -- [-890.618] (-890.576) (-889.897) (-890.393) * [-891.483] (-892.937) (-892.216) (-889.823) -- 0:00:39
727500 -- [-891.420] (-889.677) (-888.085) (-891.395) * (-889.217) (-893.355) (-892.072) [-890.021] -- 0:00:38
728000 -- [-896.417] (-889.877) (-890.481) (-891.174) * (-890.947) (-890.757) (-899.226) [-889.029] -- 0:00:38
728500 -- (-889.473) [-889.513] (-890.999) (-897.396) * (-893.031) (-889.951) [-890.117] (-889.859) -- 0:00:38
729000 -- (-892.300) (-891.276) [-892.769] (-888.715) * (-894.861) (-889.521) [-887.983] (-893.937) -- 0:00:38
729500 -- (-889.894) [-891.931] (-893.594) (-896.852) * (-889.127) (-891.556) [-891.732] (-889.689) -- 0:00:38
730000 -- (-893.307) (-892.075) [-890.204] (-898.724) * (-889.992) (-897.127) [-896.410] (-894.320) -- 0:00:38
Average standard deviation of split frequencies: 0.002581
730500 -- (-892.845) [-891.071] (-895.151) (-895.224) * [-891.470] (-894.092) (-890.674) (-889.447) -- 0:00:38
731000 -- (-895.450) [-891.823] (-893.149) (-896.583) * (-899.012) [-894.437] (-893.394) (-891.156) -- 0:00:38
731500 -- (-892.102) (-895.184) [-888.043] (-902.432) * (-893.255) (-899.062) (-892.758) [-891.433] -- 0:00:38
732000 -- (-892.084) [-889.830] (-888.685) (-896.428) * (-897.945) (-896.402) (-894.170) [-888.366] -- 0:00:38
732500 -- [-890.190] (-892.510) (-896.366) (-890.567) * [-888.603] (-889.185) (-890.558) (-892.962) -- 0:00:37
733000 -- (-895.109) (-893.256) (-889.018) [-888.661] * (-896.086) (-896.389) [-891.536] (-892.106) -- 0:00:38
733500 -- (-890.607) (-892.925) (-887.945) [-887.528] * (-891.355) (-893.986) (-891.975) [-888.770] -- 0:00:38
734000 -- (-891.741) [-897.366] (-897.760) (-892.662) * (-892.523) (-889.192) (-891.282) [-887.233] -- 0:00:38
734500 -- (-893.747) (-894.517) (-895.122) [-889.904] * (-892.313) (-890.411) [-888.562] (-890.557) -- 0:00:37
735000 -- [-889.643] (-892.580) (-899.754) (-890.957) * (-888.690) (-892.046) (-889.944) [-892.745] -- 0:00:37
Average standard deviation of split frequencies: 0.002562
735500 -- (-894.142) [-892.405] (-897.302) (-893.063) * (-893.251) (-893.097) (-888.761) [-890.639] -- 0:00:37
736000 -- (-890.226) (-893.239) (-896.107) [-893.581] * (-892.612) [-889.573] (-892.890) (-897.502) -- 0:00:37
736500 -- (-889.015) [-890.281] (-898.034) (-892.916) * (-892.828) (-894.159) [-889.696] (-888.811) -- 0:00:37
737000 -- (-889.941) [-900.539] (-895.244) (-895.064) * (-888.026) [-888.935] (-890.332) (-890.138) -- 0:00:37
737500 -- (-890.530) (-891.762) (-895.786) [-890.361] * (-891.733) [-890.986] (-888.767) (-887.680) -- 0:00:37
738000 -- (-895.594) (-890.111) [-891.052] (-895.377) * (-893.993) (-889.212) [-889.088] (-891.506) -- 0:00:37
738500 -- (-892.666) [-888.410] (-890.934) (-892.986) * (-889.776) [-895.893] (-889.970) (-895.003) -- 0:00:37
739000 -- (-892.999) (-897.405) (-892.953) [-890.958] * (-889.604) (-893.367) (-893.545) [-891.788] -- 0:00:37
739500 -- (-898.015) (-892.336) (-896.251) [-890.713] * [-890.855] (-893.851) (-895.266) (-889.956) -- 0:00:36
740000 -- (-896.976) [-890.020] (-890.965) (-888.808) * (-889.544) (-891.214) [-890.855] (-897.251) -- 0:00:37
Average standard deviation of split frequencies: 0.003819
740500 -- [-888.323] (-891.929) (-890.868) (-895.849) * (-896.509) (-892.988) [-889.577] (-895.907) -- 0:00:37
741000 -- [-888.236] (-890.235) (-893.939) (-894.501) * [-890.660] (-897.410) (-892.390) (-890.947) -- 0:00:37
741500 -- (-894.126) (-893.478) (-893.638) [-893.853] * (-888.593) (-894.642) [-890.261] (-888.515) -- 0:00:36
742000 -- (-895.025) (-895.912) (-893.093) [-889.398] * (-890.969) [-894.501] (-891.444) (-890.444) -- 0:00:36
742500 -- (-892.719) [-892.098] (-888.437) (-892.399) * (-891.256) (-891.556) (-892.932) [-890.926] -- 0:00:36
743000 -- (-898.665) (-892.808) [-890.006] (-892.955) * (-895.254) (-896.923) [-895.123] (-890.764) -- 0:00:36
743500 -- (-895.235) [-895.104] (-892.059) (-895.341) * (-890.933) (-897.846) [-887.300] (-894.172) -- 0:00:36
744000 -- (-896.341) (-890.883) [-890.697] (-893.349) * (-891.799) [-894.195] (-893.715) (-894.631) -- 0:00:36
744500 -- [-892.721] (-889.345) (-897.267) (-895.309) * (-890.155) (-888.463) [-893.982] (-892.698) -- 0:00:36
745000 -- (-899.176) [-891.938] (-892.799) (-905.223) * (-892.213) [-887.942] (-893.893) (-892.051) -- 0:00:36
Average standard deviation of split frequencies: 0.003791
745500 -- (-889.102) (-894.588) (-893.422) [-896.874] * (-892.883) (-890.712) (-897.301) [-889.698] -- 0:00:36
746000 -- [-893.551] (-892.143) (-893.196) (-891.474) * (-893.253) (-890.335) [-895.018] (-892.887) -- 0:00:36
746500 -- (-889.754) [-897.098] (-890.411) (-888.066) * (-892.980) (-898.888) [-888.927] (-896.634) -- 0:00:35
747000 -- [-891.389] (-891.363) (-889.079) (-891.916) * [-893.761] (-892.968) (-887.837) (-892.864) -- 0:00:36
747500 -- [-896.188] (-895.714) (-890.451) (-898.042) * (-892.191) (-899.148) (-890.801) [-889.335] -- 0:00:36
748000 -- [-897.431] (-892.797) (-892.615) (-901.070) * (-889.190) (-896.220) [-890.542] (-892.794) -- 0:00:36
748500 -- [-891.192] (-895.560) (-891.683) (-890.066) * (-892.220) [-896.733] (-891.472) (-887.756) -- 0:00:35
749000 -- (-892.085) (-895.360) [-888.128] (-892.945) * (-890.217) (-891.150) [-893.778] (-890.281) -- 0:00:35
749500 -- (-893.818) [-896.887] (-887.232) (-890.334) * (-888.396) [-888.909] (-890.179) (-886.767) -- 0:00:35
750000 -- [-888.420] (-890.553) (-893.015) (-891.039) * (-890.801) [-894.443] (-890.112) (-888.578) -- 0:00:35
Average standard deviation of split frequencies: 0.003140
750500 -- (-895.384) (-893.454) [-893.488] (-894.947) * (-887.580) (-898.137) [-896.235] (-892.616) -- 0:00:35
751000 -- [-891.728] (-890.156) (-903.269) (-891.451) * [-895.413] (-898.749) (-894.537) (-890.833) -- 0:00:35
751500 -- (-890.246) (-890.617) (-893.422) [-888.064] * (-894.020) (-894.931) (-889.601) [-890.154] -- 0:00:35
752000 -- [-893.522] (-895.594) (-890.817) (-889.085) * (-894.789) (-894.644) (-892.900) [-891.212] -- 0:00:35
752500 -- (-892.672) (-900.696) [-891.890] (-895.815) * (-891.727) (-892.031) [-889.069] (-889.562) -- 0:00:35
753000 -- (-889.464) [-888.940] (-891.392) (-892.193) * [-893.611] (-897.525) (-891.406) (-893.162) -- 0:00:35
753500 -- (-890.922) (-887.435) (-890.513) [-893.465] * (-896.907) (-892.863) (-893.483) [-892.537] -- 0:00:35
754000 -- [-890.277] (-893.546) (-891.986) (-892.136) * (-893.124) (-894.699) [-887.462] (-888.653) -- 0:00:35
754500 -- (-889.654) (-894.089) (-888.921) [-889.550] * (-889.819) (-891.567) (-893.351) [-890.560] -- 0:00:35
755000 -- (-891.416) (-906.900) [-892.947] (-888.308) * [-893.552] (-893.003) (-890.661) (-888.749) -- 0:00:35
Average standard deviation of split frequencies: 0.003118
755500 -- (-895.077) [-887.676] (-894.495) (-893.026) * (-893.001) [-891.961] (-892.404) (-892.569) -- 0:00:34
756000 -- (-887.749) (-897.150) [-890.146] (-893.832) * (-888.905) [-892.277] (-889.167) (-892.053) -- 0:00:34
756500 -- [-897.510] (-893.505) (-889.448) (-891.740) * (-887.597) (-892.824) [-893.014] (-890.275) -- 0:00:34
757000 -- [-895.099] (-891.777) (-889.985) (-892.910) * [-890.501] (-890.136) (-895.557) (-890.085) -- 0:00:34
757500 -- (-890.554) (-890.047) [-889.029] (-894.056) * [-891.224] (-890.941) (-893.194) (-898.026) -- 0:00:34
758000 -- (-897.559) [-888.325] (-892.321) (-893.329) * (-892.431) [-892.407] (-894.191) (-897.250) -- 0:00:34
758500 -- (-889.170) (-895.102) [-889.693] (-892.326) * (-887.893) (-892.201) (-894.267) [-890.933] -- 0:00:34
759000 -- (-890.732) (-893.769) [-893.034] (-890.313) * (-893.208) (-900.394) (-891.004) [-891.599] -- 0:00:34
759500 -- (-897.678) (-892.161) (-894.512) [-893.681] * (-895.351) [-898.337] (-890.905) (-893.530) -- 0:00:34
760000 -- (-892.154) (-892.849) [-888.883] (-892.118) * (-889.391) (-897.168) [-894.455] (-897.320) -- 0:00:34
Average standard deviation of split frequencies: 0.003099
760500 -- [-891.783] (-897.966) (-889.442) (-887.842) * (-888.854) (-893.081) [-891.018] (-889.997) -- 0:00:34
761000 -- (-890.272) (-895.303) (-894.819) [-892.543] * (-888.268) [-891.314] (-893.830) (-905.188) -- 0:00:34
761500 -- (-895.852) (-895.700) (-891.788) [-891.432] * (-889.614) (-891.237) [-891.189] (-892.465) -- 0:00:34
762000 -- (-891.732) (-890.327) [-893.073] (-892.454) * (-889.112) (-902.921) (-892.696) [-889.798] -- 0:00:34
762500 -- [-889.946] (-900.048) (-890.227) (-890.458) * (-893.015) (-895.609) [-888.194] (-891.480) -- 0:00:33
763000 -- (-897.673) (-891.696) (-889.237) [-888.007] * (-896.037) [-890.673] (-889.518) (-896.421) -- 0:00:33
763500 -- (-897.058) (-888.433) (-889.095) [-891.097] * (-890.885) (-896.733) (-890.576) [-890.903] -- 0:00:33
764000 -- (-890.586) (-897.061) (-890.459) [-893.363] * (-895.471) (-892.990) [-891.890] (-893.376) -- 0:00:33
764500 -- (-893.327) (-894.841) (-900.178) [-889.700] * (-894.088) (-894.116) [-889.505] (-893.160) -- 0:00:33
765000 -- (-894.429) (-893.168) (-898.082) [-892.587] * (-891.037) (-893.655) (-888.892) [-890.469] -- 0:00:33
Average standard deviation of split frequencies: 0.002462
765500 -- (-896.549) (-895.885) [-887.887] (-898.959) * (-897.625) (-889.802) (-892.944) [-891.127] -- 0:00:33
766000 -- (-898.764) (-901.451) (-893.361) [-890.558] * (-887.524) [-890.969] (-897.592) (-892.270) -- 0:00:33
766500 -- (-894.381) (-895.633) [-890.237] (-889.599) * (-890.188) (-890.003) (-894.673) [-893.206] -- 0:00:33
767000 -- (-894.776) (-895.945) (-893.858) [-891.274] * (-896.194) (-893.334) (-892.428) [-888.346] -- 0:00:33
767500 -- (-888.997) (-892.566) (-895.544) [-888.295] * [-894.147] (-891.848) (-886.702) (-890.426) -- 0:00:33
768000 -- (-894.298) (-893.171) (-888.233) [-890.464] * (-893.633) (-893.555) [-888.685] (-894.550) -- 0:00:33
768500 -- [-888.687] (-899.695) (-890.535) (-896.218) * (-889.801) (-890.635) (-887.481) [-891.366] -- 0:00:33
769000 -- (-892.936) [-890.365] (-891.475) (-893.633) * (-891.317) (-893.326) [-896.992] (-896.538) -- 0:00:33
769500 -- (-891.195) (-891.412) [-896.208] (-895.727) * (-892.033) [-892.121] (-895.294) (-894.125) -- 0:00:32
770000 -- [-893.935] (-892.809) (-902.328) (-899.042) * [-890.964] (-893.239) (-887.538) (-900.139) -- 0:00:32
Average standard deviation of split frequencies: 0.001835
770500 -- (-893.458) [-896.276] (-890.381) (-896.943) * (-894.141) (-896.256) [-887.961] (-896.866) -- 0:00:32
771000 -- (-890.191) (-894.662) (-894.634) [-897.907] * (-892.543) (-896.227) (-892.888) [-897.307] -- 0:00:32
771500 -- [-895.670] (-894.894) (-892.928) (-897.720) * (-891.056) (-892.371) (-893.270) [-893.324] -- 0:00:32
772000 -- [-890.893] (-891.000) (-891.939) (-897.846) * (-890.047) (-891.438) (-895.119) [-889.935] -- 0:00:32
772500 -- (-890.623) (-889.323) (-890.195) [-894.061] * (-896.059) [-891.511] (-899.105) (-887.684) -- 0:00:32
773000 -- [-893.754] (-898.070) (-891.572) (-893.607) * (-894.235) (-893.559) [-888.426] (-892.217) -- 0:00:32
773500 -- (-893.933) (-895.771) [-893.090] (-895.142) * (-891.632) [-897.293] (-896.709) (-896.142) -- 0:00:32
774000 -- (-889.835) (-894.121) [-889.844] (-895.982) * (-890.583) (-890.535) [-892.649] (-891.468) -- 0:00:32
774500 -- (-894.704) [-889.907] (-894.674) (-890.995) * (-889.064) [-891.538] (-894.908) (-898.431) -- 0:00:32
775000 -- [-896.521] (-890.923) (-894.073) (-893.277) * [-891.782] (-900.432) (-888.803) (-897.444) -- 0:00:32
Average standard deviation of split frequencies: 0.001215
775500 -- (-893.925) (-896.226) [-887.069] (-891.987) * (-894.260) (-892.282) (-889.815) [-888.278] -- 0:00:32
776000 -- (-890.424) (-892.343) [-896.926] (-887.650) * (-893.057) (-889.949) [-888.789] (-894.888) -- 0:00:32
776500 -- (-894.490) (-900.473) (-890.283) [-889.060] * (-894.775) (-891.283) (-896.770) [-888.995] -- 0:00:31
777000 -- (-887.676) (-896.439) (-899.951) [-889.962] * (-889.748) (-891.988) (-895.604) [-890.289] -- 0:00:31
777500 -- (-891.071) (-889.404) (-889.428) [-891.925] * (-893.458) [-892.568] (-895.701) (-893.718) -- 0:00:31
778000 -- [-890.022] (-887.691) (-894.795) (-890.583) * (-890.071) [-890.634] (-894.968) (-896.835) -- 0:00:31
778500 -- (-890.802) [-891.303] (-897.852) (-890.286) * (-892.458) [-890.224] (-895.529) (-897.770) -- 0:00:31
779000 -- (-900.069) (-893.875) (-898.235) [-896.688] * [-892.031] (-897.046) (-886.684) (-893.967) -- 0:00:31
779500 -- [-892.349] (-896.195) (-897.312) (-889.421) * (-890.263) (-898.624) [-889.916] (-896.757) -- 0:00:31
780000 -- (-889.821) (-894.139) [-892.461] (-890.720) * (-893.917) [-897.807] (-898.093) (-891.420) -- 0:00:31
Average standard deviation of split frequencies: 0.001208
780500 -- (-890.145) [-897.042] (-890.362) (-889.327) * [-890.421] (-889.412) (-899.830) (-893.493) -- 0:00:31
781000 -- (-894.576) (-893.988) [-894.124] (-891.229) * (-890.712) [-890.923] (-891.452) (-892.220) -- 0:00:31
781500 -- (-887.867) (-892.742) (-892.490) [-891.257] * (-894.348) [-891.900] (-891.698) (-891.689) -- 0:00:31
782000 -- (-889.749) [-887.920] (-894.452) (-892.455) * (-891.922) (-896.891) [-892.192] (-890.318) -- 0:00:31
782500 -- (-892.040) (-889.039) [-892.360] (-890.830) * (-891.083) (-895.852) [-891.516] (-891.960) -- 0:00:31
783000 -- (-896.615) (-894.684) (-893.616) [-893.634] * (-891.297) [-893.703] (-892.342) (-891.149) -- 0:00:31
783500 -- (-891.907) (-900.509) [-890.217] (-891.463) * (-892.931) [-889.589] (-896.766) (-889.469) -- 0:00:30
784000 -- (-896.083) (-888.627) (-888.917) [-892.859] * (-891.116) (-890.159) [-893.296] (-889.456) -- 0:00:30
784500 -- [-891.714] (-892.352) (-893.545) (-902.400) * [-891.817] (-891.707) (-891.797) (-890.488) -- 0:00:30
785000 -- (-890.450) [-894.420] (-891.217) (-891.152) * [-897.928] (-897.595) (-894.291) (-893.572) -- 0:00:30
Average standard deviation of split frequencies: 0.001200
