--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 17:34:29 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/4EHP-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1190.31 -1201.62
2 -1189.97 -1204.03
--------------------------------------
TOTAL -1190.13 -1203.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.280929 0.003202 0.181063 0.394628 0.275292 1259.35 1270.70 1.000
r(A<->C){all} 0.071970 0.000945 0.021271 0.134133 0.068368 780.19 933.85 1.000
r(A<->G){all} 0.194199 0.002985 0.091518 0.302733 0.190111 610.47 613.23 1.000
r(A<->T){all} 0.050709 0.001588 0.000003 0.126243 0.042169 679.55 723.10 1.000
r(C<->G){all} 0.063712 0.000698 0.016475 0.116520 0.060413 964.50 985.30 1.000
r(C<->T){all} 0.471510 0.008747 0.282010 0.647502 0.469780 478.79 522.61 1.000
r(G<->T){all} 0.147900 0.003028 0.050256 0.256120 0.140921 547.31 618.92 1.000
pi(A){all} 0.252698 0.000315 0.219549 0.288960 0.252361 1013.58 1040.22 1.000
pi(C){all} 0.279210 0.000317 0.245774 0.313919 0.279351 1145.25 1269.69 1.000
pi(G){all} 0.317237 0.000347 0.280985 0.353037 0.316754 1163.96 1189.76 1.000
pi(T){all} 0.150855 0.000202 0.124092 0.179251 0.150352 1254.95 1342.43 1.000
alpha{1,2} 0.074764 0.004235 0.000101 0.191338 0.059423 1362.55 1390.03 1.000
alpha{3} 1.471551 0.480868 0.428196 2.840744 1.346490 1350.79 1425.90 1.000
pinvar{all} 0.453619 0.011691 0.252176 0.670771 0.467630 1192.62 1262.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1123.5819
Model 2: PositiveSelection -1123.238077
Model 0: one-ratio -1126.706968
Model 3: discrete -1123.238077
Model 7: beta -1124.353303
Model 8: beta&w>1 -1123.258724
Model 0 vs 1 6.250136000000111
Model 2 vs 1 0.6876459999998588
Model 8 vs 7 2.189158000000134
>C1
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT
>C2
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C3
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C4
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT
>C5
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT
>C6
MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=186
C1 MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
C2 MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
C3 MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
C4 MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH
C5 MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
C6 MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
*******.****:* ***:********:*:***::***************
C1 TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
C2 TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
C3 TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
C4 TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
C5 TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
C6 TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
********* *****:*******:**************************
C1 RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
C2 RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
C3 RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
C4 RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
C5 RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
C6 RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
*** ****** **************:*******::***************
C1 LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT
C2 LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
C3 LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
C4 LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT
C5 LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT
C6 LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
********:**********:: ********** ***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 186 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 186 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5580]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5580]--->[5580]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/4EHP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.321 Mb, Max= 30.580 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT
>C2
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C3
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C4
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT
>C5
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT
>C6
MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
FORMAT of file /tmp/tmp5777405898194894586aln Not Supported[FATAL:T-COFFEE]