785500 -- (-895.884) (-891.849) (-891.561) [-892.627] * (-899.325) (-893.211) (-890.479) [-892.021] -- 0:00:30
786000 -- (-890.541) [-890.836] (-892.696) (-894.225) * (-890.755) (-891.264) [-896.674] (-895.731) -- 0:00:30
786500 -- (-892.045) [-894.307] (-894.859) (-892.308) * [-890.866] (-888.803) (-891.526) (-891.013) -- 0:00:30
787000 -- (-895.390) (-893.674) (-897.425) [-891.540] * (-895.332) [-891.182] (-892.290) (-894.659) -- 0:00:30
787500 -- (-889.224) [-890.694] (-888.135) (-892.743) * (-890.987) (-892.314) [-890.668] (-890.597) -- 0:00:30
788000 -- (-893.312) [-893.071] (-891.152) (-887.395) * (-890.231) (-894.843) [-890.507] (-889.083) -- 0:00:30
788500 -- (-897.710) [-892.114] (-893.632) (-890.544) * (-891.166) (-895.479) [-888.755] (-892.018) -- 0:00:30
789000 -- (-896.536) [-891.021] (-898.490) (-892.673) * [-889.499] (-894.207) (-891.933) (-896.030) -- 0:00:30
789500 -- (-899.335) (-888.513) (-898.348) [-891.964] * (-887.620) (-890.511) [-890.743] (-890.975) -- 0:00:30
790000 -- (-892.030) (-891.306) (-893.477) [-894.592] * (-900.050) (-895.291) [-888.323] (-894.313) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
790500 -- [-890.664] (-890.265) (-892.311) (-893.653) * (-902.393) (-888.814) [-892.533] (-892.168) -- 0:00:29
791000 -- (-892.719) [-893.722] (-896.639) (-891.197) * (-895.414) (-892.435) [-891.069] (-893.056) -- 0:00:29
791500 -- (-892.401) [-895.838] (-890.267) (-888.743) * (-894.972) [-891.648] (-892.434) (-891.880) -- 0:00:29
792000 -- (-893.245) (-902.957) [-888.215] (-896.071) * (-890.404) [-891.385] (-895.680) (-894.955) -- 0:00:29
792500 -- [-892.332] (-893.073) (-894.526) (-899.796) * (-889.672) [-893.096] (-893.222) (-898.314) -- 0:00:29
793000 -- (-896.322) (-892.016) (-895.098) [-892.095] * (-893.862) [-895.650] (-895.367) (-894.168) -- 0:00:29
793500 -- (-889.790) (-891.088) [-890.115] (-894.565) * (-897.067) [-891.267] (-897.874) (-894.044) -- 0:00:29
794000 -- (-886.878) [-891.998] (-888.895) (-893.089) * (-893.287) (-891.533) [-892.274] (-892.582) -- 0:00:29
794500 -- [-891.496] (-892.269) (-891.019) (-892.049) * [-893.522] (-896.277) (-889.219) (-896.898) -- 0:00:29
795000 -- (-895.785) (-891.460) [-891.389] (-895.743) * (-890.875) (-900.680) [-891.986] (-892.689) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
795500 -- (-892.599) (-890.606) [-895.871] (-895.037) * (-894.813) (-890.553) [-891.926] (-898.833) -- 0:00:29
796000 -- [-891.665] (-891.673) (-889.740) (-894.632) * [-889.848] (-889.792) (-888.334) (-898.232) -- 0:00:29
796500 -- [-891.509] (-893.125) (-890.483) (-895.230) * (-895.213) [-890.894] (-897.997) (-895.230) -- 0:00:29
797000 -- (-893.315) (-901.501) [-892.530] (-889.886) * [-891.768] (-887.371) (-891.410) (-892.209) -- 0:00:29
797500 -- (-893.617) (-897.695) [-891.794] (-894.871) * (-895.377) [-891.004] (-898.395) (-896.300) -- 0:00:28
798000 -- (-895.518) (-897.077) (-894.970) [-890.291] * [-894.458] (-893.340) (-893.936) (-892.416) -- 0:00:28
798500 -- (-894.859) (-894.293) (-892.117) [-891.750] * [-901.948] (-892.866) (-889.044) (-902.067) -- 0:00:28
799000 -- (-889.837) (-893.318) (-897.950) [-891.577] * [-889.615] (-895.314) (-900.969) (-891.248) -- 0:00:28
799500 -- (-888.679) (-890.810) (-894.933) [-888.992] * [-894.576] (-900.231) (-900.969) (-891.507) -- 0:00:28
800000 -- [-889.219] (-899.932) (-897.192) (-892.108) * (-892.640) (-896.749) (-892.684) [-891.946] -- 0:00:28
Average standard deviation of split frequencies: 0.000000
800500 -- (-892.770) (-892.165) [-889.597] (-893.021) * [-891.047] (-896.677) (-888.899) (-895.050) -- 0:00:28
801000 -- (-892.977) [-890.238] (-890.233) (-890.718) * (-890.673) [-891.443] (-893.819) (-888.944) -- 0:00:28
801500 -- [-893.737] (-893.853) (-896.867) (-891.854) * (-890.051) (-898.302) [-887.958] (-892.856) -- 0:00:28
802000 -- [-888.957] (-896.318) (-890.106) (-890.624) * (-892.942) [-893.937] (-889.445) (-893.520) -- 0:00:28
802500 -- (-890.705) (-890.534) (-896.011) [-890.045] * (-895.962) [-891.352] (-891.712) (-895.596) -- 0:00:28
803000 -- [-892.207] (-892.114) (-893.920) (-892.736) * [-891.254] (-904.368) (-888.844) (-892.052) -- 0:00:28
803500 -- (-889.704) [-891.074] (-895.536) (-889.147) * [-891.126] (-894.201) (-890.304) (-888.434) -- 0:00:28
804000 -- [-890.194] (-893.106) (-894.253) (-894.436) * (-892.535) (-894.468) [-889.709] (-891.668) -- 0:00:28
804500 -- (-887.766) (-897.801) [-891.577] (-895.852) * (-894.491) (-894.131) (-891.938) [-894.218] -- 0:00:27
805000 -- [-891.206] (-895.645) (-896.674) (-893.583) * (-894.480) [-896.700] (-895.248) (-892.315) -- 0:00:27
Average standard deviation of split frequencies: 0.000585
805500 -- [-887.319] (-892.100) (-895.794) (-892.129) * (-894.579) (-892.755) [-891.633] (-890.613) -- 0:00:27
806000 -- (-895.518) (-894.532) (-891.874) [-893.523] * (-897.213) (-897.377) [-890.816] (-889.345) -- 0:00:27
806500 -- [-891.472] (-896.641) (-894.294) (-893.237) * [-894.030] (-889.352) (-895.937) (-891.353) -- 0:00:27
807000 -- (-892.975) (-893.792) (-891.535) [-893.306] * (-889.783) (-891.235) [-888.138] (-894.381) -- 0:00:27
807500 -- [-896.205] (-888.815) (-890.945) (-894.442) * (-889.518) (-891.622) (-892.757) [-893.151] -- 0:00:27
808000 -- (-891.290) (-893.115) [-888.143] (-893.530) * [-888.545] (-896.141) (-890.257) (-890.052) -- 0:00:27
808500 -- (-887.687) [-888.617] (-894.484) (-895.627) * (-889.696) (-892.302) [-890.275] (-895.199) -- 0:00:27
809000 -- (-890.303) (-891.810) [-889.841] (-893.425) * (-889.385) (-894.537) (-900.875) [-894.512] -- 0:00:27
809500 -- (-895.243) [-889.339] (-891.240) (-895.411) * (-892.551) [-892.273] (-892.731) (-889.201) -- 0:00:27
810000 -- (-890.869) (-897.845) (-892.439) [-891.233] * [-887.689] (-893.716) (-891.078) (-894.348) -- 0:00:27
Average standard deviation of split frequencies: 0.000582
810500 -- (-891.242) (-893.169) (-887.872) [-888.350] * (-890.283) (-889.312) [-893.839] (-896.909) -- 0:00:27
811000 -- (-892.893) (-895.502) [-890.574] (-892.464) * (-896.417) (-891.842) (-894.671) [-890.409] -- 0:00:27
811500 -- (-887.667) (-902.265) (-888.242) [-890.896] * (-891.958) [-896.257] (-889.788) (-894.092) -- 0:00:26
812000 -- [-894.621] (-891.168) (-892.010) (-893.754) * [-893.794] (-896.027) (-892.482) (-892.886) -- 0:00:26
812500 -- (-901.445) (-896.014) [-892.585] (-888.998) * (-899.423) (-891.579) [-889.761] (-891.181) -- 0:00:26
813000 -- (-897.242) (-891.880) (-891.819) [-895.371] * (-898.446) [-892.407] (-894.388) (-894.554) -- 0:00:26
813500 -- (-896.633) (-894.532) (-897.521) [-891.503] * [-899.668] (-892.169) (-894.619) (-895.601) -- 0:00:26
814000 -- (-891.497) [-888.733] (-897.790) (-889.503) * [-890.850] (-889.280) (-892.707) (-896.444) -- 0:00:26
814500 -- (-889.767) [-891.441] (-890.590) (-889.926) * (-888.992) (-895.913) (-890.004) [-891.223] -- 0:00:26
815000 -- [-893.571] (-890.213) (-890.521) (-892.027) * [-887.285] (-892.452) (-891.405) (-895.636) -- 0:00:26
Average standard deviation of split frequencies: 0.002311
815500 -- (-896.260) (-892.988) [-889.992] (-890.018) * [-892.452] (-897.662) (-893.324) (-894.138) -- 0:00:26
816000 -- (-892.999) (-887.587) (-892.459) [-891.052] * (-890.382) [-891.853] (-891.435) (-890.475) -- 0:00:26
816500 -- (-892.292) (-890.137) (-889.494) [-890.230] * [-895.114] (-893.637) (-893.042) (-891.458) -- 0:00:26
817000 -- (-891.051) [-891.037] (-890.939) (-894.564) * (-894.550) [-888.357] (-894.877) (-892.210) -- 0:00:26
817500 -- [-895.721] (-893.757) (-890.704) (-895.098) * (-889.817) (-897.403) (-889.016) [-891.567] -- 0:00:26
818000 -- [-893.275] (-888.772) (-895.321) (-890.818) * (-892.662) [-889.840] (-889.171) (-890.882) -- 0:00:26
818500 -- (-894.639) (-895.533) [-891.278] (-895.455) * [-893.900] (-895.217) (-892.701) (-891.216) -- 0:00:25
819000 -- (-893.793) (-892.505) (-890.524) [-895.645] * (-892.275) (-896.590) [-891.404] (-902.014) -- 0:00:25
819500 -- (-905.104) (-892.468) [-890.818] (-896.659) * (-891.438) [-887.038] (-895.843) (-891.583) -- 0:00:25
820000 -- (-889.172) [-889.136] (-893.857) (-893.164) * [-890.573] (-888.862) (-889.507) (-895.059) -- 0:00:25
Average standard deviation of split frequencies: 0.002872
820500 -- [-894.962] (-890.000) (-894.255) (-900.486) * (-890.387) (-894.125) [-888.345] (-890.514) -- 0:00:25
821000 -- (-889.711) [-887.749] (-892.496) (-896.294) * (-895.304) (-893.044) [-888.723] (-893.849) -- 0:00:25
821500 -- (-891.451) [-891.860] (-887.424) (-889.777) * (-892.439) (-897.634) [-896.513] (-888.462) -- 0:00:25
822000 -- [-888.017] (-891.026) (-896.681) (-888.570) * (-892.086) (-901.256) [-890.314] (-893.587) -- 0:00:25
822500 -- [-890.112] (-888.615) (-898.665) (-889.397) * [-897.025] (-900.826) (-890.432) (-891.589) -- 0:00:25
823000 -- (-888.569) (-891.833) [-895.748] (-899.355) * [-888.660] (-893.907) (-888.837) (-893.373) -- 0:00:25
823500 -- [-893.685] (-891.153) (-892.840) (-895.171) * (-890.936) (-895.979) (-890.244) [-889.474] -- 0:00:25
824000 -- (-893.122) [-890.322] (-892.891) (-899.536) * [-890.065] (-887.271) (-892.561) (-890.506) -- 0:00:25
824500 -- (-889.698) (-888.477) (-888.619) [-890.770] * [-891.886] (-892.457) (-892.451) (-894.245) -- 0:00:25
825000 -- (-889.538) [-899.145] (-896.523) (-894.291) * [-893.396] (-891.035) (-890.676) (-890.782) -- 0:00:25
Average standard deviation of split frequencies: 0.001712
825500 -- (-892.182) (-897.765) [-889.332] (-890.443) * (-895.163) (-893.245) (-901.753) [-889.238] -- 0:00:24
826000 -- (-888.955) (-890.701) (-893.524) [-892.420] * (-900.436) (-899.850) [-898.464] (-891.405) -- 0:00:24
826500 -- (-890.889) [-892.885] (-890.047) (-890.081) * [-895.566] (-896.606) (-890.035) (-898.715) -- 0:00:24
827000 -- (-890.508) (-890.792) [-895.075] (-891.008) * (-888.893) (-897.392) (-894.589) [-890.516] -- 0:00:24
827500 -- (-891.588) [-893.060] (-888.872) (-894.252) * [-890.681] (-892.543) (-894.545) (-896.469) -- 0:00:24
828000 -- [-892.176] (-895.102) (-890.213) (-890.200) * [-896.247] (-890.612) (-890.946) (-894.929) -- 0:00:24
828500 -- (-899.493) (-894.208) [-890.135] (-893.162) * (-893.491) (-894.128) [-892.816] (-895.134) -- 0:00:24
829000 -- (-896.660) [-889.436] (-891.473) (-892.036) * [-893.582] (-893.678) (-900.399) (-890.784) -- 0:00:24
829500 -- (-896.334) [-893.168] (-892.307) (-893.657) * (-893.173) [-890.170] (-897.028) (-894.218) -- 0:00:24
830000 -- [-896.523] (-893.140) (-895.208) (-896.781) * (-892.703) [-888.702] (-889.203) (-896.810) -- 0:00:24
Average standard deviation of split frequencies: 0.002270
830500 -- (-892.987) [-891.073] (-899.464) (-889.408) * [-889.979] (-892.932) (-889.611) (-891.759) -- 0:00:24
831000 -- (-894.289) (-896.904) (-896.761) [-890.320] * (-893.617) (-892.213) (-894.280) [-889.149] -- 0:00:24
831500 -- [-891.823] (-890.020) (-896.440) (-895.290) * (-893.190) [-889.267] (-891.660) (-891.824) -- 0:00:24
832000 -- (-891.663) (-892.363) [-889.316] (-891.679) * (-890.704) [-891.758] (-892.257) (-892.190) -- 0:00:24
832500 -- (-894.485) (-892.909) (-895.287) [-895.121] * (-889.519) (-889.779) (-897.533) [-894.446] -- 0:00:23
833000 -- (-888.215) (-898.389) [-894.543] (-888.962) * (-898.833) (-890.456) (-893.896) [-890.825] -- 0:00:23
833500 -- (-891.753) (-895.179) (-890.171) [-889.901] * (-891.162) [-891.387] (-895.213) (-888.719) -- 0:00:23
834000 -- (-889.853) (-887.934) [-891.521] (-892.768) * [-893.798] (-894.418) (-889.198) (-891.087) -- 0:00:23
834500 -- (-887.693) (-888.905) [-889.507] (-892.704) * (-892.361) [-895.989] (-889.652) (-891.289) -- 0:00:23
835000 -- (-893.496) (-892.471) [-895.603] (-891.151) * (-890.954) (-895.089) [-891.978] (-892.496) -- 0:00:23
Average standard deviation of split frequencies: 0.002256
835500 -- (-900.467) (-892.864) [-891.707] (-887.983) * (-892.104) (-898.758) (-892.207) [-892.371] -- 0:00:23
836000 -- [-892.509] (-888.444) (-891.942) (-900.780) * (-894.129) [-890.189] (-893.180) (-893.311) -- 0:00:23
836500 -- (-892.711) [-893.912] (-891.641) (-891.537) * (-893.882) (-890.942) [-892.567] (-890.282) -- 0:00:23
837000 -- (-894.922) (-893.414) [-896.294] (-893.299) * (-896.914) (-898.241) (-890.082) [-888.211] -- 0:00:23
837500 -- (-889.749) [-891.394] (-896.238) (-895.576) * [-890.248] (-894.507) (-892.036) (-889.620) -- 0:00:23
838000 -- [-891.330] (-893.922) (-895.552) (-894.537) * (-891.874) (-893.444) [-897.388] (-888.971) -- 0:00:23
838500 -- (-890.434) [-892.601] (-892.021) (-891.171) * (-895.148) (-895.849) (-893.702) [-894.696] -- 0:00:23
839000 -- [-892.713] (-891.677) (-889.775) (-900.489) * (-894.660) (-896.796) [-895.782] (-891.421) -- 0:00:23
839500 -- (-890.130) [-895.516] (-887.610) (-896.177) * (-895.466) (-891.506) [-887.229] (-893.526) -- 0:00:22
840000 -- [-892.977] (-891.502) (-891.001) (-891.469) * (-893.318) (-897.479) [-892.886] (-891.543) -- 0:00:22
Average standard deviation of split frequencies: 0.002804
840500 -- [-892.477] (-891.091) (-894.638) (-893.484) * (-890.349) (-891.334) (-890.291) [-894.147] -- 0:00:22
841000 -- [-890.819] (-891.743) (-904.494) (-893.825) * (-897.634) [-891.575] (-893.168) (-894.020) -- 0:00:22
841500 -- (-899.496) [-897.645] (-896.882) (-895.957) * (-890.658) (-895.800) [-889.137] (-892.025) -- 0:00:22
842000 -- (-893.399) (-898.772) (-891.434) [-889.566] * (-891.679) (-897.969) (-888.564) [-894.651] -- 0:00:22
842500 -- (-893.505) (-895.691) (-899.050) [-890.878] * (-895.042) (-892.275) [-889.906] (-889.427) -- 0:00:22
843000 -- [-891.939] (-891.626) (-891.924) (-891.635) * [-888.713] (-892.325) (-890.767) (-889.587) -- 0:00:22
843500 -- (-887.869) (-892.137) (-892.032) [-895.322] * [-896.996] (-889.701) (-894.546) (-893.343) -- 0:00:22
844000 -- [-890.135] (-894.460) (-889.926) (-891.764) * (-891.143) (-895.588) (-894.886) [-890.719] -- 0:00:22
844500 -- (-890.812) (-894.451) [-889.293] (-892.866) * (-893.424) [-890.236] (-894.186) (-899.057) -- 0:00:22
845000 -- (-888.078) [-893.408] (-894.871) (-888.320) * (-897.355) (-895.940) (-889.444) [-892.985] -- 0:00:22
Average standard deviation of split frequencies: 0.003343
845500 -- (-893.605) [-890.029] (-892.901) (-891.554) * (-894.333) (-891.256) (-895.633) [-892.606] -- 0:00:22
846000 -- (-896.658) (-899.070) (-891.884) [-890.267] * [-898.007] (-897.038) (-898.262) (-891.492) -- 0:00:22
846500 -- (-894.001) (-892.469) (-897.251) [-894.258] * (-891.939) [-888.522] (-891.417) (-887.950) -- 0:00:21
847000 -- (-896.125) [-889.138] (-891.552) (-890.963) * (-895.516) (-895.310) (-894.768) [-895.452] -- 0:00:21
847500 -- [-890.788] (-888.639) (-899.217) (-891.931) * (-895.453) (-889.429) (-894.404) [-895.002] -- 0:00:21
848000 -- (-894.952) (-897.411) [-894.671] (-900.708) * (-890.592) (-890.269) [-898.059] (-893.118) -- 0:00:21
848500 -- (-892.286) [-897.104] (-891.052) (-897.801) * [-898.165] (-890.012) (-901.150) (-895.648) -- 0:00:21
849000 -- [-898.633] (-896.340) (-892.171) (-897.357) * (-896.080) [-889.666] (-890.500) (-889.611) -- 0:00:21
849500 -- (-893.697) (-888.982) [-889.491] (-894.753) * (-896.451) (-891.770) [-887.791] (-888.765) -- 0:00:21
850000 -- (-891.021) [-888.435] (-891.243) (-895.543) * (-894.327) (-894.601) [-888.327] (-891.256) -- 0:00:21
Average standard deviation of split frequencies: 0.002217
850500 -- [-890.290] (-894.968) (-896.514) (-894.372) * [-894.052] (-892.427) (-893.113) (-893.511) -- 0:00:21
851000 -- (-892.983) (-892.586) [-890.706] (-895.915) * (-891.157) (-889.883) [-891.375] (-890.500) -- 0:00:21
851500 -- (-893.958) [-891.333] (-895.664) (-891.499) * [-896.258] (-891.389) (-890.024) (-890.183) -- 0:00:21
852000 -- (-892.673) (-888.169) (-891.481) [-892.889] * (-895.351) (-891.565) (-894.959) [-891.249] -- 0:00:21
852500 -- (-888.687) [-889.373] (-890.026) (-893.003) * (-890.651) (-892.097) (-891.979) [-890.220] -- 0:00:21
853000 -- (-888.602) [-890.842] (-904.170) (-890.614) * [-892.872] (-891.326) (-895.021) (-892.948) -- 0:00:21
853500 -- (-891.466) (-892.647) (-890.993) [-897.582] * (-889.838) [-889.522] (-890.928) (-889.625) -- 0:00:20
854000 -- (-891.230) (-891.998) [-891.890] (-889.433) * [-892.276] (-890.930) (-890.713) (-890.715) -- 0:00:20
854500 -- (-893.959) (-889.465) [-892.585] (-894.662) * (-893.382) [-891.131] (-889.212) (-893.714) -- 0:00:20
855000 -- [-893.809] (-890.242) (-893.822) (-894.006) * (-888.849) (-891.128) (-891.604) [-893.976] -- 0:00:20
Average standard deviation of split frequencies: 0.002754
855500 -- (-888.097) [-890.829] (-897.065) (-892.998) * (-888.618) [-890.080] (-888.977) (-888.813) -- 0:00:20
856000 -- [-888.416] (-892.246) (-900.599) (-895.881) * (-895.858) (-889.255) (-891.164) [-890.813] -- 0:00:20
856500 -- (-888.649) (-893.014) [-895.583] (-900.147) * [-892.910] (-890.435) (-889.824) (-889.627) -- 0:00:20
857000 -- (-895.901) (-895.603) [-895.030] (-900.500) * (-897.910) (-894.958) (-889.799) [-893.313] -- 0:00:20
857500 -- (-892.620) (-893.558) [-889.576] (-891.580) * (-899.700) [-890.538] (-888.752) (-890.896) -- 0:00:20
858000 -- (-895.087) (-891.180) (-892.454) [-892.061] * (-890.599) (-893.283) [-892.384] (-892.834) -- 0:00:20
858500 -- (-892.217) (-891.757) (-891.445) [-891.125] * (-887.565) (-896.927) [-891.339] (-890.939) -- 0:00:20
859000 -- (-889.965) (-891.131) [-890.622] (-890.373) * (-889.320) [-893.796] (-892.813) (-895.500) -- 0:00:20
859500 -- (-891.517) [-890.599] (-890.583) (-891.991) * [-893.031] (-887.982) (-895.210) (-893.512) -- 0:00:20
860000 -- (-891.758) [-890.006] (-892.092) (-892.330) * (-893.063) (-891.065) [-893.517] (-890.315) -- 0:00:20
Average standard deviation of split frequencies: 0.003834
860500 -- (-894.939) (-892.384) [-895.288] (-896.323) * (-897.459) (-892.642) [-895.304] (-889.977) -- 0:00:19
861000 -- [-892.649] (-897.396) (-891.075) (-895.102) * [-890.125] (-891.993) (-895.004) (-892.124) -- 0:00:19
861500 -- (-891.759) (-896.885) (-892.695) [-895.127] * (-890.494) [-891.696] (-889.357) (-892.109) -- 0:00:19
862000 -- (-891.103) [-898.608] (-889.927) (-889.155) * [-890.720] (-895.965) (-892.062) (-889.207) -- 0:00:19
862500 -- (-893.034) (-896.731) (-890.105) [-889.759] * (-892.653) [-892.160] (-890.975) (-890.058) -- 0:00:19
863000 -- (-894.603) [-895.971] (-888.134) (-892.673) * (-896.067) (-899.899) (-892.456) [-891.327] -- 0:00:19
863500 -- (-889.583) [-896.528] (-890.331) (-894.960) * [-891.530] (-902.097) (-893.770) (-890.772) -- 0:00:19
864000 -- (-890.089) (-898.981) (-895.041) [-889.253] * [-892.447] (-892.195) (-896.017) (-894.748) -- 0:00:19
864500 -- [-890.861] (-892.446) (-892.086) (-895.062) * (-897.983) (-889.452) (-901.003) [-891.699] -- 0:00:19
865000 -- (-892.670) (-906.090) (-893.007) [-893.044] * (-893.699) (-888.911) (-901.968) [-893.367] -- 0:00:19
Average standard deviation of split frequencies: 0.003266
865500 -- (-889.496) (-895.907) [-891.633] (-892.784) * (-889.463) [-889.700] (-890.569) (-897.775) -- 0:00:19
866000 -- (-889.049) [-893.831] (-898.506) (-893.508) * (-891.641) (-891.133) [-888.515] (-900.203) -- 0:00:19
866500 -- [-898.377] (-892.077) (-896.671) (-891.684) * [-892.646] (-892.694) (-889.080) (-894.434) -- 0:00:19
867000 -- (-891.003) [-888.722] (-895.346) (-892.492) * (-897.123) (-893.944) (-893.627) [-889.857] -- 0:00:19
867500 -- [-892.245] (-889.697) (-893.560) (-896.864) * (-892.821) (-898.284) (-888.557) [-891.655] -- 0:00:18
868000 -- (-894.596) [-892.712] (-888.721) (-893.762) * (-892.042) (-891.500) (-891.984) [-891.633] -- 0:00:18
868500 -- (-892.361) [-892.805] (-895.561) (-893.678) * (-892.581) (-893.602) [-891.168] (-891.834) -- 0:00:18
869000 -- (-893.189) (-890.339) (-900.591) [-895.592] * [-888.642] (-894.350) (-892.134) (-898.439) -- 0:00:18
869500 -- (-889.926) [-891.523] (-895.332) (-888.806) * (-888.111) (-893.138) [-889.236] (-889.874) -- 0:00:18
870000 -- [-896.011] (-894.982) (-892.930) (-898.886) * (-894.334) (-892.077) (-893.199) [-889.916] -- 0:00:18
Average standard deviation of split frequencies: 0.003249
870500 -- (-893.908) [-888.510] (-894.401) (-891.900) * (-892.835) (-892.943) [-890.202] (-891.934) -- 0:00:18
871000 -- (-894.322) [-886.332] (-893.803) (-890.701) * (-895.670) (-896.543) [-892.268] (-892.835) -- 0:00:18
871500 -- (-892.771) (-894.724) (-897.038) [-895.759] * (-890.409) [-893.451] (-891.397) (-896.172) -- 0:00:18
872000 -- [-890.375] (-890.733) (-893.289) (-891.364) * (-891.960) [-891.530] (-897.752) (-892.844) -- 0:00:18
872500 -- [-888.390] (-900.563) (-894.019) (-889.784) * (-891.344) (-892.522) (-891.076) [-889.628] -- 0:00:18
873000 -- (-893.130) [-899.781] (-894.055) (-888.904) * (-890.907) (-891.380) [-895.855] (-893.943) -- 0:00:18
873500 -- [-891.966] (-894.008) (-893.027) (-889.197) * (-890.467) [-890.262] (-890.196) (-888.758) -- 0:00:18
874000 -- (-896.019) (-890.688) [-888.081] (-890.817) * (-888.673) (-888.913) [-894.155] (-892.483) -- 0:00:18
874500 -- (-894.385) (-895.900) (-892.062) [-888.340] * (-891.069) (-888.854) [-893.266] (-894.071) -- 0:00:17
875000 -- (-891.452) (-891.329) [-891.328] (-893.754) * (-890.309) (-887.743) (-892.307) [-893.170] -- 0:00:17
Average standard deviation of split frequencies: 0.003229
875500 -- [-890.631] (-894.060) (-891.231) (-892.630) * (-891.800) (-890.997) [-887.411] (-895.231) -- 0:00:17
876000 -- [-889.723] (-889.587) (-893.446) (-892.318) * (-892.055) (-893.977) [-891.793] (-896.545) -- 0:00:17
876500 -- (-895.775) (-890.071) (-890.643) [-889.070] * (-895.623) (-894.491) [-887.860] (-900.297) -- 0:00:17
877000 -- (-892.860) [-892.391] (-887.250) (-891.604) * (-892.248) (-893.252) [-901.976] (-893.235) -- 0:00:17
877500 -- (-892.770) [-892.189] (-896.465) (-889.177) * (-895.251) (-890.527) (-890.398) [-888.940] -- 0:00:17
878000 -- [-893.739] (-892.610) (-890.286) (-891.912) * (-890.236) (-894.601) (-891.209) [-890.222] -- 0:00:17
878500 -- (-895.351) (-898.269) [-890.925] (-894.736) * [-890.523] (-891.596) (-888.107) (-895.177) -- 0:00:17
879000 -- [-892.482] (-892.798) (-895.862) (-894.160) * (-894.898) (-889.306) [-886.929] (-888.451) -- 0:00:17
879500 -- [-889.958] (-896.396) (-890.416) (-889.151) * [-886.553] (-892.539) (-890.795) (-888.612) -- 0:00:17
880000 -- (-895.149) (-894.432) (-896.721) [-889.086] * (-892.601) (-891.404) [-889.120] (-890.168) -- 0:00:17
Average standard deviation of split frequencies: 0.003212
880500 -- (-892.192) [-896.191] (-889.997) (-889.738) * [-892.030] (-891.883) (-893.311) (-894.424) -- 0:00:17
881000 -- (-889.886) [-894.992] (-892.768) (-891.094) * (-891.177) [-888.995] (-892.132) (-901.152) -- 0:00:17
881500 -- (-893.445) [-894.311] (-892.418) (-893.720) * (-891.644) (-891.198) (-897.783) [-890.757] -- 0:00:16
882000 -- (-890.304) (-893.565) (-891.746) [-889.277] * (-890.037) (-889.607) (-892.987) [-891.236] -- 0:00:16
882500 -- (-894.225) (-892.697) (-891.779) [-896.991] * [-890.819] (-889.585) (-902.940) (-899.721) -- 0:00:16
883000 -- (-895.463) (-891.814) (-894.014) [-888.410] * (-889.168) (-893.565) (-892.169) [-895.285] -- 0:00:16
883500 -- (-892.156) [-886.918] (-895.471) (-889.001) * [-889.234] (-893.751) (-894.355) (-894.007) -- 0:00:16
884000 -- [-892.867] (-889.443) (-895.390) (-892.039) * [-890.416] (-896.640) (-891.407) (-895.767) -- 0:00:16
884500 -- (-892.357) (-895.414) (-894.751) [-892.202] * [-889.437] (-893.013) (-890.253) (-893.427) -- 0:00:16
885000 -- (-890.997) [-892.015] (-890.687) (-893.042) * (-887.072) (-889.284) (-893.190) [-894.522] -- 0:00:16
Average standard deviation of split frequencies: 0.002660
885500 -- (-893.432) [-896.958] (-893.461) (-888.974) * (-896.020) (-895.942) [-891.392] (-887.982) -- 0:00:16
886000 -- (-892.927) (-895.295) (-893.929) [-888.660] * [-889.090] (-892.245) (-892.211) (-890.832) -- 0:00:16
886500 -- (-889.059) (-892.509) [-895.022] (-902.040) * (-889.525) [-890.163] (-896.865) (-890.368) -- 0:00:16
887000 -- (-891.652) (-893.927) (-897.700) [-893.340] * (-898.635) [-894.226] (-892.682) (-890.382) -- 0:00:16
887500 -- [-890.111] (-889.826) (-896.349) (-895.801) * (-889.696) (-891.056) (-891.188) [-889.573] -- 0:00:16
888000 -- (-891.069) [-894.849] (-887.845) (-894.817) * [-889.368] (-887.947) (-891.200) (-892.935) -- 0:00:16
888500 -- [-894.158] (-890.782) (-894.199) (-896.454) * (-893.688) (-895.093) (-891.754) [-888.638] -- 0:00:15
889000 -- (-894.873) (-889.158) (-892.139) [-894.307] * (-891.027) (-894.527) [-893.679] (-893.235) -- 0:00:15
889500 -- (-892.549) [-892.967] (-892.099) (-893.977) * (-891.292) (-893.532) [-893.725] (-889.471) -- 0:00:15
890000 -- (-902.102) (-892.936) [-891.535] (-897.749) * (-895.069) [-893.544] (-895.130) (-889.029) -- 0:00:15
Average standard deviation of split frequencies: 0.002646
890500 -- [-891.055] (-897.671) (-891.284) (-888.244) * (-894.358) [-890.688] (-893.523) (-895.962) -- 0:00:15
891000 -- [-895.645] (-893.877) (-891.733) (-895.067) * (-895.555) (-890.571) (-887.528) [-892.299] -- 0:00:15
891500 -- (-894.575) (-893.196) (-893.995) [-893.560] * [-889.546] (-888.582) (-888.137) (-897.470) -- 0:00:15
892000 -- (-890.260) [-896.239] (-891.290) (-893.305) * [-893.975] (-890.581) (-894.463) (-898.802) -- 0:00:15
892500 -- [-891.877] (-891.812) (-898.064) (-891.895) * (-890.737) (-890.075) (-892.245) [-890.594] -- 0:00:15
893000 -- (-888.621) (-889.848) [-893.331] (-889.145) * (-890.179) (-895.269) (-891.856) [-889.635] -- 0:00:15
893500 -- (-894.886) (-894.728) [-892.493] (-894.036) * [-895.957] (-898.187) (-897.024) (-900.316) -- 0:00:15
894000 -- (-889.267) (-894.218) (-890.859) [-890.378] * (-888.099) [-889.103] (-901.286) (-892.941) -- 0:00:15
894500 -- (-892.153) [-896.359] (-890.635) (-892.373) * [-890.359] (-889.769) (-891.166) (-893.801) -- 0:00:15
895000 -- (-895.057) (-896.488) [-891.684] (-893.839) * (-896.997) [-888.382] (-894.624) (-893.482) -- 0:00:15
Average standard deviation of split frequencies: 0.002631
895500 -- (-894.532) [-891.664] (-892.221) (-889.578) * (-897.782) [-892.184] (-891.052) (-887.403) -- 0:00:14
896000 -- [-891.499] (-891.628) (-893.534) (-893.327) * (-888.893) (-890.463) (-890.240) [-890.266] -- 0:00:14
896500 -- (-892.964) [-892.763] (-898.268) (-891.983) * (-892.823) (-896.075) (-890.643) [-890.826] -- 0:00:14
897000 -- [-892.398] (-896.015) (-894.054) (-889.337) * (-894.356) (-893.533) (-895.448) [-893.049] -- 0:00:14
897500 -- [-888.386] (-891.181) (-897.735) (-887.756) * [-894.223] (-894.128) (-888.784) (-893.904) -- 0:00:14
898000 -- (-889.276) [-892.124] (-894.737) (-900.916) * (-890.649) [-890.399] (-891.998) (-900.759) -- 0:00:14
898500 -- [-890.249] (-894.873) (-887.739) (-894.909) * [-890.192] (-894.724) (-892.486) (-895.089) -- 0:00:14
899000 -- (-888.571) [-889.147] (-892.225) (-892.568) * (-894.203) (-891.329) [-898.562] (-891.926) -- 0:00:14
899500 -- (-889.722) (-891.459) (-890.649) [-891.186] * (-892.997) (-891.968) (-894.997) [-892.562] -- 0:00:14
900000 -- (-898.682) (-888.080) [-891.543] (-894.314) * (-895.540) [-893.437] (-892.636) (-897.731) -- 0:00:14
Average standard deviation of split frequencies: 0.002094
900500 -- (-891.664) (-891.416) (-887.795) [-898.117] * [-890.152] (-896.914) (-894.552) (-904.697) -- 0:00:14
901000 -- [-888.996] (-893.926) (-892.300) (-893.143) * (-889.824) (-890.622) [-901.004] (-891.047) -- 0:00:14
901500 -- [-889.504] (-893.478) (-899.004) (-894.499) * (-891.598) (-892.632) (-894.458) [-892.127] -- 0:00:14
902000 -- (-891.887) (-894.623) (-894.531) [-891.148] * (-888.851) [-895.095] (-894.761) (-891.577) -- 0:00:14
902500 -- (-892.309) [-892.945] (-898.137) (-891.599) * [-893.922] (-891.758) (-895.393) (-889.022) -- 0:00:13