>C1
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT
>C2
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C3
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C4
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT
>C5
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT
>C6
MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:186 S:100 BS:186
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 98.92 C1 C2 98.92
TOP 1 0 98.92 C2 C1 98.92
BOT 0 2 98.39 C1 C3 98.39
TOP 2 0 98.39 C3 C1 98.39
BOT 0 3 91.40 C1 C4 91.40
TOP 3 0 91.40 C4 C1 91.40
BOT 0 4 91.94 C1 C5 91.94
TOP 4 0 91.94 C5 C1 91.94
BOT 0 5 89.78 C1 C6 89.78
TOP 5 0 89.78 C6 C1 89.78
BOT 1 2 99.46 C2 C3 99.46
TOP 2 1 99.46 C3 C2 99.46
BOT 1 3 92.47 C2 C4 92.47
TOP 3 1 92.47 C4 C2 92.47
BOT 1 4 93.01 C2 C5 93.01
TOP 4 1 93.01 C5 C2 93.01
BOT 1 5 90.86 C2 C6 90.86
TOP 5 1 90.86 C6 C2 90.86
BOT 2 3 92.47 C3 C4 92.47
TOP 3 2 92.47 C4 C3 92.47
BOT 2 4 93.01 C3 C5 93.01
TOP 4 2 93.01 C5 C3 93.01
BOT 2 5 90.86 C3 C6 90.86
TOP 5 2 90.86 C6 C3 90.86
BOT 3 4 98.39 C4 C5 98.39
TOP 4 3 98.39 C5 C4 98.39
BOT 3 5 96.24 C4 C6 96.24
TOP 5 3 96.24 C6 C4 96.24
BOT 4 5 97.85 C5 C6 97.85
TOP 5 4 97.85 C6 C5 97.85
AVG 0 C1 * 94.09
AVG 1 C2 * 94.95
AVG 2 C3 * 94.84
AVG 3 C4 * 94.19
AVG 4 C5 * 94.84
AVG 5 C6 * 93.12
TOT TOT * 94.34
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC
C2 ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC
C3 ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC
C4 ATGAGCATGGAGAAAGTAGCCAACAAGCAGTATGAGTCGAAAAACTGGCC
C5 ATGAGCATGGAGAAAGTAGCCAACAAGCAGTATGAGTCGAAAAACTGGCC
C6 ATGAGCATGGAGAAAGTAGCGAGCAAGCAGTACGAGTCGAAAATCTGGCC
******************** *.********* ***:******:******
C1 AGATATTGTCGACAGCGACGACAGCGATGTGGATAATCAGATAGATGTGG
C2 AGATATCGTCGACAGCGACGACAGCGATGTGGATAACGAAATAGATGTGG
C3 AGATATCGTCGACAGCGACGACAGCGATGTGGATAACGAGATAGATGTGG
C4 AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAACGAGATAGACGTGG
C5 AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAATGAGATAGACGTGG
C6 AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAACGAGATAGATGTGG
****.* ************************** ** *.***** ****
C1 ACAACCTGCCACCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
C2 ACAACCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
C3 ACAACCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
C4 AGAAGCTCCCCCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
C5 ACAAGCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
C6 ATAAGCTGCCTCCGCTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
* ** ** ** **.************************************
C1 ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGCGCGGCCGCCGA
C2 ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGA
C3 ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGA
C4 ACATACTGCCTCTGGTTCTCTCGCAAGGGTACGCAACGGGCGGCCGCCGA
C5 ACATACTGCCTCTGGTTCTCTCGCAAGGGGACGCAGCGGGCGGCCGCCGA
C6 ACATACTGCCTCTGGTTCTCCCGCAAAGGGACGCAGCGGGCGGCCTCCGA
******************** *****.*. *****.** ****** ****
C1 CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
C2 CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
C3 CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
C4 CTACAGCAAATCGCTGCACGTGGTCGGACGGTGCGCCAGCGTGCAGCAGT
C5 CTACAGCAAATCGCTGCACGTGGTCGGCCGGTGCGCCAGCGTGCAGCAAT
C6 CTACAGCAAGTCGCTGCACGTGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
*********.*********.*******.********************.*
C1 GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTAC
C2 GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACAGCCCTGAAGCCCTAC
C3 GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACAGCCCTGAAGCCCTAC
C4 GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTAC
C5 GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACTGCCCTGAAGCCCTAC
C6 GGTGGTCGCTCTACTCGCATCTCATCCGGCCCACCGCCCTTAAGCCCTAC
******************* ************** ***** *********
C1 CGGGAGCTCCTCCTCTTCAAGCAGGGCATCATACCGATGTGGGAGGACCC
C2 CGGGAGCTCCTCCTCTTCAAGCAGGGTATCATACCGATGTGGGAGGACCC
C3 CGGGAGCTCCTCCTCTTCAAGCAGGGTATCGTGCCGATGTGGGAGGACCC
C4 CGGGAGCTCAGCCTCTTCAAGCAGGGCATCAAACCGATGTGGGAGGACCC
C5 CGGGAGCTCAGCCTCTTCAAGCAGGGCATCAAACCGATGTGGGAGGACCC
C6 CGGGAGCTCAGCCTGTTCAAGCAGGGCATCAAGCCGATGTGGGAGGACCC
*********. *** *********** ***.:.*****************
C1 GGCGAACAGCAAGGGCGGCCAGTGGTTGATACGACTACGCAAGAACAAGG
C2 GGCGAACAGCAAGGGCGGACAATGGTTGATACGGCTGCGCAAGAACAAGG
C3 GGCGAACAGCAAGGGCGGACAATGGTTGATACGGCTGCGCAAGAACAAGG
C4 GGCGAACAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAGA
C5 TGCGAACAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAGA
C6 GGCGAATAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAAA
***** ***********.**.*** *******.**.***********..
C1 TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
C2 TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
C3 TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
C4 TCGAGCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTT
C5 TCGAGCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
C6 TCGAGCGAGCCTGGGAGAACGTCTGCATGGCGATGCTCGGAGAGCAGTTT
**** **.************** ** **************.********
C1 CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT
C2 CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT
C3 CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT
C4 CTCGTCGGCGACGAGATATGCGGAATCGTGCTACAGACGAAATATCCGAT
C5 CTCGTCGGCGACGAGATATGCGGAATCGTGCTACAAACGAAATATCCGAT
C6 CTCGTCGGCGACGAGATATGCGGCATTGTGCTACAGACGAAATATCCGAT
***********************..* ********.**************
C1 AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGCGATG
C2 AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGCCCTG
C3 AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGTCCTG
C4 AAAAACCGAACACCGCCGGCCAATGCATACAAATGAGCGAAGGAGCCCGG
C5 AAAAACCAAACACAGTCGGCCAATGCATACAAATGAGCGAAGGAGCCCGG