903000 -- (-891.455) (-889.958) (-893.137) [-888.907] * (-895.970) [-894.342] (-891.142) (-895.189) -- 0:00:13
903500 -- (-894.351) (-894.048) [-890.572] (-893.226) * (-896.646) [-891.099] (-898.398) (-891.519) -- 0:00:13
904000 -- (-896.640) (-891.564) [-888.861] (-890.219) * [-892.574] (-890.909) (-891.599) (-891.233) -- 0:00:13
904500 -- (-895.801) (-895.077) (-891.121) [-889.732] * (-891.978) (-893.637) (-890.294) [-888.245] -- 0:00:13
905000 -- [-891.873] (-896.844) (-888.961) (-894.286) * (-891.662) (-898.087) (-891.945) [-891.830] -- 0:00:13
Average standard deviation of split frequencies: 0.002081
905500 -- (-894.034) (-891.219) (-889.101) [-892.408] * [-892.699] (-896.527) (-890.411) (-894.254) -- 0:00:13
906000 -- (-894.107) [-886.916] (-889.088) (-900.494) * (-893.434) (-892.210) (-891.384) [-890.855] -- 0:00:13
906500 -- (-890.834) (-890.878) [-888.949] (-891.890) * (-890.023) (-891.661) [-890.831] (-892.114) -- 0:00:13
907000 -- [-897.581] (-891.485) (-890.777) (-896.808) * (-890.990) (-888.224) [-891.235] (-893.341) -- 0:00:13
907500 -- (-895.479) (-891.197) [-892.010] (-893.591) * [-890.164] (-894.827) (-900.234) (-894.174) -- 0:00:13
908000 -- (-890.117) (-890.392) (-895.163) [-891.860] * (-891.436) (-890.809) (-894.044) [-893.360] -- 0:00:13
908500 -- (-888.332) (-899.546) [-890.858] (-894.893) * [-893.899] (-894.492) (-890.344) (-895.866) -- 0:00:13
909000 -- [-887.917] (-894.702) (-890.585) (-891.419) * (-893.554) (-888.280) [-891.688] (-896.019) -- 0:00:13
909500 -- (-890.932) (-890.474) [-894.202] (-891.812) * (-890.675) (-890.352) [-890.660] (-890.790) -- 0:00:12
910000 -- (-896.867) (-894.428) (-894.485) [-892.547] * (-891.870) [-891.176] (-898.250) (-891.741) -- 0:00:12
Average standard deviation of split frequencies: 0.003106
910500 -- (-897.761) (-889.073) [-892.277] (-897.215) * [-891.212] (-897.403) (-898.833) (-890.285) -- 0:00:12
911000 -- (-893.566) [-888.074] (-894.615) (-896.188) * (-889.096) (-894.250) (-892.769) [-891.928] -- 0:00:12
911500 -- [-891.506] (-892.267) (-894.139) (-894.702) * (-888.718) [-892.053] (-890.084) (-892.567) -- 0:00:12
912000 -- [-886.370] (-893.086) (-898.012) (-895.347) * (-890.329) (-892.136) [-888.461] (-891.013) -- 0:00:12
912500 -- (-890.571) (-891.191) (-896.905) [-890.445] * [-894.544] (-888.677) (-893.366) (-895.165) -- 0:00:12
913000 -- (-891.629) [-889.798] (-887.759) (-896.540) * (-894.308) [-888.950] (-893.775) (-889.548) -- 0:00:12
913500 -- (-892.139) (-896.133) [-890.782] (-895.631) * (-895.147) (-891.738) (-890.894) [-892.826] -- 0:00:12
914000 -- (-898.576) [-888.890] (-897.242) (-894.632) * (-896.447) (-890.469) (-894.932) [-889.871] -- 0:00:12
914500 -- (-896.329) [-892.671] (-897.900) (-892.492) * [-893.761] (-892.581) (-889.672) (-890.200) -- 0:00:12
915000 -- (-896.326) [-891.345] (-898.589) (-893.682) * [-896.044] (-890.692) (-893.129) (-895.393) -- 0:00:12
Average standard deviation of split frequencies: 0.004117
915500 -- [-897.366] (-889.080) (-899.169) (-892.607) * (-890.392) [-891.916] (-894.049) (-889.947) -- 0:00:12
916000 -- (-897.796) [-891.512] (-900.040) (-895.441) * (-891.076) [-889.065] (-897.913) (-892.187) -- 0:00:12
916500 -- [-890.843] (-896.185) (-893.947) (-891.207) * (-893.836) [-890.482] (-891.655) (-890.726) -- 0:00:11
917000 -- (-893.340) (-894.083) (-894.345) [-891.095] * [-890.580] (-890.705) (-889.137) (-890.940) -- 0:00:11
917500 -- (-890.989) (-888.803) [-896.466] (-891.574) * (-895.146) [-888.722] (-890.973) (-892.314) -- 0:00:11
918000 -- (-894.943) [-892.847] (-895.234) (-895.993) * (-896.737) (-896.529) (-892.088) [-888.473] -- 0:00:11
918500 -- (-890.191) (-890.536) [-891.765] (-898.537) * (-888.895) [-893.114] (-890.206) (-889.068) -- 0:00:11
919000 -- (-899.572) (-888.437) [-891.145] (-895.426) * [-889.446] (-894.842) (-895.944) (-891.376) -- 0:00:11
919500 -- (-898.637) (-890.009) [-897.001] (-893.256) * [-892.839] (-900.330) (-899.413) (-892.179) -- 0:00:11
920000 -- (-891.966) (-897.984) [-887.567] (-893.823) * (-893.611) (-893.269) (-895.335) [-895.786] -- 0:00:11
Average standard deviation of split frequencies: 0.004608
920500 -- [-889.060] (-891.616) (-892.598) (-897.907) * (-893.347) (-890.952) (-894.308) [-891.319] -- 0:00:11
921000 -- (-891.217) (-889.743) [-888.456] (-893.816) * (-892.636) (-896.076) [-893.345] (-893.344) -- 0:00:11
921500 -- (-894.145) (-889.491) (-893.137) [-890.862] * (-890.287) (-893.130) [-894.529] (-897.487) -- 0:00:11
922000 -- (-894.362) [-892.393] (-891.812) (-886.474) * (-890.943) (-892.006) [-892.238] (-898.187) -- 0:00:11
922500 -- (-891.473) (-895.094) [-892.515] (-893.613) * [-893.199] (-893.689) (-897.059) (-893.523) -- 0:00:11
923000 -- (-891.788) (-892.143) [-888.561] (-892.402) * (-895.826) (-894.438) [-890.427] (-894.861) -- 0:00:11
923500 -- (-889.121) (-892.869) [-890.936] (-892.298) * (-892.256) (-893.501) (-891.134) [-894.258] -- 0:00:10
924000 -- (-890.261) [-889.871] (-891.191) (-891.825) * [-892.085] (-890.403) (-888.929) (-895.725) -- 0:00:10
924500 -- (-894.518) [-892.004] (-892.989) (-891.417) * (-894.746) [-892.467] (-894.125) (-891.761) -- 0:00:10
925000 -- [-889.837] (-890.571) (-897.041) (-891.035) * (-889.250) (-890.795) [-891.828] (-888.720) -- 0:00:10
Average standard deviation of split frequencies: 0.004073
925500 -- (-888.512) [-889.794] (-892.120) (-894.338) * (-892.681) (-890.073) (-889.565) [-892.422] -- 0:00:10
926000 -- (-890.026) [-889.920] (-895.722) (-890.538) * (-897.234) [-892.900] (-895.784) (-895.937) -- 0:00:10
926500 -- (-892.554) [-892.127] (-889.857) (-890.021) * [-895.135] (-903.447) (-895.689) (-890.357) -- 0:00:10
927000 -- (-895.144) (-892.730) (-897.392) [-889.811] * (-890.243) (-893.542) (-895.661) [-896.002] -- 0:00:10
927500 -- [-889.132] (-892.376) (-889.144) (-891.030) * [-888.428] (-889.420) (-891.202) (-891.977) -- 0:00:10
928000 -- (-891.526) (-889.679) (-891.429) [-888.614] * (-892.387) [-888.383] (-893.052) (-898.250) -- 0:00:10
928500 -- (-889.673) (-889.586) [-890.284] (-892.726) * [-888.076] (-892.849) (-894.364) (-897.893) -- 0:00:10
929000 -- (-893.560) (-895.367) (-893.619) [-891.403] * [-892.474] (-898.037) (-892.418) (-897.657) -- 0:00:10
929500 -- (-891.166) (-891.847) (-895.689) [-887.428] * [-888.356] (-899.032) (-889.667) (-895.436) -- 0:00:10
930000 -- (-889.719) (-894.923) [-890.816] (-890.423) * (-895.029) [-893.023] (-889.457) (-893.238) -- 0:00:10
Average standard deviation of split frequencies: 0.004052
930500 -- (-892.538) (-898.093) (-890.850) [-889.137] * (-895.357) (-899.351) [-892.816] (-895.098) -- 0:00:09
931000 -- (-893.420) (-897.626) (-893.988) [-889.692] * [-892.529] (-895.966) (-895.892) (-895.908) -- 0:00:09
931500 -- (-895.371) (-894.766) (-892.533) [-890.733] * (-893.602) [-893.392] (-888.988) (-889.856) -- 0:00:09
932000 -- (-892.186) [-891.991] (-889.350) (-892.520) * [-892.255] (-897.420) (-893.453) (-890.558) -- 0:00:09
932500 -- (-897.745) (-887.577) (-893.969) [-897.669] * (-892.961) [-890.014] (-891.927) (-891.407) -- 0:00:09
933000 -- (-892.842) [-890.141] (-889.845) (-894.850) * (-890.934) [-892.857] (-890.842) (-890.540) -- 0:00:09
933500 -- [-890.649] (-890.736) (-892.017) (-892.355) * (-901.390) [-891.903] (-891.985) (-888.338) -- 0:00:09
934000 -- [-890.617] (-893.214) (-890.201) (-893.177) * (-898.485) (-891.329) [-888.715] (-887.885) -- 0:00:09
934500 -- [-894.243] (-894.022) (-892.884) (-893.642) * (-890.664) [-889.170] (-893.445) (-894.284) -- 0:00:09
935000 -- [-890.156] (-896.989) (-890.118) (-892.660) * (-892.431) [-894.654] (-893.111) (-896.175) -- 0:00:09
Average standard deviation of split frequencies: 0.004029
935500 -- [-888.612] (-895.283) (-892.150) (-890.789) * (-894.984) [-892.180] (-897.458) (-893.356) -- 0:00:09
936000 -- [-891.439] (-892.339) (-899.524) (-890.829) * (-895.104) [-890.827] (-896.303) (-896.974) -- 0:00:09
936500 -- [-889.606] (-891.270) (-890.844) (-892.958) * (-896.692) [-895.143] (-892.725) (-897.329) -- 0:00:09
937000 -- (-890.305) (-889.099) (-897.701) [-890.032] * (-896.959) [-890.511] (-890.269) (-892.799) -- 0:00:09
937500 -- (-889.424) (-893.918) [-892.929] (-890.188) * (-895.191) [-891.973] (-897.376) (-893.355) -- 0:00:08
938000 -- (-895.493) (-890.514) [-889.117] (-889.873) * (-890.185) [-895.249] (-895.918) (-892.078) -- 0:00:08
938500 -- (-891.312) (-893.870) [-893.471] (-892.508) * (-894.530) (-890.058) (-892.356) [-890.689] -- 0:00:08
939000 -- (-893.025) (-889.872) (-891.377) [-891.973] * (-894.262) [-893.410] (-891.713) (-887.789) -- 0:00:08
939500 -- (-892.185) [-890.790] (-892.149) (-890.874) * [-891.958] (-889.659) (-898.455) (-893.541) -- 0:00:08
940000 -- (-897.772) [-894.464] (-890.399) (-892.868) * (-895.823) [-891.229] (-893.955) (-892.910) -- 0:00:08
Average standard deviation of split frequencies: 0.004009
940500 -- (-888.893) (-895.073) (-902.837) [-894.114] * (-900.700) (-887.680) [-895.441] (-894.836) -- 0:00:08
941000 -- [-887.493] (-892.955) (-893.011) (-894.693) * [-890.139] (-896.508) (-889.436) (-891.439) -- 0:00:08
941500 -- (-888.704) (-888.356) (-892.000) [-891.913] * (-888.690) (-896.567) (-893.235) [-890.630] -- 0:00:08
942000 -- (-895.719) (-889.354) (-890.796) [-888.706] * (-892.454) (-891.897) [-894.759] (-893.055) -- 0:00:08
942500 -- (-900.007) [-892.180] (-887.336) (-893.337) * (-893.574) (-889.953) (-891.422) [-890.761] -- 0:00:08
943000 -- [-894.855] (-889.308) (-891.586) (-897.060) * (-893.446) (-888.602) [-892.936] (-889.957) -- 0:00:08
943500 -- (-893.114) (-889.807) (-893.922) [-888.910] * [-890.212] (-894.964) (-900.596) (-893.355) -- 0:00:08
944000 -- (-891.023) (-887.857) [-894.651] (-890.215) * (-890.241) (-893.917) (-894.372) [-891.993] -- 0:00:08
944500 -- (-893.964) (-890.912) [-891.157] (-892.599) * [-889.075] (-898.172) (-891.489) (-897.827) -- 0:00:07
945000 -- (-894.903) [-889.117] (-895.076) (-890.770) * (-894.173) (-889.844) [-894.525] (-893.446) -- 0:00:07
Average standard deviation of split frequencies: 0.003987
945500 -- (-888.991) [-890.004] (-890.001) (-894.148) * (-898.664) (-890.737) (-894.121) [-895.633] -- 0:00:07
946000 -- [-891.500] (-889.841) (-889.799) (-892.253) * (-901.148) (-890.161) [-890.571] (-891.055) -- 0:00:07
946500 -- (-898.963) (-893.350) [-897.223] (-896.410) * (-894.660) (-894.897) (-889.595) [-892.829] -- 0:00:07
947000 -- (-893.064) (-889.206) (-892.318) [-892.418] * (-890.114) [-889.685] (-892.603) (-894.881) -- 0:00:07
947500 -- (-892.995) [-889.145] (-888.071) (-897.774) * (-895.666) (-890.095) [-893.561] (-892.224) -- 0:00:07
948000 -- [-892.104] (-897.881) (-896.628) (-894.959) * (-890.287) [-893.811] (-894.391) (-891.691) -- 0:00:07
948500 -- (-893.594) (-894.776) [-897.849] (-892.403) * (-888.243) (-890.533) (-891.848) [-891.200] -- 0:00:07
949000 -- [-888.501] (-892.575) (-893.172) (-891.950) * (-891.162) (-894.861) (-889.012) [-887.969] -- 0:00:07
949500 -- (-892.595) [-896.303] (-897.175) (-889.958) * (-898.316) [-893.740] (-892.352) (-889.730) -- 0:00:07
950000 -- (-895.990) [-892.055] (-890.400) (-891.340) * (-892.466) (-901.209) [-888.441] (-890.953) -- 0:00:07
Average standard deviation of split frequencies: 0.003967
950500 -- (-895.729) (-890.166) (-899.545) [-891.149] * (-893.085) [-887.979] (-894.604) (-891.841) -- 0:00:07
951000 -- [-890.145] (-889.401) (-895.335) (-890.294) * [-892.049] (-887.824) (-889.332) (-890.827) -- 0:00:07
951500 -- (-896.869) (-891.704) [-891.049] (-894.620) * (-889.469) (-891.399) [-897.412] (-891.490) -- 0:00:06
952000 -- (-897.399) (-897.131) (-892.422) [-889.811] * (-890.510) [-893.749] (-896.586) (-891.734) -- 0:00:06
952500 -- (-898.244) (-890.982) [-890.203] (-889.670) * [-893.047] (-891.153) (-888.581) (-897.915) -- 0:00:06
953000 -- (-889.296) [-893.987] (-891.565) (-895.061) * (-894.284) (-892.991) [-889.733] (-893.112) -- 0:00:06
953500 -- (-891.388) (-893.171) (-898.599) [-890.189] * [-894.621] (-888.682) (-893.884) (-889.262) -- 0:00:06
954000 -- [-889.353] (-891.786) (-894.248) (-900.894) * (-890.892) [-890.590] (-895.533) (-890.101) -- 0:00:06
954500 -- (-892.995) (-892.991) (-889.964) [-895.533] * (-894.559) (-887.516) [-889.292] (-892.558) -- 0:00:06
955000 -- (-890.489) (-890.188) (-890.428) [-894.038] * (-893.491) [-889.287] (-890.304) (-891.680) -- 0:00:06
Average standard deviation of split frequencies: 0.004931
955500 -- (-894.179) [-888.681] (-899.220) (-893.659) * [-892.640] (-893.610) (-890.587) (-897.967) -- 0:00:06
956000 -- (-888.508) (-889.165) (-894.433) [-892.264] * (-892.923) (-888.697) [-889.363] (-892.036) -- 0:00:06
956500 -- (-890.171) [-893.261] (-893.976) (-889.271) * [-889.783] (-891.987) (-898.105) (-893.857) -- 0:00:06
957000 -- [-894.083] (-892.568) (-891.832) (-892.001) * (-890.210) (-895.902) (-893.952) [-893.402] -- 0:00:06
957500 -- (-888.421) (-891.782) [-893.605] (-890.196) * (-896.209) (-891.506) [-888.102] (-895.138) -- 0:00:06
958000 -- (-894.861) [-891.120] (-893.715) (-898.753) * [-890.456] (-893.124) (-889.950) (-892.413) -- 0:00:06
958500 -- [-890.556] (-894.770) (-887.367) (-894.935) * [-895.442] (-895.769) (-900.684) (-891.565) -- 0:00:05
959000 -- [-892.614] (-891.719) (-891.221) (-895.849) * [-895.094] (-889.730) (-889.151) (-894.319) -- 0:00:05
959500 -- (-894.326) (-888.817) [-890.637] (-897.039) * [-889.626] (-896.906) (-895.185) (-892.795) -- 0:00:05
960000 -- (-896.293) (-890.420) (-895.755) [-891.115] * (-896.144) (-895.030) [-890.568] (-889.610) -- 0:00:05
Average standard deviation of split frequencies: 0.004416
960500 -- (-891.728) (-893.033) [-893.087] (-891.989) * (-895.449) (-895.182) (-887.334) [-895.493] -- 0:00:05
961000 -- [-902.521] (-890.498) (-899.391) (-893.584) * [-896.615] (-899.872) (-889.261) (-894.279) -- 0:00:05
961500 -- (-889.940) (-888.771) (-899.561) [-891.195] * (-893.662) (-893.770) [-889.748] (-891.593) -- 0:00:05
962000 -- (-892.965) [-892.414] (-895.556) (-893.130) * (-891.108) (-890.621) (-897.413) [-888.107] -- 0:00:05
962500 -- (-892.976) [-889.246] (-894.984) (-897.862) * (-894.284) [-889.156] (-892.734) (-889.325) -- 0:00:05
963000 -- (-892.526) [-891.052] (-890.140) (-890.670) * (-895.507) (-888.810) [-891.675] (-893.259) -- 0:00:05
963500 -- [-888.979] (-894.018) (-889.408) (-898.305) * (-894.990) [-891.090] (-896.486) (-890.525) -- 0:00:05
964000 -- (-889.970) [-890.551] (-890.358) (-896.740) * [-891.077] (-888.244) (-899.043) (-893.964) -- 0:00:05
964500 -- (-889.671) (-890.953) [-890.880] (-890.242) * (-900.053) [-890.087] (-889.783) (-892.909) -- 0:00:05
965000 -- (-893.334) (-888.199) [-899.226] (-889.230) * (-898.429) [-890.708] (-892.950) (-892.749) -- 0:00:05
Average standard deviation of split frequencies: 0.003904
965500 -- (-892.781) [-891.705] (-890.529) (-896.977) * (-891.443) [-891.748] (-893.310) (-889.569) -- 0:00:04
966000 -- (-889.702) [-891.027] (-889.587) (-889.989) * (-894.025) [-892.868] (-897.315) (-893.633) -- 0:00:04
966500 -- (-895.341) [-892.245] (-895.176) (-889.009) * [-893.766] (-892.055) (-893.015) (-892.903) -- 0:00:04
967000 -- (-888.413) (-892.408) [-887.743] (-889.199) * (-894.363) [-890.437] (-891.754) (-897.028) -- 0:00:04
967500 -- (-892.494) (-897.621) [-891.799] (-893.118) * (-888.947) [-895.200] (-890.466) (-894.424) -- 0:00:04
968000 -- (-891.647) [-887.410] (-893.239) (-896.635) * [-892.492] (-900.733) (-891.890) (-896.168) -- 0:00:04
968500 -- [-893.730] (-890.102) (-888.673) (-895.469) * [-890.074] (-894.870) (-892.343) (-891.876) -- 0:00:04
969000 -- (-894.408) (-894.108) (-892.737) [-888.264] * (-894.252) [-890.364] (-893.184) (-889.211) -- 0:00:04
969500 -- (-896.140) (-897.819) (-893.343) [-891.798] * [-896.058] (-894.633) (-887.441) (-889.551) -- 0:00:04
970000 -- (-891.655) (-900.096) [-889.971] (-896.146) * (-899.899) [-889.812] (-896.543) (-893.840) -- 0:00:04
Average standard deviation of split frequencies: 0.002914
970500 -- (-888.711) (-897.789) (-891.384) [-888.284] * (-892.543) (-891.721) (-891.183) [-888.313] -- 0:00:04
971000 -- [-888.437] (-896.772) (-892.792) (-889.828) * (-896.637) (-890.870) [-893.002] (-891.412) -- 0:00:04
971500 -- (-890.300) (-891.931) [-891.046] (-886.469) * [-892.877] (-893.071) (-895.261) (-897.026) -- 0:00:04
972000 -- (-891.951) (-897.249) (-892.396) [-887.403] * (-891.429) [-891.850] (-894.069) (-890.782) -- 0:00:04
972500 -- (-893.687) (-898.810) (-891.172) [-893.619] * [-894.145] (-901.589) (-897.538) (-891.258) -- 0:00:03
973000 -- (-896.571) (-891.967) (-894.406) [-888.992] * (-892.021) [-892.685] (-893.724) (-890.973) -- 0:00:03
973500 -- (-893.578) [-889.889] (-900.079) (-892.147) * (-893.179) (-891.977) [-891.962] (-892.042) -- 0:00:03
974000 -- [-893.915] (-894.558) (-891.042) (-887.780) * (-900.624) (-890.732) (-899.477) [-890.751] -- 0:00:03
974500 -- (-900.584) (-889.929) (-891.059) [-888.296] * [-893.803] (-896.514) (-897.202) (-890.338) -- 0:00:03
975000 -- (-903.724) [-892.711] (-892.180) (-894.552) * (-893.676) (-898.952) [-897.103] (-896.586) -- 0:00:03
Average standard deviation of split frequencies: 0.002898
975500 -- (-899.446) (-893.383) [-891.924] (-891.898) * (-894.757) (-894.026) (-895.400) [-890.302] -- 0:00:03
976000 -- (-891.755) (-897.238) (-889.431) [-891.724] * (-893.129) (-901.859) (-897.754) [-890.227] -- 0:00:03
976500 -- [-889.859] (-894.771) (-892.334) (-892.259) * (-891.538) (-890.418) [-890.114] (-892.402) -- 0:00:03
977000 -- (-888.455) (-893.220) (-889.055) [-888.391] * (-892.175) (-891.507) (-893.316) [-893.076] -- 0:00:03
977500 -- [-889.306] (-899.711) (-893.142) (-892.789) * (-892.234) [-894.938] (-890.552) (-897.195) -- 0:00:03
978000 -- [-893.628] (-897.156) (-893.542) (-889.803) * (-893.999) [-904.463] (-898.938) (-890.834) -- 0:00:03
978500 -- [-894.840] (-892.888) (-890.171) (-890.267) * [-891.612] (-899.893) (-893.359) (-893.487) -- 0:00:03
979000 -- (-895.038) (-892.914) (-891.510) [-889.727] * [-891.137] (-899.430) (-890.964) (-893.364) -- 0:00:03
979500 -- (-895.088) [-889.271] (-892.538) (-893.840) * [-890.775] (-889.057) (-893.090) (-900.557) -- 0:00:02
980000 -- [-890.783] (-888.364) (-892.647) (-890.720) * [-892.484] (-897.268) (-890.830) (-894.158) -- 0:00:02
Average standard deviation of split frequencies: 0.002884
980500 -- [-891.353] (-889.444) (-890.080) (-890.371) * (-892.747) [-888.440] (-892.851) (-893.366) -- 0:00:02
981000 -- (-896.280) [-890.694] (-891.732) (-891.226) * (-892.315) [-889.365] (-891.574) (-889.591) -- 0:00:02
981500 -- (-894.021) (-894.846) [-890.284] (-887.805) * (-890.967) (-892.715) [-891.928] (-892.161) -- 0:00:02
982000 -- [-893.269] (-893.967) (-895.985) (-889.674) * (-892.115) [-890.065] (-890.685) (-897.359) -- 0:00:02
982500 -- (-895.762) (-894.332) (-892.644) [-892.109] * [-891.122] (-889.563) (-896.261) (-891.408) -- 0:00:02
983000 -- (-891.016) [-893.720] (-898.257) (-889.071) * (-890.634) (-891.191) (-891.601) [-891.366] -- 0:00:02
983500 -- (-894.331) (-888.256) (-893.438) [-898.605] * (-889.531) (-890.248) (-895.679) [-893.173] -- 0:00:02
984000 -- (-893.573) (-890.491) (-887.463) [-889.274] * [-894.939] (-888.584) (-898.308) (-895.727) -- 0:00:02
984500 -- [-888.938] (-893.429) (-892.935) (-894.514) * (-888.194) (-889.941) [-889.214] (-895.772) -- 0:00:02
985000 -- (-891.126) (-890.557) (-890.299) [-891.832] * (-899.232) (-891.666) [-889.283] (-892.324) -- 0:00:02
Average standard deviation of split frequencies: 0.002869
985500 -- [-893.279] (-889.510) (-894.052) (-888.438) * (-892.938) (-889.819) [-892.706] (-892.646) -- 0:00:02
986000 -- (-891.823) (-891.394) (-890.708) [-889.504] * (-890.812) (-895.670) (-891.531) [-888.675] -- 0:00:02
986500 -- (-888.318) (-896.465) [-889.365] (-891.206) * (-892.905) [-894.073] (-889.901) (-887.181) -- 0:00:01
987000 -- [-890.913] (-887.316) (-895.860) (-892.106) * (-892.507) [-892.032] (-891.751) (-893.615) -- 0:00:01
987500 -- (-892.091) (-892.111) (-894.775) [-892.824] * [-893.311] (-898.469) (-889.429) (-891.536) -- 0:00:01
988000 -- [-893.136] (-891.951) (-899.204) (-893.968) * (-888.944) (-900.156) [-890.931] (-891.652) -- 0:00:01
988500 -- (-896.363) (-887.859) [-891.784] (-903.366) * (-888.082) (-892.599) (-890.948) [-893.534] -- 0:00:01
989000 -- (-889.861) [-891.673] (-893.989) (-892.481) * (-888.813) [-892.025] (-886.665) (-896.720) -- 0:00:01
989500 -- (-888.806) [-890.410] (-895.294) (-888.850) * (-896.094) (-888.744) [-894.173] (-902.335) -- 0:00:01
990000 -- [-890.539] (-889.073) (-893.634) (-893.498) * (-894.869) [-890.212] (-893.220) (-892.801) -- 0:00:01
Average standard deviation of split frequencies: 0.003331
990500 -- (-891.856) (-893.181) [-890.394] (-888.809) * (-894.668) (-890.303) [-891.193] (-897.164) -- 0:00:01
991000 -- (-896.677) (-897.364) [-895.824] (-894.104) * (-890.694) (-895.660) [-890.106] (-890.999) -- 0:00:01
991500 -- [-891.380] (-896.831) (-892.965) (-894.305) * (-896.978) (-891.566) [-889.651] (-888.048) -- 0:00:01
992000 -- (-892.838) (-892.731) (-889.863) [-890.596] * (-890.395) [-891.678] (-891.536) (-893.506) -- 0:00:01
992500 -- [-891.532] (-890.961) (-893.189) (-895.599) * (-893.431) (-888.969) (-895.627) [-890.830] -- 0:00:01
993000 -- (-890.799) [-887.912] (-891.994) (-891.154) * (-889.866) (-895.474) (-890.761) [-890.117] -- 0:00:01
993500 -- (-892.095) (-898.830) (-893.113) [-893.869] * (-890.463) (-894.794) [-890.825] (-895.795) -- 0:00:00
994000 -- (-893.993) [-893.549] (-889.415) (-900.530) * (-895.768) (-888.037) (-893.338) [-897.594] -- 0:00:00
994500 -- (-889.646) (-890.407) (-891.295) [-900.023] * (-889.272) [-891.166] (-888.964) (-891.071) -- 0:00:00
995000 -- [-894.123] (-888.259) (-890.194) (-900.409) * [-891.736] (-891.584) (-894.640) (-894.526) -- 0:00:00
Average standard deviation of split frequencies: 0.003786
995500 -- (-892.545) (-892.430) (-892.798) [-894.132] * (-891.172) (-895.745) [-894.097] (-891.282) -- 0:00:00
996000 -- [-890.267] (-895.649) (-892.221) (-896.245) * [-892.121] (-893.620) (-889.099) (-894.867) -- 0:00:00
996500 -- (-894.034) (-893.164) [-890.577] (-894.208) * (-898.344) (-892.316) (-892.376) [-892.779] -- 0:00:00
997000 -- (-895.259) (-897.913) [-889.566] (-894.321) * [-894.571] (-888.899) (-895.389) (-889.419) -- 0:00:00
997500 -- (-893.818) [-886.846] (-891.746) (-892.612) * [-892.550] (-888.817) (-888.351) (-895.594) -- 0:00:00
998000 -- (-891.710) [-890.519] (-895.599) (-899.384) * (-891.661) [-888.294] (-891.999) (-894.103) -- 0:00:00
998500 -- (-890.319) [-888.375] (-894.178) (-895.719) * [-892.243] (-895.014) (-894.992) (-896.950) -- 0:00:00
999000 -- (-895.929) [-894.786] (-896.123) (-894.757) * [-894.061] (-893.290) (-894.517) (-893.298) -- 0:00:00
999500 -- (-896.694) [-895.691] (-895.753) (-891.803) * (-896.194) (-893.903) (-894.186) [-891.805] -- 0:00:00
1000000 -- (-890.852) (-891.066) (-892.648) [-898.292] * (-889.756) (-893.771) (-888.193) [-895.331] -- 0:00:00
Average standard deviation of split frequencies: 0.002827
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -890.851632 -- 10.840362
Chain 1 -- -890.851632 -- 10.840362
Chain 2 -- -891.066008 -- 12.892868
Chain 2 -- -891.066008 -- 12.892868
Chain 3 -- -892.648414 -- 11.106489
Chain 3 -- -892.648414 -- 11.106489
Chain 4 -- -898.291719 -- 12.488587
Chain 4 -- -898.291719 -- 12.488587
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -889.755832 -- 12.250880
Chain 1 -- -889.755832 -- 12.250880
Chain 2 -- -893.770506 -- 13.031470
Chain 2 -- -893.770506 -- 13.031470
Chain 3 -- -888.192769 -- 5.693924
Chain 3 -- -888.192769 -- 5.693924
Chain 4 -- -895.331365 -- 13.365909
Chain 4 -- -895.331365 -- 13.365909
Analysis completed in 2 mins 23 seconds
Analysis used 143.12 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -885.43
Likelihood of best state for "cold" chain of run 2 was -885.43
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
67.7 % ( 62 %) Dirichlet(Revmat{all})
78.4 % ( 59 %) Slider(Revmat{all})
30.5 % ( 29 %) Dirichlet(Pi{all})
31.0 % ( 26 %) Slider(Pi{all})
51.0 % ( 29 %) Multiplier(Alpha{1,2})
49.5 % ( 32 %) Multiplier(Alpha{3})
67.1 % ( 44 %) Slider(Pinvar{all})
7.1 % ( 6 %) NNI(Tau{all},V{all})
5.7 % ( 4 %) ParsSPR(Tau{all},V{all})
26.4 % ( 32 %) Multiplier(V{all})
37.2 % ( 41 %) Nodeslider(V{all})
26.1 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.7 % ( 61 %) Dirichlet(Revmat{all})
78.9 % ( 67 %) Slider(Revmat{all})
30.4 % ( 28 %) Dirichlet(Pi{all})
30.4 % ( 22 %) Slider(Pi{all})
51.1 % ( 24 %) Multiplier(Alpha{1,2})
49.8 % ( 27 %) Multiplier(Alpha{3})
66.4 % ( 52 %) Slider(Pinvar{all})
6.9 % ( 7 %) NNI(Tau{all},V{all})
5.5 % ( 3 %) ParsSPR(Tau{all},V{all})
26.3 % ( 24 %) Multiplier(V{all})
37.1 % ( 28 %) Nodeslider(V{all})
26.1 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166436 0.86 0.72
3 | 166868 166737 0.87
4 | 166253 166929 166777
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166519 0.85 0.73
3 | 167199 166365 0.87
4 | 166961 166471 166485
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -890.56
| 2 1 1 |
| 1 1 2 1 2 |
| 1 2 1 2 |
| 1 1 1 1 |
| 1 2 |
| 1 2 2 1 1 2 2 1 1 |
|1 2 1 2 2 2 2* 2 |
| * 2 1 2 2 2 1212 2 112 1 2 2 2 |
| 2 1 1 2 2 2121 2 |
|2 2 2 1 2 2 2 2 1 2 1 |
| 12 1 11 2 1 1 21 11121 1 12 1 2 21 22|
| 1 2 1 1 1|
| 1 2 22 1 2 1 1 |
| 2 2 1 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -892.82
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -889.70 -897.64
2 -889.77 -897.94
--------------------------------------
TOTAL -889.74 -897.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.522852 0.020542 0.280878 0.803748 0.497287 787.91 1144.45 1.000
r(A<->C){all} 0.117885 0.005050 0.001770 0.257085 0.106542 560.09 568.91 1.001
r(A<->G){all} 0.212347 0.007059 0.059244 0.372296 0.205007 496.56 558.65 1.002
r(A<->T){all} 0.237229 0.007176 0.082699 0.399957 0.227723 783.27 809.42 1.002
r(C<->G){all} 0.128731 0.002684 0.044040 0.235406 0.121330 807.66 845.39 1.001
r(C<->T){all} 0.176114 0.003498 0.060535 0.285755 0.171138 747.84 807.13 1.000
r(G<->T){all} 0.127694 0.003661 0.019685 0.240768 0.119516 654.97 697.32 1.000
pi(A){all} 0.120025 0.000213 0.090364 0.147662 0.119679 1375.25 1395.52 1.000
pi(C){all} 0.365767 0.000461 0.325288 0.409917 0.365668 1293.21 1397.11 1.000
pi(G){all} 0.239168 0.000388 0.201284 0.278077 0.238387 1314.49 1321.00 1.000
pi(T){all} 0.275040 0.000406 0.236830 0.315056 0.274351 1274.11 1346.44 1.000
alpha{1,2} 0.203478 0.033950 0.000260 0.524118 0.160956 1094.65 1217.07 1.001
alpha{3} 0.906771 0.349609 0.137599 2.074984 0.748727 1246.15 1273.14 1.000
pinvar{all} 0.278017 0.027465 0.000033 0.566670 0.264733 756.55 978.69 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 2828 0.942039 0.002827 0.940040 0.944037 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.030122 0.000425 0.000049 0.068662 0.026402 1.000 2
length{all}[2] 0.010377 0.000034 0.001009 0.021834 0.009435 1.000 2
length{all}[3] 0.008001 0.000029 0.000018 0.018456 0.006846 1.000 2
length{all}[4] 0.436841 0.019222 0.219923 0.725707 0.412822 1.000 2
length{all}[5] 0.039485 0.000390 0.001764 0.075482 0.037976 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.002827
Maximum standard deviation of split frequencies = 0.002827
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /------------------------------------ C2 (2)
\-----------------94----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/----- C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /- C2 (2)
\------+
\- C3 (3)
|-------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 447
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sites with gaps or missing data are removed.