C6 AAAAACCAAACGCAGTCGCCCAATGCATACAAATGAGCGGAGGAGCCCTG
*******.***.*.* ** ********************.***** . *
C1 GAGTCACG
C2 GAGTCACG
C3 GAGTCACG
C4 GAGTCACG
C5 GAGTCACG
C6 GAGTCACG
********
>C1
ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC
AGATATTGTCGACAGCGACGACAGCGATGTGGATAATCAGATAGATGTGG
ACAACCTGCCACCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGCGCGGCCGCCGA
CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTAC
CGGGAGCTCCTCCTCTTCAAGCAGGGCATCATACCGATGTGGGAGGACCC
GGCGAACAGCAAGGGCGGCCAGTGGTTGATACGACTACGCAAGAACAAGG
TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT
AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGCGATG
GAGTCACG
>C2
ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC
AGATATCGTCGACAGCGACGACAGCGATGTGGATAACGAAATAGATGTGG
ACAACCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGA
CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACAGCCCTGAAGCCCTAC
CGGGAGCTCCTCCTCTTCAAGCAGGGTATCATACCGATGTGGGAGGACCC
GGCGAACAGCAAGGGCGGACAATGGTTGATACGGCTGCGCAAGAACAAGG
TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT
AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGCCCTG
GAGTCACG
>C3
ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC
AGATATCGTCGACAGCGACGACAGCGATGTGGATAACGAGATAGATGTGG
ACAACCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGA
CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACAGCCCTGAAGCCCTAC
CGGGAGCTCCTCCTCTTCAAGCAGGGTATCGTGCCGATGTGGGAGGACCC
GGCGAACAGCAAGGGCGGACAATGGTTGATACGGCTGCGCAAGAACAAGG
TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT
AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGTCCTG
GAGTCACG
>C4
ATGAGCATGGAGAAAGTAGCCAACAAGCAGTATGAGTCGAAAAACTGGCC
AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAACGAGATAGACGTGG
AGAAGCTCCCCCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
ACATACTGCCTCTGGTTCTCTCGCAAGGGTACGCAACGGGCGGCCGCCGA
CTACAGCAAATCGCTGCACGTGGTCGGACGGTGCGCCAGCGTGCAGCAGT
GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTAC
CGGGAGCTCAGCCTCTTCAAGCAGGGCATCAAACCGATGTGGGAGGACCC
GGCGAACAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAGA
TCGAGCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTT
CTCGTCGGCGACGAGATATGCGGAATCGTGCTACAGACGAAATATCCGAT
AAAAACCGAACACCGCCGGCCAATGCATACAAATGAGCGAAGGAGCCCGG
GAGTCACG
>C5
ATGAGCATGGAGAAAGTAGCCAACAAGCAGTATGAGTCGAAAAACTGGCC
AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAATGAGATAGACGTGG
ACAAGCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
ACATACTGCCTCTGGTTCTCTCGCAAGGGGACGCAGCGGGCGGCCGCCGA
CTACAGCAAATCGCTGCACGTGGTCGGCCGGTGCGCCAGCGTGCAGCAAT
GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACTGCCCTGAAGCCCTAC
CGGGAGCTCAGCCTCTTCAAGCAGGGCATCAAACCGATGTGGGAGGACCC
TGCGAACAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAGA
TCGAGCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC
CTCGTCGGCGACGAGATATGCGGAATCGTGCTACAAACGAAATATCCGAT
AAAAACCAAACACAGTCGGCCAATGCATACAAATGAGCGAAGGAGCCCGG
GAGTCACG
>C6
ATGAGCATGGAGAAAGTAGCGAGCAAGCAGTACGAGTCGAAAATCTGGCC
AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAACGAGATAGATGTGG
ATAAGCTGCCTCCGCTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC
ACATACTGCCTCTGGTTCTCCCGCAAAGGGACGCAGCGGGCGGCCTCCGA
CTACAGCAAGTCGCTGCACGTGGTCGGCCGGTGCGCCAGCGTGCAGCAGT
GGTGGTCGCTCTACTCGCATCTCATCCGGCCCACCGCCCTTAAGCCCTAC
CGGGAGCTCAGCCTGTTCAAGCAGGGCATCAAGCCGATGTGGGAGGACCC
GGCGAATAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAAA
TCGAGCGAGCCTGGGAGAACGTCTGCATGGCGATGCTCGGAGAGCAGTTT
CTCGTCGGCGACGAGATATGCGGCATTGTGCTACAGACGAAATATCCGAT
AAAAACCAAACGCAGTCGCCCAATGCATACAAATGAGCGGAGGAGCCCTG
GAGTCACG
>C1
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT
>C2
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C3
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
>C4
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT
>C5
MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT
>C6
MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 558 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480094970
Setting output file names to "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1612934665
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7562238747
Seed = 1786106023
Swapseed = 1480094970
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 16 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 39 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1595.585093 -- -24.965149
Chain 2 -- -1519.379999 -- -24.965149
Chain 3 -- -1557.660136 -- -24.965149
Chain 4 -- -1544.267851 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1559.491174 -- -24.965149
Chain 2 -- -1513.905487 -- -24.965149
Chain 3 -- -1560.961800 -- -24.965149
Chain 4 -- -1595.546972 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1595.585] (-1519.380) (-1557.660) (-1544.268) * [-1559.491] (-1513.905) (-1560.962) (-1595.547)
500 -- (-1222.550) (-1213.898) (-1218.745) [-1222.154] * (-1203.366) (-1207.824) (-1211.650) [-1210.780] -- 0:00:00
1000 -- (-1207.953) [-1208.113] (-1213.229) (-1219.932) * [-1204.853] (-1222.720) (-1206.370) (-1206.463) -- 0:00:00
1500 -- [-1203.923] (-1214.424) (-1208.458) (-1208.479) * [-1200.520] (-1208.804) (-1200.157) (-1200.034) -- 0:00:00
2000 -- (-1205.047) (-1206.920) [-1206.155] (-1204.329) * [-1196.369] (-1206.883) (-1197.860) (-1201.688) -- 0:00:00
2500 -- (-1200.937) (-1206.470) [-1207.767] (-1203.224) * (-1200.779) (-1206.775) (-1198.155) [-1194.724] -- 0:00:00
3000 -- (-1202.848) (-1197.679) [-1202.786] (-1204.511) * (-1193.261) (-1209.701) (-1197.093) [-1189.683] -- 0:00:00
3500 -- (-1193.778) [-1197.652] (-1201.808) (-1203.584) * (-1190.872) (-1203.638) [-1196.954] (-1195.171) -- 0:00:00
4000 -- (-1196.072) (-1195.696) [-1195.790] (-1199.441) * (-1201.740) (-1196.986) (-1198.415) [-1191.230] -- 0:04:09
4500 -- (-1194.840) (-1196.616) [-1198.892] (-1195.199) * [-1190.656] (-1199.802) (-1195.244) (-1196.495) -- 0:03:41
5000 -- [-1192.713] (-1193.792) (-1199.153) (-1198.588) * (-1201.635) [-1198.895] (-1194.371) (-1195.279) -- 0:03:19
Average standard deviation of split frequencies: 0.039284
5500 -- (-1191.160) (-1189.486) [-1196.585] (-1197.466) * (-1195.040) (-1204.052) [-1191.775] (-1190.567) -- 0:03:00
6000 -- (-1195.008) (-1188.150) [-1193.308] (-1196.346) * (-1204.162) (-1203.072) [-1196.158] (-1191.944) -- 0:02:45
6500 -- [-1198.298] (-1194.529) (-1197.752) (-1193.569) * [-1192.637] (-1201.705) (-1192.173) (-1192.994) -- 0:02:32
7000 -- (-1198.088) (-1195.259) (-1201.866) [-1193.527] * (-1200.411) (-1201.806) (-1190.800) [-1198.422] -- 0:02:21
7500 -- [-1195.498] (-1204.057) (-1194.301) (-1198.399) * (-1190.083) (-1194.753) [-1190.969] (-1189.295) -- 0:02:12
8000 -- (-1206.222) (-1197.525) [-1195.036] (-1194.388) * (-1191.141) [-1194.981] (-1192.695) (-1194.717) -- 0:02:04
8500 -- (-1203.360) [-1189.720] (-1201.772) (-1193.794) * (-1198.718) (-1195.737) (-1195.733) [-1195.031] -- 0:01:56
9000 -- (-1194.201) (-1197.909) [-1198.446] (-1200.706) * [-1196.372] (-1189.081) (-1195.458) (-1193.755) -- 0:01:50
9500 -- [-1193.871] (-1190.139) (-1195.222) (-1195.586) * (-1204.194) (-1191.690) (-1193.149) [-1192.403] -- 0:03:28
10000 -- (-1194.918) (-1190.091) [-1194.675] (-1208.507) * (-1197.309) [-1191.738] (-1194.186) (-1195.001) -- 0:03:18
Average standard deviation of split frequencies: 0.026517
10500 -- (-1190.332) (-1192.375) [-1204.377] (-1201.286) * [-1193.036] (-1190.470) (-1192.569) (-1194.196) -- 0:03:08
11000 -- (-1194.648) [-1193.078] (-1196.214) (-1199.479) * (-1194.524) [-1188.182] (-1200.921) (-1193.590) -- 0:02:59
11500 -- [-1196.835] (-1198.148) (-1198.942) (-1193.253) * (-1195.999) [-1195.942] (-1199.892) (-1193.652) -- 0:02:51
12000 -- (-1200.180) (-1188.343) (-1198.555) [-1189.447] * (-1201.868) [-1195.639] (-1191.581) (-1189.213) -- 0:02:44
12500 -- (-1197.102) (-1193.097) [-1199.707] (-1197.557) * [-1194.856] (-1193.593) (-1189.859) (-1198.181) -- 0:02:38
13000 -- (-1194.422) (-1195.002) (-1192.948) [-1193.251] * (-1192.886) [-1191.338] (-1192.767) (-1202.861) -- 0:02:31
13500 -- (-1190.862) (-1196.715) [-1187.680] (-1193.026) * (-1194.137) (-1192.729) (-1191.740) [-1196.893] -- 0:02:26
14000 -- (-1193.396) (-1195.125) (-1193.363) [-1189.979] * (-1192.150) (-1190.829) [-1190.079] (-1193.616) -- 0:02:20
14500 -- (-1192.849) (-1196.145) [-1195.479] (-1193.680) * (-1197.372) (-1193.265) [-1189.494] (-1202.949) -- 0:02:15
15000 -- [-1190.131] (-1197.817) (-1198.756) (-1191.922) * [-1197.759] (-1204.173) (-1197.939) (-1189.655) -- 0:03:17
Average standard deviation of split frequencies: 0.053033
15500 -- (-1189.390) [-1199.116] (-1196.997) (-1199.571) * (-1201.223) (-1199.640) (-1193.321) [-1192.751] -- 0:03:10
16000 -- [-1193.116] (-1193.186) (-1195.113) (-1197.936) * (-1190.982) (-1187.864) (-1197.686) [-1191.860] -- 0:03:04
16500 -- [-1192.960] (-1195.357) (-1201.737) (-1192.555) * (-1193.008) (-1188.844) (-1192.542) [-1194.540] -- 0:02:58
17000 -- [-1191.169] (-1195.244) (-1204.305) (-1194.398) * (-1199.974) [-1191.071] (-1195.663) (-1198.051) -- 0:02:53
17500 -- (-1195.325) (-1199.545) (-1200.823) [-1190.834] * [-1194.332] (-1198.784) (-1194.578) (-1193.852) -- 0:02:48
18000 -- (-1198.795) (-1194.539) (-1198.027) [-1201.393] * (-1198.386) [-1195.749] (-1197.467) (-1194.722) -- 0:02:43
18500 -- (-1196.562) (-1199.108) [-1199.687] (-1199.658) * (-1204.051) [-1188.694] (-1204.709) (-1193.632) -- 0:02:39
19000 -- (-1195.888) (-1196.833) [-1203.864] (-1193.278) * (-1200.799) [-1190.244] (-1189.868) (-1194.743) -- 0:02:34
19500 -- [-1191.704] (-1195.660) (-1196.991) (-1191.684) * [-1194.968] (-1191.963) (-1190.947) (-1193.636) -- 0:02:30
20000 -- (-1199.210) (-1187.762) (-1201.375) [-1189.126] * (-1199.319) [-1188.575] (-1198.137) (-1190.250) -- 0:02:27
Average standard deviation of split frequencies: 0.022810
20500 -- (-1193.618) (-1192.735) [-1201.094] (-1191.634) * (-1199.719) [-1189.818] (-1193.392) (-1193.954) -- 0:03:11
21000 -- (-1199.643) (-1200.558) [-1194.528] (-1191.125) * (-1196.504) [-1188.645] (-1192.467) (-1197.824) -- 0:03:06
21500 -- (-1199.231) (-1199.683) [-1191.140] (-1194.026) * (-1191.719) (-1189.125) (-1192.413) [-1193.431] -- 0:03:02
22000 -- [-1198.395] (-1197.092) (-1200.798) (-1196.789) * (-1195.859) (-1196.112) (-1193.116) [-1197.216] -- 0:02:57
22500 -- (-1191.367) (-1192.678) [-1191.515] (-1191.167) * (-1191.629) (-1192.600) (-1191.207) [-1193.982] -- 0:02:53
23000 -- [-1191.198] (-1194.841) (-1191.978) (-1193.721) * (-1197.793) [-1192.847] (-1197.068) (-1197.552) -- 0:02:49
23500 -- (-1195.228) (-1192.668) [-1196.801] (-1196.585) * (-1198.607) (-1192.781) (-1195.256) [-1189.290] -- 0:02:46
24000 -- [-1189.696] (-1193.561) (-1191.380) (-1189.879) * (-1201.493) (-1201.425) [-1198.867] (-1194.248) -- 0:02:42
24500 -- [-1191.059] (-1200.790) (-1192.105) (-1198.905) * [-1196.249] (-1194.582) (-1200.342) (-1191.977) -- 0:02:39
25000 -- [-1194.122] (-1197.727) (-1194.137) (-1193.693) * (-1202.076) (-1198.396) [-1191.606] (-1194.933) -- 0:02:36
Average standard deviation of split frequencies: 0.025383
25500 -- (-1191.925) (-1203.301) [-1197.674] (-1195.742) * (-1197.612) [-1189.610] (-1194.410) (-1191.450) -- 0:02:32
26000 -- (-1191.955) [-1193.970] (-1194.784) (-1194.270) * (-1198.401) [-1192.383] (-1195.730) (-1191.373) -- 0:02:29
26500 -- [-1192.832] (-1197.808) (-1200.107) (-1192.311) * (-1192.937) [-1192.254] (-1193.940) (-1200.162) -- 0:03:03
27000 -- (-1196.746) [-1188.684] (-1199.698) (-1193.592) * [-1195.817] (-1198.549) (-1192.692) (-1195.373) -- 0:03:00