60 ambiguity characters in seq. 1
42 ambiguity characters in seq. 2
42 ambiguity characters in seq. 3
84 ambiguity characters in seq. 4
28 sites are removed. 35 36 37 38 39 40 41 42 43 44 45 46 47 103 136 137 138 139 140 141 142 143 144 145 146 147 148 149
Sequences read..
Counting site patterns.. 0:00
74 patterns at 121 / 121 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
72224 bytes for conP
10064 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, (2, 3)); MP score: 66
0.080201 0.555290 0.091327 0.025998 0.015727 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -805.930215
Iterating by ming2
Initial: fx= 805.930215
x= 0.08020 0.55529 0.09133 0.02600 0.01573 0.30000 1.30000
1 h-m-p 0.0000 0.0470 49.2813 ++++CYC 802.027901 2 0.0042 19 | 0/7
2 h-m-p 0.0003 0.0013 176.7561 +YYCCCC 798.025352 5 0.0008 38 | 0/7
3 h-m-p 0.0000 0.0002 325.6315 YCYCCC 797.339915 5 0.0001 56 | 0/7
4 h-m-p 0.0006 0.0044 49.3385 YCCCC 796.102715 4 0.0016 73 | 0/7
5 h-m-p 0.0012 0.0061 47.2825 YCC 795.234855 2 0.0020 86 | 0/7
6 h-m-p 0.0023 0.0284 41.1274 +YYYCYCCCCC 789.814962 9 0.0130 111 | 0/7
7 h-m-p 0.0034 0.0168 35.3175 CYCCCC 788.428145 5 0.0052 130 | 0/7
8 h-m-p 1.1135 8.0000 0.1660 YCCCC 786.751481 4 0.6688 147 | 0/7
9 h-m-p 0.9299 4.6496 0.0692 CCCC 786.338517 3 1.1883 170 | 0/7
10 h-m-p 1.4584 8.0000 0.0564 CCC 786.215941 2 1.4179 191 | 0/7
11 h-m-p 1.5798 8.0000 0.0506 CCC 786.158399 2 1.1969 212 | 0/7
12 h-m-p 1.6000 8.0000 0.0111 YC 786.153216 1 1.2769 230 | 0/7
13 h-m-p 1.6000 8.0000 0.0010 YC 786.153001 1 1.0462 248 | 0/7
14 h-m-p 1.6000 8.0000 0.0002 Y 786.152998 0 1.1973 265 | 0/7
15 h-m-p 1.6000 8.0000 0.0000 C 786.152998 0 1.3376 282 | 0/7
16 h-m-p 1.6000 8.0000 0.0000 Y 786.152998 0 1.1504 299 | 0/7
17 h-m-p 1.6000 8.0000 0.0000 Y 786.152998 0 1.0752 316 | 0/7
18 h-m-p 1.6000 8.0000 0.0000 ---------------N 786.152998 0 0.0000 348
Out..
lnL = -786.152998
349 lfun, 349 eigenQcodon, 1745 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 4, (2, 3)); MP score: 66
0.080201 0.555290 0.091327 0.025998 0.015727 0.974618 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.125506
np = 8
lnL0 = -782.234947
Iterating by ming2
Initial: fx= 782.234947
x= 0.08020 0.55529 0.09133 0.02600 0.01573 0.97462 0.75552 0.23461
1 h-m-p 0.0000 0.0056 24.4050 ++++YYCCCCC 781.220295 6 0.0029 27 | 0/8
2 h-m-p 0.0001 0.0005 482.1817 ++ 777.821193 m 0.0005 38 | 0/8
3 h-m-p 0.0000 0.0000 86.3120
h-m-p: 3.85071075e-21 1.92535538e-20 8.63120186e+01 777.821193
.. | 0/8
4 h-m-p 0.0000 0.0006 62.2247 ++CYCCC 777.169749 4 0.0003 67 | 0/8
5 h-m-p 0.0006 0.0283 27.6849 +CYCC 776.590528 3 0.0019 84 | 0/8
6 h-m-p 0.0003 0.0017 18.3629 ++ 776.289446 m 0.0017 95 | 1/8
7 h-m-p 0.0003 0.0036 74.8464 CCC 776.224437 2 0.0003 110 | 1/8
8 h-m-p 0.0041 0.1831 5.3057 CC 776.211854 1 0.0015 123 | 1/8
9 h-m-p 0.0030 0.0994 2.6728 +YC 776.191365 1 0.0076 136 | 1/8
10 h-m-p 0.0055 0.2039 3.7185 YCC 776.165446 2 0.0089 150 | 1/8
11 h-m-p 0.0350 0.9915 0.9492 YCCC 776.137894 3 0.0669 166 | 1/8
12 h-m-p 1.6000 8.0000 0.0138 YC 776.102373 1 0.8004 185 | 1/8
13 h-m-p 1.6000 8.0000 0.0024 YC 776.102106 1 0.9850 204 | 1/8
14 h-m-p 1.6000 8.0000 0.0001 Y 776.102102 0 0.9079 222 | 1/8
15 h-m-p 1.6000 8.0000 0.0000 Y 776.102101 0 1.0421 240 | 1/8
16 h-m-p 1.6000 8.0000 0.0000 Y 776.102101 0 0.9958 258 | 1/8
17 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/8
18 h-m-p 0.0160 8.0000 0.0001 -----C 776.102101 0 0.0000 313
Out..
lnL = -776.102101
314 lfun, 942 eigenQcodon, 3140 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 4, (2, 3)); MP score: 66
initial w for M2:NSpselection reset.
0.080201 0.555290 0.091327 0.025998 0.015727 0.876995 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.182982
np = 10
lnL0 = -783.018279
Iterating by ming2
Initial: fx= 783.018279
x= 0.08020 0.55529 0.09133 0.02600 0.01573 0.87700 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0134 31.4827 ++++CCCC 782.074523 3 0.0024 25 | 0/10
2 h-m-p 0.0004 0.0019 165.6099 ++ 776.548836 m 0.0019 38 | 1/10
3 h-m-p 0.0003 0.0013 81.9019 YCCC 776.210862 3 0.0005 56 | 1/10
4 h-m-p 0.0004 0.0039 111.7914 +CCCCC 774.751191 4 0.0016 78 | 1/10
5 h-m-p 0.0046 0.0231 13.5401 CCCC 774.379850 3 0.0063 97 | 1/10
6 h-m-p 0.0137 0.6089 6.2713 +CCC 773.592660 2 0.0499 115 | 1/10
7 h-m-p 0.1548 0.7739 1.7943 CCCCC 772.686355 4 0.2690 136 | 1/10
8 h-m-p 0.1867 2.9065 2.5858 CCC 772.305376 2 0.1696 153 | 1/10
9 h-m-p 0.2176 2.2087 2.0147 CCC 771.951734 2 0.2587 170 | 1/10
10 h-m-p 1.6000 8.0000 0.2973 YCCC 771.896593 3 0.8550 188 | 0/10
11 h-m-p 0.0035 0.1732 71.9043 CCC 771.826385 2 0.0041 214 | 0/10
12 h-m-p 0.6631 8.0000 0.4394 +CCCC 771.626502 3 3.0093 234 | 0/10
13 h-m-p 1.6000 8.0000 0.3905 YC 771.554491 1 1.0707 258 | 0/10
14 h-m-p 0.9293 8.0000 0.4499 CCC 771.525030 2 1.3072 285 | 0/10
15 h-m-p 1.6000 8.0000 0.1199 CYC 771.516293 2 1.8024 311 | 0/10
16 h-m-p 1.6000 8.0000 0.0419 +YC 771.507238 1 4.3432 336 | 0/10
17 h-m-p 1.5230 8.0000 0.1196 ++ 771.470746 m 8.0000 359 | 0/10
18 h-m-p 1.6000 8.0000 0.1170 CCC 771.456372 2 1.8560 386 | 0/10
19 h-m-p 0.6097 8.0000 0.3562 CCC 771.449905 2 0.9224 413 | 0/10
20 h-m-p 1.6000 8.0000 0.1381 CCC 771.442077 2 2.2592 440 | 0/10
21 h-m-p 1.6000 8.0000 0.1894 YC 771.433205 1 3.9872 464 | 0/10
22 h-m-p 1.6000 8.0000 0.2143 CYC 771.428816 2 2.1723 490 | 0/10
23 h-m-p 0.8377 8.0000 0.5557 CC 771.427027 1 0.9483 515 | 0/10
24 h-m-p 1.5055 8.0000 0.3500 CCC 771.425281 2 2.1554 542 | 0/10
25 h-m-p 1.6000 8.0000 0.3161 YC 771.424323 1 2.4810 566 | 0/10
26 h-m-p 1.6000 8.0000 0.3536 CC 771.423918 1 2.3433 591 | 0/10
27 h-m-p 1.6000 8.0000 0.3831 C 771.423741 0 2.1398 614 | 0/10
28 h-m-p 1.6000 8.0000 0.3441 C 771.423659 0 2.1620 637 | 0/10
29 h-m-p 1.6000 8.0000 0.3638 Y 771.423620 0 2.5670 660 | 0/10
30 h-m-p 1.6000 8.0000 0.3418 C 771.423605 0 2.1238 683 | 0/10
31 h-m-p 1.6000 8.0000 0.3762 C 771.423598 0 2.2029 706 | 0/10
32 h-m-p 1.6000 8.0000 0.3719 C 771.423595 0 2.0668 729 | 0/10
33 h-m-p 1.6000 8.0000 0.3623 C 771.423593 0 2.4223 752 | 0/10
34 h-m-p 1.6000 8.0000 0.3503 C 771.423593 0 2.4806 775 | 0/10
35 h-m-p 1.6000 8.0000 0.3510 Y 771.423592 0 2.5683 798 | 0/10
36 h-m-p 1.6000 8.0000 0.3431 C 771.423592 0 2.4980 821 | 0/10
37 h-m-p 1.6000 8.0000 0.3416 Y 771.423592 0 2.6292 844 | 0/10
38 h-m-p 1.6000 8.0000 0.3824 Y 771.423592 0 2.6860 867 | 0/10
39 h-m-p 1.6000 8.0000 0.2357 C 771.423592 0 1.8829 890 | 0/10
40 h-m-p 1.0613 8.0000 0.4182 ++ 771.423592 m 8.0000 913 | 0/10
41 h-m-p 1.6000 8.0000 0.6269 C 771.423592 0 1.6000 936 | 0/10
42 h-m-p 1.6000 8.0000 0.1163 --------------C 771.423592 0 0.0000 973 | 0/10
43 h-m-p 0.0160 8.0000 0.0024 -------------.. | 0/10
44 h-m-p 0.0160 8.0000 0.0001 -----C 771.423592 0 0.0000 1035
Out..
lnL = -771.423592
1036 lfun, 4144 eigenQcodon, 15540 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -777.084548 S = -711.178051 -60.457971
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 74 patterns 0:07
did 20 / 74 patterns 0:07
did 30 / 74 patterns 0:07
did 40 / 74 patterns 0:07
did 50 / 74 patterns 0:07
did 60 / 74 patterns 0:07
did 70 / 74 patterns 0:07
did 74 / 74 patterns 0:07
Time used: 0:07
Model 3: discrete
TREE # 1
(1, 4, (2, 3)); MP score: 66
0.080201 0.555290 0.091327 0.025998 0.015727 0.846677 0.408838 0.998206 0.205895 0.447456 0.676938
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.515026
np = 11
lnL0 = -785.513884
Iterating by ming2
Initial: fx= 785.513884
x= 0.08020 0.55529 0.09133 0.02600 0.01573 0.84668 0.40884 0.99821 0.20590 0.44746 0.67694
1 h-m-p 0.0000 0.0056 17.6537 +++YCCC 785.242263 3 0.0016 24 | 0/11
2 h-m-p 0.0002 0.0031 131.1429 +YCCC 783.758692 3 0.0016 44 | 0/11
3 h-m-p 0.0003 0.0014 100.6593 YCCCCC 783.247500 5 0.0006 67 | 0/11
4 h-m-p 0.0001 0.0003 312.1444 ++ 782.401534 m 0.0003 81 | 1/11
5 h-m-p 0.0059 0.0295 8.2700 CYCCC 782.057487 4 0.0096 102 | 1/11
6 h-m-p 0.0049 0.0896 16.2423 ++YCCCC 776.443934 4 0.0595 125 | 1/11
7 h-m-p 0.0086 0.0429 17.4152 +YCCC 775.536823 3 0.0235 145 | 1/11
8 h-m-p 0.0200 0.9832 20.5061 +CYCCC 774.052083 4 0.0650 167 | 1/11
9 h-m-p 0.1042 0.5210 3.2689 CYCCC 773.055787 4 0.1556 188 | 1/11
10 h-m-p 0.3620 1.8099 0.7809 YYC 772.541084 2 0.3216 204 | 1/11
11 h-m-p 0.1834 0.9282 1.3689 YCCC 772.170187 3 0.1324 233 | 1/11
12 h-m-p 0.5487 4.7563 0.3304 YCCC 771.837592 3 1.2897 252 | 1/11
13 h-m-p 1.6000 8.0000 0.1552 CCC 771.742514 2 2.1666 280 | 0/11
14 h-m-p 0.0109 0.0944 30.9270 CCC 771.710957 2 0.0039 308 | 0/11
15 h-m-p 0.4757 8.0000 0.2532 +CCCC 771.602694 3 2.6823 329 | 0/11
16 h-m-p 1.6000 8.0000 0.3390 CCC 771.520152 2 2.3075 358 | 0/11
17 h-m-p 1.6000 8.0000 0.1322 YC 771.496846 1 1.0574 384 | 0/11
18 h-m-p 0.4303 8.0000 0.3248 +YYC 771.468888 2 1.6302 412 | 0/11
19 h-m-p 1.6000 8.0000 0.1206 YCCC 771.453170 3 2.9115 442 | 0/11
20 h-m-p 1.6000 8.0000 0.0977 CYC 771.450559 2 1.4470 470 | 0/11
21 h-m-p 1.6000 8.0000 0.0484 C 771.448665 0 1.5247 495 | 0/11
22 h-m-p 1.3793 8.0000 0.0535 +YC 771.442871 1 4.7286 522 | 0/11
23 h-m-p 1.5527 8.0000 0.1630 YCC 771.434527 2 2.6877 550 | 0/11
24 h-m-p 1.6000 8.0000 0.0642 CC 771.431484 1 1.3893 577 | 0/11
25 h-m-p 0.4348 8.0000 0.2053 +YC 771.429627 1 1.1331 604 | 0/11
26 h-m-p 1.6000 8.0000 0.1156 YCC 771.426570 2 2.9521 632 | 0/11
27 h-m-p 1.6000 8.0000 0.1597 C 771.425257 0 1.6000 657 | 0/11
28 h-m-p 1.6000 8.0000 0.0664 C 771.424756 0 1.8084 682 | 0/11
29 h-m-p 0.5759 8.0000 0.2085 +YC 771.424083 1 1.8679 709 | 0/11
30 h-m-p 1.6000 8.0000 0.1141 CC 771.423699 1 2.1354 736 | 0/11
31 h-m-p 1.6000 8.0000 0.1044 C 771.423633 0 1.6531 761 | 0/11
32 h-m-p 1.6000 8.0000 0.0489 C 771.423602 0 2.4496 786 | 0/11
33 h-m-p 1.6000 8.0000 0.0733 Y 771.423593 0 1.1471 811 | 0/11
34 h-m-p 1.6000 8.0000 0.0165 C 771.423592 0 1.5203 836 | 0/11
35 h-m-p 1.6000 8.0000 0.0031 Y 771.423592 0 1.1943 861 | 0/11
36 h-m-p 1.6000 8.0000 0.0001 Y 771.423592 0 1.0884 886 | 0/11
37 h-m-p 1.6000 8.0000 0.0000 Y 771.423592 0 0.4000 911 | 0/11
38 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/11
39 h-m-p 0.0160 8.0000 0.0000 --------C 771.423592 0 0.0000 983
Out..
lnL = -771.423592
984 lfun, 3936 eigenQcodon, 14760 P(t)
Time used: 0:12
Model 7: beta
TREE # 1
(1, 4, (2, 3)); MP score: 66
0.080201 0.555290 0.091327 0.025998 0.015727 0.846678 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.048797
np = 8
lnL0 = -783.621258
Iterating by ming2
Initial: fx= 783.621258
x= 0.08020 0.55529 0.09133 0.02600 0.01573 0.84668 0.99671 1.80579
1 h-m-p 0.0000 0.0049 17.5124 +++YCCC 783.388192 3 0.0014 21 | 0/8
2 h-m-p 0.0002 0.0053 106.2065 +CYC 782.539874 2 0.0011 36 | 0/8
3 h-m-p 0.0004 0.0021 18.6701 YYC 782.506968 2 0.0003 49 | 0/8
4 h-m-p 0.0006 0.2990 21.6892 CCC 782.462979 2 0.0005 64 | 0/8
5 h-m-p 0.0019 0.0230 5.6921 CCC 782.434606 2 0.0023 79 | 0/8
6 h-m-p 0.0050 0.5154 2.6286 ++CCCC 782.177747 3 0.0957 98 | 0/8
7 h-m-p 0.1068 0.5821 2.3553 YCYCYC 781.388878 5 0.2958 117 | 0/8
8 h-m-p 0.0065 0.0326 28.6176 CYCYCCC 781.094433 6 0.0115 138 | 0/8
9 h-m-p 0.0781 0.3906 2.1946 +YYYCYC 779.836191 5 0.2850 156 | 0/8
10 h-m-p 0.0042 0.0208 12.4911 ++ 777.114278 m 0.0208 167 | 0/8
11 h-m-p 0.0000 0.0000 0.3157
h-m-p: 1.54098483e-17 7.70492413e-17 3.15651830e-01 777.114278
.. | 0/8
12 h-m-p 0.0000 0.0041 7.4528 +++CCYYC 776.686642 4 0.0003 204 | 0/8
13 h-m-p 0.0001 0.0008 28.4854 YCYYYYYC 776.679513 7 0.0001 223 | 0/8
14 h-m-p 0.0001 0.0115 16.9909 +CYYCC 776.634460 4 0.0009 242 | 0/8
15 h-m-p 0.0004 0.0049 37.7428 CCC 776.579887 2 0.0006 257 | 0/8
16 h-m-p 0.0009 0.0050 25.2183 YYC 776.540549 2 0.0007 270 | 0/8
17 h-m-p 0.0014 0.0487 12.5028 +CYC 776.407999 2 0.0058 285 | 0/8
18 h-m-p 0.0026 0.0130 3.1759 ++ 776.340055 m 0.0130 296 | 0/8
19 h-m-p 0.0070 0.1784 5.9475 YCCC 776.236097 3 0.0169 312 | 0/8
20 h-m-p 0.1285 0.6423 0.0791 +CYC 776.210415 2 0.5469 327 | 0/8
21 h-m-p 1.6000 8.0000 0.0088 YYYYY 776.208411 4 0.4000 350 | 0/8
22 h-m-p 1.2252 8.0000 0.0029 CC 776.208092 1 1.7364 371 | 0/8
23 h-m-p 1.6000 8.0000 0.0013 C 776.207917 0 1.8892 390 | 0/8
24 h-m-p 1.6000 8.0000 0.0006 C 776.207901 0 1.4648 409 | 0/8
25 h-m-p 1.6000 8.0000 0.0002 ++ 776.207875 m 8.0000 428 | 0/8
26 h-m-p 1.0369 5.1843 0.0005 Y 776.207869 0 1.9696 447 | 0/8
27 h-m-p 1.1218 5.6091 0.0003 Y 776.207868 0 2.2474 466 | 0/8
28 h-m-p 0.6443 3.2214 0.0003 +C 776.207867 0 2.5771 486 | 0/8
29 h-m-p 0.1439 0.7197 0.0003 ++ 776.207867 m 0.7197 505 | 1/8
30 h-m-p 0.6584 8.0000 0.0003 -Y 776.207867 0 0.0682 525 | 1/8
31 h-m-p 1.0789 8.0000 0.0000 Y 776.207867 0 0.8410 543 | 1/8
32 h-m-p 1.6000 8.0000 0.0000 C 776.207867 0 0.5199 561 | 1/8
33 h-m-p 1.0150 8.0000 0.0000 -Y 776.207867 0 0.0634 580
Out..
lnL = -776.207867
581 lfun, 6391 eigenQcodon, 29050 P(t)
Time used: 0:22
Model 8: beta&w>1
TREE # 1
(1, 4, (2, 3)); MP score: 66
initial w for M8:NSbetaw>1 reset.
0.080201 0.555290 0.091327 0.025998 0.015727 0.885029 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.323340
np = 10
lnL0 = -778.226636
Iterating by ming2
Initial: fx= 778.226636
x= 0.08020 0.55529 0.09133 0.02600 0.01573 0.88503 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0400 21.0196 ++++CYCC 777.092200 3 0.0057 24 | 0/10
2 h-m-p 0.0002 0.0010 109.6134 YCYCCC 776.483721 5 0.0005 45 | 0/10
3 h-m-p 0.0007 0.0061 74.4323 CCC 775.846811 2 0.0011 62 | 0/10
4 h-m-p 0.0004 0.0019 70.9159 CYCCC 775.532004 4 0.0006 82 | 0/10
5 h-m-p 0.0020 0.0310 19.1382 +CYC 774.867822 2 0.0076 99 | 0/10
6 h-m-p 0.0026 0.0129 40.2630 +YYCCC 772.486069 4 0.0093 119 | 0/10
7 h-m-p 0.0028 0.0140 14.6125 YCCC 772.286255 3 0.0043 137 | 0/10
8 h-m-p 0.0459 0.6879 1.3666 YCCC 772.177548 3 0.1006 155 | 0/10
9 h-m-p 0.3844 4.9685 0.3575 +YCCC 771.969658 3 1.1083 174 | 0/10
10 h-m-p 0.4160 2.0802 0.6523 YYC 771.886559 2 0.3324 199 | 0/10
11 h-m-p 0.5319 6.6359 0.4076 YCCC 771.746240 3 1.3257 227 | 0/10
12 h-m-p 1.2530 8.0000 0.4313 CYC 771.610453 2 1.4642 253 | 0/10
13 h-m-p 1.2236 8.0000 0.5161 YYCC 771.568939 3 0.9464 280 | 0/10
14 h-m-p 1.6000 8.0000 0.2865 YC 771.533682 1 1.1231 304 | 0/10
15 h-m-p 1.3533 8.0000 0.2378 CCC 771.518926 2 1.9817 331 | 0/10
16 h-m-p 1.6000 8.0000 0.0465 CC 771.515051 1 1.3140 356 | 0/10
17 h-m-p 1.0431 8.0000 0.0586 YC 771.512271 1 2.4990 380 | 0/10
18 h-m-p 1.6000 8.0000 0.0702 YC 771.507992 1 3.4941 404 | 0/10
19 h-m-p 1.6000 8.0000 0.1010 ++ 771.494688 m 8.0000 427 | 0/10
20 h-m-p 1.6000 8.0000 0.4470 YCC 771.476441 2 2.6738 453 | 0/10
21 h-m-p 1.6000 8.0000 0.6754 CC 771.466458 1 2.0651 478 | 0/10
22 h-m-p 1.6000 8.0000 0.8192 YC 771.455956 1 3.1160 502 | 0/10
23 h-m-p 1.6000 8.0000 1.2742 YCC 771.449666 2 2.4908 528 | 0/10
24 h-m-p 1.6000 8.0000 1.6259 YC 771.444488 1 3.3092 542 | 0/10
25 h-m-p 1.6000 8.0000 2.4179 YC 771.441352 1 2.6126 556 | 0/10
26 h-m-p 1.6000 8.0000 3.2518 YC 771.438885 1 3.5916 570 | 0/10
27 h-m-p 1.6000 8.0000 4.9498 CC 771.437433 1 2.3563 585 | 0/10
28 h-m-p 1.4021 7.0104 7.7638 YC 771.436418 1 2.4308 599 | 0/10
29 h-m-p 0.7315 3.6573 9.7213 +C 771.435562 0 2.7848 613 | 0/10
30 h-m-p 0.1177 0.5884 14.4153 ++ 771.435337 m 0.5884 626 | 1/10
31 h-m-p 0.0900 5.5421 14.9745 --------------.. | 1/10
32 h-m-p 0.0002 0.0812 0.4087 Y 771.435314 0 0.0003 664 | 1/10
33 h-m-p 0.0007 0.3414 0.2394 C 771.435300 0 0.0006 686 | 1/10
34 h-m-p 0.0014 0.6925 0.1584 Y 771.435291 0 0.0011 708 | 1/10
35 h-m-p 0.0100 4.9865 0.0603 C 771.435288 0 0.0021 730 | 1/10
36 h-m-p 0.0075 3.7261 0.0450 Y 771.435285 0 0.0040 752 | 1/10
37 h-m-p 0.0160 8.0000 0.0355 +C 771.435261 0 0.0704 775 | 1/10
38 h-m-p 0.0873 8.0000 0.0286 +CC 771.435161 1 0.5050 800 | 1/10
39 h-m-p 0.0662 8.0000 0.2181 +++YC 771.430213 1 3.3051 826 | 1/10
40 h-m-p 1.6000 8.0000 0.0463 ++ 771.427115 m 8.0000 848 | 1/10
41 h-m-p 0.9863 8.0000 0.3754 C 771.425932 0 0.9863 870 | 1/10
42 h-m-p 1.6000 8.0000 0.0095 Y 771.425925 0 0.9813 892 | 1/10
43 h-m-p 1.6000 8.0000 0.0008 Y 771.425925 0 1.0659 914 | 1/10
44 h-m-p 1.6000 8.0000 0.0002 Y 771.425925 0 0.9528 936 | 1/10
45 h-m-p 1.6000 8.0000 0.0000 Y 771.425925 0 0.4000 958
Out..
lnL = -771.425925
959 lfun, 11508 eigenQcodon, 52745 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -776.299730 S = -711.177303 -60.379855
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 74 patterns 0:40
did 20 / 74 patterns 0:40
did 30 / 74 patterns 0:41
did 40 / 74 patterns 0:41
did 50 / 74 patterns 0:41
did 60 / 74 patterns 0:41
did 70 / 74 patterns 0:41
did 74 / 74 patterns 0:42
Time used: 0:42
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=149
D_melanogaster_825-Oak-PB MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP
D_sechellia_825-Oak-PB MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
D_sechellia_825-Oak-PB MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
D_erecta_825-Oak-PB MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP
*** ***.*.:*****************:***** :**
D_melanogaster_825-Oak-PB APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV
D_sechellia_825-Oak-PB APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV
D_sechellia_825-Oak-PB APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV
D_erecta_825-Oak-PB APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA
**************************** * **. :* *:**:**:.
D_melanogaster_825-Oak-PB AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLIoooooo--------
D_sechellia_825-Oak-PB AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
D_sechellia_825-Oak-PB AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI--------------
D_erecta_825-Oak-PB AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLIoooooooooooooo
* *:*:** *********************:**
>D_melanogaster_825-Oak-PB ATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCTCTGGCTT AC------------------TCTGCTCCTGCTGCCGTGGTAGCTGCTCCC GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAA TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG CTCCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCTCCTGTGGTG GCGAAGTACGCGGCTACTCCTCTGGCTGCACGACTGGCCTACTCCTCGCC TTTGGCTTACTCCGCACCACTGAGCTACGCTGCTGCTCCTGCACCATTTC TCATC------------------------------------------ >D_sechellia_825-Oak-PB ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGGTGCTCCTCTGGCTG CTCCAGTAGTGGCCAAGTACGCGGCTGCTCCTCTGGCTGCTCCAGTAGTG GCCAAGTACGCGGCCGCTCCTGTGGCTGCACCTCTGGCCTACTCCTCGCC ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC TCATC------------------------------------------ >D_sechellia_825-Oak-PB ATGTTCAAATACGCCGTCGTCGTTCTCGTTCTCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCTCCCCTGGCATACACTGCTCCTCTGGCTT ACTCTGCTCCTCTGGCCTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCC GCTCCAGTTGTGACCGCCACCAGTAGCCAGGTGATCGCCAGGAACTACAA TGGAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTG CTCCACTGGTGGCCAAGTACTCGGCTGCTCCTCTGGCTGCTCCAGTAGTG GCCAAGTACGCGGCCGCTCCTCTGGCTGCACCTCTGGCCTACTCCTCGCC ATTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCATTTC TCATC------------------------------------------ >D_erecta_825-Oak-PB ATGTTCAAATCCGCTGTTGTGTTCCTGGCCATCGTTGCCTGCGCTGCTGC CAAGCCTGGACTCCTGGGTGCGCCTTTGGCCTACTCTGCTCCCCTGGCTT AC---------------------------------------ACTGCTCCT GCTCCAGTTGTGACCGCAACCAGTAGCCAGGTTATCGCCAGGAACTACAA TGGCATCGCCGCTGCTCCGGTGATTGCTCCCGTGGTGGCCAAATACGCGG CTGCTCCTCTGGCTGCTCCTGTGGCTGCTCCTCTGACTGCTCCTCTGGCT GCTCCT---CTGGCTGCTCCTCTGGCTGCTCCCTTGGCCTACTCCTCGCC GTTGGCCTACTCCGCACCACTGAGCTACGCCGCTGCTCCTGCACCACTTC TCATC------------------------------------------
>D_melanogaster_825-Oak-PB MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAY------SAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVV AKYAATPLAARLAYSSPLAYSAPLSYAAAPAPFLI >D_sechellia_825-Oak-PB MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVGAPLAAPVVAKYAAAPLAAPVV AKYAAAPVAAPLAYSSPLAYSAPLSYAAAPAPFLI >D_sechellia_825-Oak-PB MFKYAVVVLVLVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP APVVTATSSQVIARNYNGIAAAPVIAPVAAPLAAPLVAKYSAAPLAAPVV AKYAAAPLAAPLAYSSPLAYSAPLSYAAAPAPFLI >D_erecta_825-Oak-PB MFKSAVVFLAIVACAAAKPGLLGAPLAYSAPLAY-------------TAP APVVTATSSQVIARNYNGIAAAPVIAPVVAKYAAAPLAAPVAAPLTAPLA AP-LAAPLAAPLAYSSPLAYSAPLSYAAAPAPLLI
#NEXUS
[ID: 9304270436]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_825-Oak-PB
D_sechellia_825-Oak-PB
D_sechellia_825-Oak-PB
D_erecta_825-Oak-PB
;
end;
begin trees;
translate
1 D_melanogaster_825-Oak-PB,
2 D_sechellia_825-Oak-PB,
3 D_sechellia_825-Oak-PB,
4 D_erecta_825-Oak-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02640202,4:0.412822,(2:0.009435048,3:0.006846399)0.942:0.03797576);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02640202,4:0.412822,(2:0.009435048,3:0.006846399):0.03797576);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -889.70 -897.64
2 -889.77 -897.94
--------------------------------------
TOTAL -889.74 -897.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/825-Oak-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.522852 0.020542 0.280878 0.803748 0.497287 787.91 1144.45 1.000
r(A<->C){all} 0.117885 0.005050 0.001770 0.257085 0.106542 560.09 568.91 1.001
r(A<->G){all} 0.212347 0.007059 0.059244 0.372296 0.205007 496.56 558.65 1.002
r(A<->T){all} 0.237229 0.007176 0.082699 0.399957 0.227723 783.27 809.42 1.002
r(C<->G){all} 0.128731 0.002684 0.044040 0.235406 0.121330 807.66 845.39 1.001
r(C<->T){all} 0.176114 0.003498 0.060535 0.285755 0.171138 747.84 807.13 1.000
r(G<->T){all} 0.127694 0.003661 0.019685 0.240768 0.119516 654.97 697.32 1.000
pi(A){all} 0.120025 0.000213 0.090364 0.147662 0.119679 1375.25 1395.52 1.000
pi(C){all} 0.365767 0.000461 0.325288 0.409917 0.365668 1293.21 1397.11 1.000
pi(G){all} 0.239168 0.000388 0.201284 0.278077 0.238387 1314.49 1321.00 1.000
pi(T){all} 0.275040 0.000406 0.236830 0.315056 0.274351 1274.11 1346.44 1.000
alpha{1,2} 0.203478 0.033950 0.000260 0.524118 0.160956 1094.65 1217.07 1.001
alpha{3} 0.906771 0.349609 0.137599 2.074984 0.748727 1246.15 1273.14 1.000
pinvar{all} 0.278017 0.027465 0.000033 0.566670 0.264733 756.55 978.69 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/825-Oak-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 121
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 0 | Ser TCT 0 0 0 1 | Tyr TAT 0 0 0 0 | Cys TGT 0 0 0 0
TTC 1 1 1 2 | TCC 2 2 2 3 | TAC 8 8 8 7 | TGC 1 1 1 1
Leu TTA 0 0 0 0 | TCA 0 0 0 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 1 1 1 3 | TCG 1 1 2 1 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 1 | Pro CCT 10 8 8 10 | His CAT 0 0 0 0 | Arg CGT 0 0 0 0
CTC 4 4 4 2 | CCC 3 3 3 3 | CAC 0 0 0 0 | CGC 0 0 0 0
CTA 0 0 0 0 | CCA 3 6 6 3 | Gln CAA 0 0 0 0 | CGA 1 0 0 0
CTG 7 7 9 9 | CCG 0 0 0 2 | CAG 1 1 1 1 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 | Thr ACT 3 1 1 2 | Asn AAT 2 1 1 1 | Ser AGT 1 1 1 1