27500 -- (-1190.691) (-1195.471) [-1195.337] (-1193.322) * (-1193.922) [-1190.443] (-1190.635) (-1190.315) -- 0:02:56
28000 -- (-1193.633) [-1194.134] (-1197.235) (-1193.838) * (-1195.201) (-1194.141) [-1197.277] (-1190.942) -- 0:02:53
28500 -- [-1191.475] (-1193.957) (-1197.843) (-1194.379) * [-1201.089] (-1189.718) (-1189.108) (-1194.023) -- 0:02:50
29000 -- (-1190.596) [-1193.718] (-1202.179) (-1190.597) * [-1192.751] (-1198.052) (-1193.725) (-1193.141) -- 0:02:47
29500 -- (-1199.914) [-1196.942] (-1193.396) (-1193.309) * (-1189.434) [-1188.021] (-1190.368) (-1199.659) -- 0:02:44
30000 -- (-1198.983) (-1190.940) (-1196.584) [-1196.343] * (-1192.310) (-1193.674) [-1190.957] (-1197.865) -- 0:02:41
Average standard deviation of split frequencies: 0.027669
30500 -- [-1196.471] (-1193.764) (-1192.270) (-1192.107) * [-1196.222] (-1199.892) (-1204.753) (-1191.681) -- 0:02:38
31000 -- (-1194.871) [-1192.663] (-1199.901) (-1200.201) * (-1192.762) (-1188.237) (-1202.062) [-1191.679] -- 0:02:36
31500 -- [-1198.127] (-1200.393) (-1195.431) (-1190.733) * (-1193.860) [-1196.776] (-1198.709) (-1193.204) -- 0:02:33
32000 -- (-1196.239) (-1205.310) (-1194.563) [-1194.666] * [-1192.718] (-1194.667) (-1196.820) (-1197.742) -- 0:03:01
32500 -- (-1193.325) [-1194.250] (-1192.659) (-1192.577) * [-1191.784] (-1195.828) (-1201.039) (-1192.402) -- 0:02:58
33000 -- (-1193.367) [-1201.266] (-1200.068) (-1197.365) * (-1186.167) [-1192.820] (-1198.971) (-1191.460) -- 0:02:55
33500 -- (-1200.119) (-1199.921) [-1198.211] (-1193.128) * (-1191.452) (-1188.607) [-1198.051] (-1202.706) -- 0:02:53
34000 -- [-1192.857] (-1194.885) (-1197.106) (-1196.826) * (-1198.244) (-1201.759) (-1198.272) [-1196.471] -- 0:02:50
34500 -- (-1195.874) (-1196.919) (-1193.844) [-1195.788] * (-1195.271) (-1191.120) (-1193.052) [-1192.155] -- 0:02:47
35000 -- (-1193.426) (-1194.563) [-1197.369] (-1200.495) * (-1193.692) [-1192.133] (-1196.463) (-1193.626) -- 0:02:45
Average standard deviation of split frequencies: 0.028808
35500 -- (-1194.477) (-1191.901) [-1194.207] (-1198.781) * (-1193.256) [-1191.019] (-1193.225) (-1192.291) -- 0:02:43
36000 -- (-1200.043) (-1190.914) (-1205.338) [-1198.851] * (-1193.291) (-1192.854) (-1204.175) [-1195.301] -- 0:02:40
36500 -- (-1194.695) (-1204.838) [-1200.286] (-1193.159) * (-1192.742) (-1200.973) (-1205.021) [-1192.564] -- 0:02:38
37000 -- (-1194.093) (-1197.437) [-1192.229] (-1199.504) * (-1187.964) (-1195.275) (-1197.712) [-1195.243] -- 0:02:36
37500 -- (-1205.707) (-1194.037) (-1194.364) [-1191.238] * [-1193.217] (-1196.097) (-1196.708) (-1193.428) -- 0:02:59
38000 -- (-1192.105) [-1193.024] (-1204.275) (-1201.446) * (-1194.085) (-1202.685) [-1200.657] (-1195.304) -- 0:02:57
38500 -- [-1192.093] (-1206.420) (-1195.446) (-1194.559) * (-1194.451) [-1194.521] (-1199.099) (-1196.804) -- 0:02:54
39000 -- (-1192.559) [-1194.606] (-1201.332) (-1192.504) * [-1193.347] (-1198.141) (-1199.919) (-1193.124) -- 0:02:52
39500 -- (-1189.159) (-1191.161) [-1195.233] (-1192.938) * [-1195.272] (-1195.337) (-1198.405) (-1198.232) -- 0:02:50
40000 -- (-1191.560) (-1195.820) (-1199.853) [-1191.851] * (-1195.001) (-1198.742) (-1196.175) [-1194.349] -- 0:02:48
Average standard deviation of split frequencies: 0.023184
40500 -- (-1191.043) (-1192.893) [-1203.013] (-1201.646) * (-1193.015) [-1198.476] (-1197.451) (-1194.923) -- 0:02:45
41000 -- [-1193.278] (-1197.787) (-1196.080) (-1192.818) * (-1204.330) (-1203.818) (-1209.486) [-1187.727] -- 0:02:43
41500 -- [-1192.033] (-1195.051) (-1202.576) (-1191.934) * [-1192.920] (-1209.582) (-1204.444) (-1192.809) -- 0:02:41
42000 -- (-1205.381) (-1197.299) [-1198.032] (-1196.675) * (-1192.266) (-1197.184) (-1198.074) [-1189.457] -- 0:02:39
42500 -- (-1196.058) (-1199.366) (-1197.608) [-1195.944] * (-1195.503) [-1197.484] (-1203.455) (-1194.483) -- 0:02:37
43000 -- (-1190.191) (-1201.794) (-1193.946) [-1193.367] * [-1197.163] (-1192.376) (-1195.499) (-1193.559) -- 0:02:58
43500 -- (-1193.585) (-1195.645) (-1192.344) [-1194.173] * (-1197.052) (-1196.584) (-1195.947) [-1192.390] -- 0:02:55
44000 -- [-1193.458] (-1197.879) (-1198.147) (-1198.555) * (-1189.719) (-1199.501) (-1194.818) [-1195.528] -- 0:02:53
44500 -- [-1197.183] (-1195.664) (-1192.805) (-1199.612) * (-1192.692) [-1198.813] (-1203.540) (-1200.034) -- 0:02:51
45000 -- (-1194.758) (-1195.770) (-1195.332) [-1191.591] * (-1199.920) (-1194.322) (-1200.411) [-1198.684] -- 0:02:49
Average standard deviation of split frequencies: 0.018446
45500 -- (-1198.246) (-1193.460) (-1194.075) [-1191.805] * [-1191.032] (-1193.884) (-1195.259) (-1198.249) -- 0:02:47
46000 -- (-1196.955) [-1192.496] (-1191.214) (-1193.744) * (-1190.838) (-1194.809) (-1200.444) [-1190.517] -- 0:02:45
46500 -- (-1196.792) (-1203.143) (-1195.074) [-1197.896] * (-1197.446) (-1188.597) (-1195.981) [-1195.216] -- 0:02:44
47000 -- [-1193.161] (-1201.119) (-1189.605) (-1194.760) * (-1187.714) (-1194.247) (-1198.371) [-1190.724] -- 0:02:42
47500 -- (-1193.667) [-1197.130] (-1199.237) (-1195.438) * (-1192.155) (-1193.639) (-1190.880) [-1187.763] -- 0:02:40
48000 -- (-1195.236) [-1192.279] (-1204.209) (-1190.125) * (-1197.949) (-1189.841) [-1191.491] (-1191.386) -- 0:02:38
48500 -- (-1192.179) (-1189.757) (-1195.057) [-1193.563] * (-1193.459) [-1188.590] (-1194.968) (-1191.973) -- 0:02:56
49000 -- (-1193.909) [-1193.231] (-1197.357) (-1188.662) * [-1190.036] (-1192.907) (-1195.342) (-1195.976) -- 0:02:54
49500 -- (-1195.145) (-1193.720) (-1200.705) [-1193.479] * [-1189.895] (-1190.433) (-1195.627) (-1189.175) -- 0:02:52
50000 -- (-1194.573) (-1190.841) [-1194.651] (-1192.994) * (-1193.976) [-1195.546] (-1189.433) (-1200.899) -- 0:02:51
Average standard deviation of split frequencies: 0.013026