ATC 3 3 3 4 | ACC 2 2 2 2 | AAC 0 1 1 1 | AGC 2 2 2 2
ATA 0 0 0 0 | ACA 0 0 0 0 | Lys AAA 1 1 1 2 | Arg AGA 0 0 0 0
Met ATG 1 1 1 1 | ACG 0 0 0 0 | AAG 3 3 3 1 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 4 5 5 4 | Ala GCT 27 23 24 25 | Asp GAT 0 0 0 0 | Gly GGT 1 2 1 1
GTC 3 2 2 0 | GCC 5 11 11 10 | GAC 0 0 0 0 | GGC 0 0 0 1
GTA 0 2 1 0 | GCA 4 4 4 3 | Glu GAA 0 0 0 0 | GGA 2 2 2 1
GTG 6 6 5 6 | GCG 4 2 1 2 | GAG 0 0 0 0 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_825-Oak-PB
position 1: T:0.12397 C:0.24793 A:0.16529 G:0.46281
position 2: T:0.27273 C:0.52893 A:0.12397 G:0.07438
position 3: T:0.42149 C:0.28099 A:0.09091 G:0.20661
Average T:0.27273 C:0.35262 A:0.12672 G:0.24793
#2: D_sechellia_825-Oak-PB
position 1: T:0.12397 C:0.23967 A:0.14876 G:0.48760
position 2: T:0.28099 C:0.52066 A:0.12397 G:0.07438
position 3: T:0.35537 C:0.33058 A:0.12397 G:0.19008
Average T:0.25344 C:0.36364 A:0.13223 G:0.25069
#3: D_sechellia_825-Oak-PB
position 1: T:0.13223 C:0.25620 A:0.14876 G:0.46281
position 2: T:0.28099 C:0.52893 A:0.12397 G:0.06612
position 3: T:0.35537 C:0.33058 A:0.11570 G:0.19835
Average T:0.25620 C:0.37190 A:0.12948 G:0.24242
#4: D_erecta_825-Oak-PB
position 1: T:0.14876 C:0.25620 A:0.15702 G:0.43802
position 2: T:0.27273 C:0.55372 A:0.10744 G:0.06612
position 3: T:0.38843 C:0.31405 A:0.07438 G:0.22314
Average T:0.26997 C:0.37466 A:0.11295 G:0.24242
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 3 | Ser S TCT 1 | Tyr Y TAT 0 | Cys C TGT 0
TTC 5 | TCC 9 | TAC 31 | TGC 4
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 5 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 2 | Pro P CCT 36 | His H CAT 0 | Arg R CGT 0
CTC 14 | CCC 12 | CAC 0 | CGC 0
CTA 0 | CCA 18 | Gln Q CAA 0 | CGA 1
CTG 32 | CCG 2 | CAG 4 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 4 | Thr T ACT 7 | Asn N AAT 5 | Ser S AGT 4
ATC 13 | ACC 8 | AAC 3 | AGC 8
ATA 0 | ACA 0 | Lys K AAA 5 | Arg R AGA 0
Met M ATG 4 | ACG 0 | AAG 10 | AGG 4
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 99 | Asp D GAT 0 | Gly G GGT 5
GTC 7 | GCC 37 | GAC 0 | GGC 1
GTA 3 | GCA 15 | Glu E GAA 0 | GGA 7
GTG 23 | GCG 9 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13223 C:0.25000 A:0.15496 G:0.46281
position 2: T:0.27686 C:0.53306 A:0.11983 G:0.07025
position 3: T:0.38017 C:0.31405 A:0.10124 G:0.20455
Average T:0.26309 C:0.36570 A:0.12534 G:0.24587
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_825-Oak-PB
D_sechellia_825-Oak-PB 0.1473 (0.0240 0.1631)
D_sechellia_825-Oak-PB 0.1591 (0.0241 0.1512) 1.7316 (0.0159 0.0092)
D_erecta_825-Oak-PB 0.3795 (0.1418 0.3738) 0.3022 (0.1322 0.4376) 0.2934 (0.1278 0.4355)
Model 0: one-ratio
TREE # 1: (1, 4, (2, 3)); MP score: 66
lnL(ntime: 5 np: 7): -786.152998 +0.000000
5..1 5..4 5..6 6..2 6..3
0.086251 0.662430 0.081285 0.024718 0.016088 0.974618 0.411790
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87077
(1: 0.086251, 4: 0.662430, (2: 0.024718, 3: 0.016088): 0.081285);
(D_melanogaster_825-Oak-PB: 0.086251, D_erecta_825-Oak-PB: 0.662430, (D_sechellia_825-Oak-PB: 0.024718, D_sechellia_825-Oak-PB: 0.016088): 0.081285);
Detailed output identifying parameters
kappa (ts/tv) = 0.97462
omega (dN/dS) = 0.41179
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.086 226.9 136.1 0.4118 0.0187 0.0455 4.2 6.2
5..4 0.662 226.9 136.1 0.4118 0.1438 0.3492 32.6 47.5
5..6 0.081 226.9 136.1 0.4118 0.0176 0.0429 4.0 5.8
6..2 0.025 226.9 136.1 0.4118 0.0054 0.0130 1.2 1.8
6..3 0.016 226.9 136.1 0.4118 0.0035 0.0085 0.8 1.2
tree length for dN: 0.1890
tree length for dS: 0.4590
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 66
lnL(ntime: 5 np: 8): -776.102101 +0.000000
5..1 5..4 5..6 6..2 6..3
0.083601 0.805810 0.092151 0.025092 0.016475 0.876995 0.634040 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.02313
(1: 0.083601, 4: 0.805810, (2: 0.025092, 3: 0.016475): 0.092151);
(D_melanogaster_825-Oak-PB: 0.083601, D_erecta_825-Oak-PB: 0.805810, (D_sechellia_825-Oak-PB: 0.025092, D_sechellia_825-Oak-PB: 0.016475): 0.092151);
Detailed output identifying parameters
kappa (ts/tv) = 0.87700
dN/dS (w) for site classes (K=2)
p: 0.63404 0.36596
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.084 227.2 135.8 0.3660 0.0169 0.0462 3.8 6.3
5..4 0.806 227.2 135.8 0.3660 0.1630 0.4453 37.0 60.5
5..6 0.092 227.2 135.8 0.3660 0.0186 0.0509 4.2 6.9
6..2 0.025 227.2 135.8 0.3660 0.0051 0.0139 1.2 1.9
6..3 0.016 227.2 135.8 0.3660 0.0033 0.0091 0.8 1.2
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 66
lnL(ntime: 5 np: 10): -771.423592 +0.000000
5..1 5..4 5..6 6..2 6..3
0.095671 1.022242 0.119612 0.030389 0.014988 0.846677 0.863223 0.000000 0.127779 5.949675
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.28290
(1: 0.095671, 4: 1.022242, (2: 0.030389, 3: 0.014988): 0.119612);
(D_melanogaster_825-Oak-PB: 0.095671, D_erecta_825-Oak-PB: 1.022242, (D_sechellia_825-Oak-PB: 0.030389, D_sechellia_825-Oak-PB: 0.014988): 0.119612);
Detailed output identifying parameters
kappa (ts/tv) = 0.84668
dN/dS (w) for site classes (K=3)
p: 0.86322 0.00000 0.13678
w: 0.12778 1.00000 5.94967
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.096 227.3 135.7 0.9241 0.0309 0.0335 7.0 4.5
5..4 1.022 227.3 135.7 0.9241 0.3306 0.3578 75.1 48.6
5..6 0.120 227.3 135.7 0.9241 0.0387 0.0419 8.8 5.7
6..2 0.030 227.3 135.7 0.9241 0.0098 0.0106 2.2 1.4
6..3 0.015 227.3 135.7 0.9241 0.0048 0.0052 1.1 0.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.506 3.073
66 A 0.961* 5.722
68 P 0.990* 5.891
69 L 0.993** 5.907
73 V 0.999** 5.943
76 K 0.989* 5.883
77 Y 0.978* 5.821
78 A 0.985* 5.860
80 T 0.670 4.029
89 K 0.991** 5.895
90 A 0.970* 5.773
92 T 0.670 4.029
97 R 0.501 3.046
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.791 5.415 +- 3.049
68 P 0.873 5.892 +- 2.795
69 L 0.915 6.176 +- 2.651
73 V 0.941 6.345 +- 2.530
76 K 0.882 5.967 +- 2.772
77 Y 0.822 5.569 +- 2.947
78 A 0.880 5.979 +- 2.796
80 T 0.542 3.742 +- 3.303
89 K 0.896 6.053 +- 2.722
90 A 0.784 5.315 +- 3.023
92 T 0.542 3.742 +- 3.303
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.635 0.324 0.039 0.002 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.003 0.034 0.090 0.133 0.151 0.150 0.137 0.119 0.101 0.083
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.015 0.013
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.008 0.055 0.069 0.017
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.010 0.060 0.169 0.098 0.008
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.011 0.046 0.141 0.193 0.068 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 3: discrete (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 66
lnL(ntime: 5 np: 11): -771.423592 +0.000000
5..1 5..4 5..6 6..2 6..3
0.095671 1.022241 0.119613 0.030389 0.014988 0.846678 0.004515 0.858708 0.127773 0.127778 5.949667
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.28290
(1: 0.095671, 4: 1.022241, (2: 0.030389, 3: 0.014988): 0.119613);
(D_melanogaster_825-Oak-PB: 0.095671, D_erecta_825-Oak-PB: 1.022241, (D_sechellia_825-Oak-PB: 0.030389, D_sechellia_825-Oak-PB: 0.014988): 0.119613);
Detailed output identifying parameters
kappa (ts/tv) = 0.84668
dN/dS (w) for site classes (K=3)
p: 0.00451 0.85871 0.13678
w: 0.12777 0.12778 5.94967
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.096 227.3 135.7 0.9241 0.0309 0.0335 7.0 4.5
5..4 1.022 227.3 135.7 0.9241 0.3306 0.3578 75.1 48.6
5..6 0.120 227.3 135.7 0.9241 0.0387 0.0419 8.8 5.7
6..2 0.030 227.3 135.7 0.9241 0.0098 0.0106 2.2 1.4
6..3 0.015 227.3 135.7 0.9241 0.0048 0.0052 1.1 0.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.506 3.073
66 A 0.961* 5.722
68 P 0.990* 5.891
69 L 0.993** 5.907
73 V 0.999** 5.943
76 K 0.989* 5.883
77 Y 0.978* 5.821
78 A 0.985* 5.860
80 T 0.670 4.029
89 K 0.991** 5.895
90 A 0.970* 5.773
92 T 0.670 4.029
97 R 0.501 3.046
Time used: 0:12
Model 7: beta (10 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 66
lnL(ntime: 5 np: 8): -776.207867 +0.000000
5..1 5..4 5..6 6..2 6..3
0.084027 0.802365 0.093731 0.025458 0.016704 0.885029 0.005000 0.007546
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.02229
(1: 0.084027, 4: 0.802365, (2: 0.025458, 3: 0.016704): 0.093731);
(D_melanogaster_825-Oak-PB: 0.084027, D_erecta_825-Oak-PB: 0.802365, (D_sechellia_825-Oak-PB: 0.025458, D_sechellia_825-Oak-PB: 0.016704): 0.093731);
Detailed output identifying parameters
kappa (ts/tv) = 0.88503
Parameters in M7 (beta):
p = 0.00500 q = 0.00755
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.084 227.2 135.8 0.4000 0.0179 0.0448 4.1 6.1
5..4 0.802 227.2 135.8 0.4000 0.1713 0.4283 38.9 58.2
5..6 0.094 227.2 135.8 0.4000 0.0200 0.0500 4.5 6.8
6..2 0.025 227.2 135.8 0.4000 0.0054 0.0136 1.2 1.8
6..3 0.017 227.2 135.8 0.4000 0.0036 0.0089 0.8 1.2
Time used: 0:22
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 66
lnL(ntime: 5 np: 10): -771.425925 +0.000000
5..1 5..4 5..6 6..2 6..3
0.095605 1.022216 0.119656 0.030392 0.014984 0.846521 0.863366 14.625490 99.000000 5.951659
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.28285
(1: 0.095605, 4: 1.022216, (2: 0.030392, 3: 0.014984): 0.119656);
(D_melanogaster_825-Oak-PB: 0.095605, D_erecta_825-Oak-PB: 1.022216, (D_sechellia_825-Oak-PB: 0.030392, D_sechellia_825-Oak-PB: 0.014984): 0.119656);
Detailed output identifying parameters
kappa (ts/tv) = 0.84652
Parameters in M8 (beta&w>1):
p0 = 0.86337 p = 14.62549 q = 99.00000
(p1 = 0.13663) w = 5.95166
dN/dS (w) for site classes (K=11)
p: 0.08634 0.08634 0.08634 0.08634 0.08634 0.08634 0.08634 0.08634 0.08634 0.08634 0.13663
w: 0.08122 0.09657 0.10649 0.11484 0.12265 0.13049 0.13889 0.14858 0.16121 0.18366 5.95166
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.096 227.3 135.7 0.9241 0.0309 0.0335 7.0 4.5
5..4 1.022 227.3 135.7 0.9241 0.3306 0.3577 75.1 48.6
5..6 0.120 227.3 135.7 0.9241 0.0387 0.0419 8.8 5.7
6..2 0.030 227.3 135.7 0.9241 0.0098 0.0106 2.2 1.4
6..3 0.015 227.3 135.7 0.9241 0.0048 0.0052 1.1 0.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.505 3.074
66 A 0.959* 5.713
68 P 0.989* 5.889
69 L 0.992** 5.906
73 V 0.999** 5.944
76 K 0.988* 5.881
77 Y 0.977* 5.816
78 A 0.984* 5.857
80 T 0.669 4.029
89 K 0.990** 5.894
90 A 0.968* 5.765
92 T 0.669 4.029
97 R 0.501 3.048
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.864 5.566 +- 2.800
68 P 0.933 5.974 +- 2.516
69 L 0.956* 6.131 +- 2.415
73 V 0.976* 6.257 +- 2.305
76 K 0.936 6.002 +- 2.509
77 Y 0.895 5.728 +- 2.675
78 A 0.930 5.985 +- 2.544
80 T 0.618 3.981 +- 3.254
89 K 0.945 6.059 +- 2.467
90 A 0.867 5.540 +- 2.764
92 T 0.618 3.981 +- 3.254
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.083 0.766 0.148
p : 0.518 0.315 0.117 0.036 0.010 0.003 0.001 0.000 0.000 0.000
q : 0.000 0.032 0.062 0.080 0.096 0.112 0.129 0.146 0.163 0.181
ws: 0.003 0.036 0.103 0.154 0.168 0.154 0.130 0.105 0.082 0.064
Time used: 0:42
Model 1: NearlyNeutral -776.102101
Model 2: PositiveSelection -771.423592
Model 0: one-ratio -786.152998
Model 3: discrete -771.423592
Model 7: beta -776.207867
Model 8: beta&w>1 -771.425925
Model 0 vs 1 20.101794000000154
Model 2 vs 1 9.357017999999925
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.506 3.073
66 A 0.961* 5.722
68 P 0.990* 5.891
69 L 0.993** 5.907
73 V 0.999** 5.943
76 K 0.989* 5.883
77 Y 0.978* 5.821
78 A 0.985* 5.860
80 T 0.670 4.029
89 K 0.991** 5.895
90 A 0.970* 5.773
92 T 0.670 4.029
97 R 0.501 3.046
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.791 5.415 +- 3.049
68 P 0.873 5.892 +- 2.795
69 L 0.915 6.176 +- 2.651
73 V 0.941 6.345 +- 2.530
76 K 0.882 5.967 +- 2.772
77 Y 0.822 5.569 +- 2.947
78 A 0.880 5.979 +- 2.796
80 T 0.542 3.742 +- 3.303
89 K 0.896 6.053 +- 2.722
90 A 0.784 5.315 +- 3.023
92 T 0.542 3.742 +- 3.303
Model 8 vs 7 9.563883999999916
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
10 A 0.505 3.074
66 A 0.959* 5.713
68 P 0.989* 5.889
69 L 0.992** 5.906
73 V 0.999** 5.944
76 K 0.988* 5.881
77 Y 0.977* 5.816
78 A 0.984* 5.857
80 T 0.669 4.029
89 K 0.990** 5.894
90 A 0.968* 5.765
92 T 0.669 4.029
97 R 0.501 3.048
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_825-Oak-PB)
Pr(w>1) post mean +- SE for w
66 A 0.864 5.566 +- 2.800
68 P 0.933 5.974 +- 2.516
69 L 0.956* 6.131 +- 2.415
73 V 0.976* 6.257 +- 2.305
76 K 0.936 6.002 +- 2.509
77 Y 0.895 5.728 +- 2.675
78 A 0.930 5.985 +- 2.544
80 T 0.618 3.981 +- 3.254
89 K 0.945 6.059 +- 2.467
90 A 0.867 5.540 +- 2.764
92 T 0.618 3.981 +- 3.254
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