50500 -- (-1190.742) (-1189.690) [-1191.513] (-1206.413) * (-1197.133) [-1191.670] (-1195.462) (-1190.394) -- 0:02:49
51000 -- (-1196.165) (-1197.632) [-1191.474] (-1200.008) * (-1202.472) [-1189.704] (-1192.480) (-1191.361) -- 0:02:47
51500 -- (-1192.561) (-1198.875) [-1190.310] (-1195.826) * (-1196.344) (-1190.522) (-1196.108) [-1194.382] -- 0:02:45
52000 -- (-1190.378) (-1195.102) (-1196.716) [-1195.017] * (-1194.445) (-1192.545) (-1191.907) [-1198.228] -- 0:02:44
52500 -- (-1191.436) (-1192.272) (-1195.815) [-1193.611] * [-1194.647] (-1193.251) (-1195.732) (-1194.229) -- 0:02:42
53000 -- (-1196.725) [-1189.276] (-1194.700) (-1197.134) * (-1193.851) (-1195.536) [-1192.689] (-1189.222) -- 0:02:40
53500 -- (-1194.101) (-1197.141) [-1192.228] (-1190.614) * (-1205.188) (-1197.874) (-1192.752) [-1194.320] -- 0:02:39
54000 -- (-1195.589) (-1194.905) (-1192.404) [-1192.545] * (-1202.562) (-1197.764) [-1189.353] (-1193.883) -- 0:02:55
54500 -- [-1195.659] (-1195.012) (-1201.503) (-1194.016) * [-1194.756] (-1199.399) (-1191.761) (-1190.713) -- 0:02:53
55000 -- (-1199.243) [-1191.112] (-1194.859) (-1196.776) * [-1192.321] (-1196.065) (-1204.326) (-1193.571) -- 0:02:51
Average standard deviation of split frequencies: 0.018519
55500 -- (-1201.994) [-1192.392] (-1198.110) (-1202.183) * (-1191.179) (-1197.601) (-1192.176) [-1190.544] -- 0:02:50
56000 -- (-1198.595) [-1194.251] (-1198.412) (-1195.883) * (-1190.306) (-1191.847) [-1194.684] (-1189.070) -- 0:02:48
56500 -- (-1200.841) (-1192.566) (-1198.305) [-1193.384] * (-1197.394) (-1192.902) (-1194.678) [-1193.477] -- 0:02:46
57000 -- (-1196.203) [-1197.684] (-1193.594) (-1199.067) * [-1196.936] (-1196.174) (-1194.452) (-1190.733) -- 0:02:45
57500 -- (-1195.528) (-1190.608) (-1196.757) [-1200.238] * (-1196.782) (-1195.617) (-1190.738) [-1193.999] -- 0:02:43
58000 -- (-1197.129) [-1193.229] (-1199.793) (-1193.393) * (-1196.924) (-1193.104) [-1192.398] (-1193.567) -- 0:02:42
58500 -- (-1193.904) (-1193.993) (-1194.686) [-1192.867] * (-1189.598) (-1193.424) [-1189.330] (-1196.012) -- 0:02:40
59000 -- (-1189.822) (-1195.113) [-1192.442] (-1190.503) * (-1192.194) [-1193.330] (-1192.090) (-1197.673) -- 0:02:39
59500 -- (-1190.951) (-1200.564) (-1194.066) [-1191.954] * (-1198.324) (-1195.568) [-1192.450] (-1198.550) -- 0:02:38
60000 -- (-1196.372) (-1196.098) [-1189.344] (-1191.498) * (-1195.248) (-1196.844) (-1197.548) [-1193.538] -- 0:02:52
Average standard deviation of split frequencies: 0.021757
60500 -- (-1189.417) (-1201.276) [-1190.996] (-1193.477) * (-1194.236) [-1195.754] (-1199.407) (-1195.958) -- 0:02:50
61000 -- (-1192.990) (-1198.382) [-1187.720] (-1195.182) * (-1201.046) [-1190.753] (-1200.781) (-1193.875) -- 0:02:49
61500 -- [-1191.526] (-1196.219) (-1193.050) (-1195.761) * (-1195.048) [-1196.788] (-1201.090) (-1192.897) -- 0:02:47
62000 -- (-1194.828) (-1200.276) (-1187.239) [-1198.480] * (-1192.932) (-1197.245) [-1190.914] (-1187.811) -- 0:02:46
62500 -- (-1194.925) (-1203.291) [-1193.987] (-1193.558) * [-1195.809] (-1196.502) (-1191.979) (-1195.469) -- 0:02:45
63000 -- (-1203.517) (-1194.110) (-1198.533) [-1197.123] * (-1200.910) (-1195.232) [-1189.529] (-1196.033) -- 0:02:43
63500 -- (-1198.218) (-1194.460) [-1190.747] (-1202.299) * (-1193.033) [-1191.406] (-1199.350) (-1195.312) -- 0:02:42
64000 -- [-1189.949] (-1197.713) (-1191.747) (-1198.375) * [-1192.088] (-1192.118) (-1200.834) (-1199.366) -- 0:02:40
64500 -- (-1193.023) (-1192.558) [-1197.519] (-1192.877) * (-1189.968) (-1194.237) (-1202.192) [-1196.351] -- 0:02:39
65000 -- [-1190.014] (-1194.088) (-1199.283) (-1197.662) * (-1199.744) [-1189.951] (-1192.435) (-1195.199) -- 0:02:38
Average standard deviation of split frequencies: 0.017142
65500 -- (-1192.974) [-1193.156] (-1191.875) (-1196.672) * (-1199.428) (-1193.028) [-1194.920] (-1197.007) -- 0:02:51
66000 -- (-1196.322) (-1201.564) [-1192.782] (-1198.752) * (-1192.975) (-1190.111) (-1189.992) [-1196.031] -- 0:02:49
66500 -- (-1189.625) [-1194.527] (-1196.605) (-1196.924) * [-1189.348] (-1193.051) (-1191.322) (-1193.904) -- 0:02:48
67000 -- (-1192.246) (-1194.374) [-1194.177] (-1192.471) * (-1197.646) (-1195.761) [-1190.115] (-1197.147) -- 0:02:47
67500 -- (-1190.493) [-1194.576] (-1199.321) (-1204.783) * (-1194.542) (-1192.540) [-1194.149] (-1193.295) -- 0:02:45
68000 -- [-1192.821] (-1199.603) (-1194.593) (-1201.575) * (-1193.885) (-1196.854) [-1195.592] (-1195.901) -- 0:02:44
68500 -- (-1187.148) (-1196.725) [-1197.173] (-1203.516) * [-1198.711] (-1194.047) (-1190.814) (-1193.583) -- 0:02:43
69000 -- [-1190.319] (-1197.267) (-1192.761) (-1202.251) * (-1193.643) (-1196.327) (-1203.138) [-1190.162] -- 0:02:41
69500 -- [-1190.014] (-1198.332) (-1197.379) (-1195.918) * [-1195.407] (-1198.512) (-1197.868) (-1195.655) -- 0:02:40
70000 -- [-1193.817] (-1192.171) (-1196.166) (-1192.807) * (-1195.865) (-1190.856) [-1199.680] (-1191.303) -- 0:02:39
Average standard deviation of split frequencies: 0.016010
70500 -- (-1198.000) (-1199.427) (-1195.605) [-1189.169] * (-1192.101) (-1193.429) (-1195.272) [-1192.881] -- 0:02:38
71000 -- (-1195.805) (-1203.197) [-1192.401] (-1187.920) * (-1193.648) [-1191.071] (-1191.432) (-1201.972) -- 0:02:50
71500 -- (-1202.046) (-1189.740) (-1190.975) [-1188.896] * (-1194.596) [-1190.724] (-1192.209) (-1202.336) -- 0:02:48
72000 -- (-1197.383) [-1195.057] (-1195.713) (-1192.443) * (-1193.956) (-1194.900) (-1196.116) [-1198.423] -- 0:02:47
72500 -- (-1200.373) (-1195.276) [-1193.422] (-1190.115) * (-1200.028) (-1192.556) (-1202.624) [-1193.574] -- 0:02:46
73000 -- (-1203.234) (-1196.643) [-1194.568] (-1196.451) * (-1203.512) [-1197.283] (-1196.518) (-1201.714) -- 0:02:45
73500 -- (-1203.659) [-1193.193] (-1189.282) (-1193.103) * (-1195.886) (-1194.141) (-1201.035) [-1194.652] -- 0:02:43
74000 -- (-1197.306) [-1191.602] (-1189.491) (-1191.497) * (-1195.342) [-1191.906] (-1201.195) (-1193.588) -- 0:02:42
74500 -- (-1198.443) (-1193.216) [-1199.939] (-1190.403) * (-1191.970) (-1190.576) (-1204.477) [-1192.817] -- 0:02:41
75000 -- (-1203.671) (-1195.805) (-1196.149) [-1190.266] * (-1197.317) [-1187.044] (-1194.746) (-1195.033) -- 0:02:40
Average standard deviation of split frequencies: 0.019849
75500 -- (-1198.979) (-1196.140) (-1193.004) [-1193.626] * (-1196.203) [-1195.408] (-1194.069) (-1196.361) -- 0:02:39
76000 -- [-1198.125] (-1198.327) (-1190.461) (-1195.822) * (-1213.290) [-1199.059] (-1199.082) (-1204.575) -- 0:02:38
76500 -- (-1196.178) [-1200.068] (-1190.700) (-1194.409) * (-1200.073) (-1193.698) [-1194.060] (-1194.072) -- 0:02:36
77000 -- (-1191.003) [-1193.284] (-1191.969) (-1199.804) * (-1205.100) (-1191.446) [-1198.835] (-1196.636) -- 0:02:47
77500 -- [-1190.809] (-1198.585) (-1197.009) (-1196.224) * (-1197.617) [-1191.379] (-1199.382) (-1194.449) -- 0:02:46
78000 -- [-1191.882] (-1202.940) (-1194.834) (-1192.570) * [-1192.087] (-1191.118) (-1194.842) (-1195.272) -- 0:02:45
78500 -- (-1190.634) (-1199.376) [-1193.567] (-1196.883) * [-1187.064] (-1196.118) (-1199.485) (-1188.837) -- 0:02:44
79000 -- (-1194.281) [-1194.333] (-1187.148) (-1202.380) * (-1194.000) (-1191.895) (-1195.657) [-1192.259] -- 0:02:43
79500 -- (-1194.435) (-1198.320) [-1192.138] (-1196.300) * (-1189.123) (-1196.489) [-1193.308] (-1192.230) -- 0:02:42
80000 -- (-1196.971) [-1195.518] (-1200.720) (-1197.366) * (-1197.293) [-1192.186] (-1198.815) (-1195.046) -- 0:02:41
Average standard deviation of split frequencies: 0.021038
80500 -- [-1201.064] (-1191.547) (-1198.268) (-1209.816) * (-1192.423) (-1198.955) [-1190.992] (-1193.113) -- 0:02:39
81000 -- (-1195.109) (-1190.982) [-1196.130] (-1199.866) * (-1199.496) (-1192.876) [-1200.072] (-1201.998) -- 0:02:38
81500 -- (-1198.690) [-1193.780] (-1198.448) (-1200.184) * [-1191.391] (-1207.299) (-1202.690) (-1189.277) -- 0:02:37
82000 -- (-1196.273) (-1195.003) (-1197.253) [-1187.866] * (-1202.219) (-1198.215) (-1196.667) [-1191.666] -- 0:02:36
82500 -- (-1194.646) (-1193.757) [-1195.596] (-1193.576) * (-1201.253) [-1186.232] (-1189.843) (-1195.345) -- 0:02:46
83000 -- [-1198.766] (-1191.554) (-1190.479) (-1205.695) * [-1192.212] (-1195.582) (-1191.959) (-1193.813) -- 0:02:45
83500 -- [-1193.091] (-1194.108) (-1193.909) (-1194.187) * (-1200.818) [-1195.082] (-1191.160) (-1199.978) -- 0:02:44
84000 -- [-1193.165] (-1191.334) (-1190.521) (-1198.185) * (-1192.022) (-1207.993) [-1193.312] (-1198.474) -- 0:02:43
84500 -- [-1195.963] (-1191.666) (-1194.997) (-1197.106) * (-1194.722) (-1202.197) [-1190.193] (-1197.534) -- 0:02:42
85000 -- [-1195.177] (-1192.713) (-1194.534) (-1197.141) * (-1199.915) (-1198.840) (-1196.666) [-1192.813] -- 0:02:41
Average standard deviation of split frequencies: 0.021926
85500 -- (-1194.918) [-1189.322] (-1201.535) (-1192.674) * (-1199.233) (-1202.127) [-1196.251] (-1190.290) -- 0:02:40
86000 -- [-1189.963] (-1189.415) (-1200.640) (-1191.860) * (-1196.046) (-1199.824) (-1201.075) [-1191.267] -- 0:02:39
86500 -- (-1193.433) [-1191.562] (-1195.877) (-1201.006) * (-1194.865) [-1190.834] (-1197.300) (-1191.535) -- 0:02:38
87000 -- (-1197.874) (-1193.293) (-1193.266) [-1189.738] * (-1194.588) (-1193.319) [-1189.248] (-1191.789) -- 0:02:37
87500 -- (-1194.766) (-1191.863) (-1194.455) [-1192.979] * (-1193.730) (-1195.996) [-1200.042] (-1195.304) -- 0:02:36
88000 -- [-1191.428] (-1197.526) (-1198.844) (-1194.388) * (-1193.647) [-1193.679] (-1197.618) (-1197.798) -- 0:02:45
88500 -- [-1192.726] (-1192.648) (-1194.462) (-1192.754) * (-1191.984) [-1191.599] (-1193.827) (-1195.076) -- 0:02:44
89000 -- (-1199.665) (-1195.624) [-1198.283] (-1193.514) * [-1197.030] (-1197.780) (-1192.258) (-1194.941) -- 0:02:43
89500 -- (-1203.845) [-1191.121] (-1193.935) (-1196.923) * [-1196.257] (-1195.996) (-1198.885) (-1193.517) -- 0:02:42
90000 -- (-1204.510) (-1192.234) (-1195.474) [-1194.246] * (-1193.125) (-1197.602) (-1196.784) [-1195.204] -- 0:02:41
Average standard deviation of split frequencies: 0.020797
90500 -- [-1196.292] (-1195.036) (-1201.178) (-1193.359) * [-1189.675] (-1195.845) (-1198.267) (-1194.934) -- 0:02:40
91000 -- (-1193.087) (-1197.480) (-1197.119) [-1193.947] * (-1191.909) [-1194.538] (-1192.858) (-1193.617) -- 0:02:39
91500 -- (-1196.383) (-1198.588) (-1189.779) [-1191.860] * (-1193.645) [-1201.722] (-1193.336) (-1194.993) -- 0:02:38
92000 -- [-1193.899] (-1190.668) (-1194.340) (-1198.331) * [-1200.157] (-1190.647) (-1193.449) (-1192.795) -- 0:02:37
92500 -- (-1194.922) (-1197.389) [-1191.722] (-1196.825) * [-1193.332] (-1191.961) (-1198.405) (-1200.211) -- 0:02:36
93000 -- (-1194.775) (-1194.673) (-1193.381) [-1196.532] * (-1191.338) (-1201.378) (-1199.147) [-1193.519] -- 0:02:36
93500 -- (-1193.993) (-1192.963) [-1198.470] (-1191.071) * [-1192.317] (-1201.238) (-1199.885) (-1209.776) -- 0:02:44
94000 -- [-1194.907] (-1194.774) (-1199.007) (-1194.550) * [-1193.683] (-1202.156) (-1195.358) (-1195.983) -- 0:02:43
94500 -- (-1193.351) (-1200.130) [-1187.969] (-1191.425) * (-1194.337) (-1194.752) (-1196.542) [-1193.802] -- 0:02:42
95000 -- [-1193.922] (-1208.752) (-1192.762) (-1192.547) * (-1195.267) [-1189.646] (-1196.553) (-1197.167) -- 0:02:41
Average standard deviation of split frequencies: 0.024552
95500 -- [-1195.475] (-1195.555) (-1192.204) (-1192.917) * (-1191.804) [-1191.484] (-1204.419) (-1191.728) -- 0:02:41
96000 -- (-1194.311) [-1195.838] (-1201.307) (-1193.669) * (-1192.981) (-1195.409) [-1194.929] (-1196.852) -- 0:02:40
96500 -- (-1195.102) (-1195.633) [-1202.869] (-1189.167) * (-1195.140) (-1196.923) (-1187.711) [-1190.577] -- 0:02:39
97000 -- (-1197.036) (-1196.753) (-1201.609) [-1191.667] * (-1193.256) (-1195.998) (-1191.451) [-1191.569] -- 0:02:38
97500 -- [-1193.223] (-1196.425) (-1193.780) (-1193.436) * [-1195.393] (-1195.946) (-1199.528) (-1198.959) -- 0:02:37
98000 -- (-1191.962) (-1198.098) [-1192.966] (-1190.773) * (-1200.451) (-1201.870) (-1191.470) [-1188.765] -- 0:02:36
98500 -- [-1191.775] (-1195.177) (-1194.478) (-1198.466) * [-1191.068] (-1195.747) (-1192.902) (-1191.747) -- 0:02:35
99000 -- (-1196.502) (-1197.331) (-1194.524) [-1192.467] * [-1191.433] (-1193.817) (-1191.552) (-1202.671) -- 0:02:34
99500 -- (-1194.664) [-1196.010] (-1197.508) (-1187.441) * [-1188.077] (-1196.187) (-1196.499) (-1192.877) -- 0:02:42
100000 -- (-1194.070) (-1196.091) (-1195.790) [-1194.978] * (-1193.421) (-1197.058) [-1196.435] (-1189.990) -- 0:02:42
Average standard deviation of split frequencies: 0.023414
100500 -- (-1197.045) (-1195.272) [-1196.390] (-1189.752) * (-1194.548) (-1196.095) (-1191.569) [-1187.334] -- 0:02:41
101000 -- (-1195.666) [-1198.159] (-1201.137) (-1201.989) * (-1191.811) (-1212.354) [-1187.939] (-1190.617) -- 0:02:40
101500 -- (-1201.170) [-1195.453] (-1191.337) (-1202.278) * [-1197.451] (-1201.840) (-1197.711) (-1192.652) -- 0:02:39
102000 -- (-1194.312) (-1196.964) [-1190.610] (-1196.935) * (-1194.679) (-1196.270) (-1190.002) [-1194.643] -- 0:02:38
102500 -- (-1193.918) (-1196.398) (-1202.522) [-1196.757] * (-1198.100) (-1195.268) [-1191.751] (-1200.608) -- 0:02:37
103000 -- (-1199.732) [-1191.206] (-1195.993) (-1200.270) * (-1193.660) (-1196.052) (-1195.047) [-1193.280] -- 0:02:36
103500 -- (-1193.075) (-1198.122) [-1189.824] (-1194.872) * (-1196.999) (-1192.590) (-1201.573) [-1193.503] -- 0:02:35
104000 -- (-1198.242) (-1197.579) [-1189.397] (-1189.846) * (-1197.307) (-1190.782) (-1196.351) [-1191.828] -- 0:02:35
104500 -- (-1197.851) [-1189.956] (-1196.048) (-1194.058) * (-1197.246) [-1193.203] (-1203.081) (-1204.268) -- 0:02:34
105000 -- (-1205.169) (-1195.045) (-1191.880) [-1190.677] * (-1194.214) (-1194.004) [-1198.805] (-1195.766) -- 0:02:41
Average standard deviation of split frequencies: 0.024904
105500 -- (-1193.699) (-1195.930) (-1190.919) [-1189.572] * (-1210.359) (-1189.605) (-1196.937) [-1188.176] -- 0:02:41
106000 -- (-1198.745) (-1195.655) [-1192.782] (-1190.327) * (-1201.612) (-1188.528) [-1192.993] (-1190.459) -- 0:02:40
106500 -- (-1197.664) [-1194.253] (-1198.871) (-1193.549) * (-1193.776) (-1192.113) (-1194.742) [-1193.574] -- 0:02:39
107000 -- (-1207.853) (-1191.023) [-1194.285] (-1191.084) * (-1203.255) (-1192.583) (-1193.112) [-1190.624] -- 0:02:38
107500 -- (-1196.674) (-1191.442) [-1189.381] (-1197.614) * (-1199.084) (-1190.316) [-1191.048] (-1192.678) -- 0:02:37
108000 -- [-1205.001] (-1197.006) (-1191.802) (-1192.894) * (-1198.416) (-1188.825) [-1193.940] (-1195.751) -- 0:02:36
108500 -- (-1195.474) (-1191.176) [-1191.993] (-1198.569) * (-1194.679) [-1190.982] (-1199.099) (-1189.148) -- 0:02:36
109000 -- [-1192.149] (-1194.823) (-1198.191) (-1192.319) * (-1197.099) (-1197.053) [-1188.583] (-1194.161) -- 0:02:35
109500 -- (-1196.178) [-1194.501] (-1198.201) (-1204.532) * [-1199.883] (-1193.652) (-1199.444) (-1189.651) -- 0:02:34
110000 -- [-1190.669] (-1195.040) (-1189.306) (-1199.023) * (-1199.252) (-1196.160) (-1195.157) [-1191.417] -- 0:02:33
Average standard deviation of split frequencies: 0.027262
110500 -- (-1188.687) (-1195.941) [-1193.689] (-1201.177) * (-1199.723) [-1192.686] (-1189.124) (-1194.585) -- 0:02:40
111000 -- (-1198.928) [-1199.514] (-1195.045) (-1196.657) * (-1192.092) (-1196.381) [-1193.542] (-1188.441) -- 0:02:40
111500 -- (-1190.132) (-1196.979) [-1194.691] (-1198.567) * (-1195.373) (-1194.140) [-1193.558] (-1203.628) -- 0:02:39
112000 -- [-1192.511] (-1190.132) (-1194.994) (-1198.787) * [-1193.180] (-1199.220) (-1193.437) (-1191.430) -- 0:02:38
112500 -- (-1195.219) [-1193.283] (-1196.055) (-1195.172) * (-1193.612) (-1190.553) [-1191.984] (-1191.857) -- 0:02:37
113000 -- (-1195.829) (-1192.963) (-1200.248) [-1197.944] * (-1207.880) (-1193.278) [-1196.337] (-1191.457) -- 0:02:36
113500 -- (-1199.654) (-1190.643) [-1189.593] (-1188.973) * (-1197.658) (-1193.661) [-1196.754] (-1192.089) -- 0:02:36
114000 -- (-1191.417) (-1200.723) [-1192.030] (-1191.289) * (-1194.531) [-1191.677] (-1192.976) (-1186.611) -- 0:02:35
114500 -- (-1198.138) [-1189.794] (-1195.300) (-1195.470) * (-1196.769) [-1191.066] (-1187.540) (-1191.950) -- 0:02:34
115000 -- [-1191.951] (-1197.162) (-1192.966) (-1188.920) * (-1192.726) (-1201.493) (-1192.507) [-1198.681] -- 0:02:33
Average standard deviation of split frequencies: 0.024383
115500 -- [-1195.122] (-1197.365) (-1200.748) (-1191.971) * (-1190.653) [-1193.298] (-1195.433) (-1195.457) -- 0:02:33
116000 -- (-1193.864) (-1203.588) (-1203.841) [-1196.045] * [-1190.405] (-1193.330) (-1191.662) (-1199.780) -- 0:02:32
116500 -- [-1192.644] (-1200.673) (-1204.450) (-1192.924) * (-1201.826) (-1193.005) [-1195.710] (-1192.003) -- 0:02:39
117000 -- [-1194.139] (-1196.041) (-1201.682) (-1195.948) * (-1195.568) (-1187.947) [-1194.983] (-1189.950) -- 0:02:38
117500 -- (-1197.753) (-1202.323) (-1215.961) [-1189.529] * (-1193.878) [-1193.146] (-1195.752) (-1193.698) -- 0:02:37
118000 -- (-1195.569) (-1200.085) (-1203.624) [-1191.897] * (-1192.447) (-1191.523) (-1193.119) [-1188.019] -- 0:02:36
118500 -- (-1194.935) (-1200.488) (-1196.684) [-1192.212] * [-1194.277] (-1191.189) (-1190.420) (-1191.388) -- 0:02:36
119000 -- (-1196.424) (-1201.745) [-1194.329] (-1195.050) * (-1195.004) (-1199.191) (-1194.371) [-1200.211] -- 0:02:35
119500 -- (-1195.354) (-1195.784) (-1190.510) [-1194.072] * [-1198.464] (-1189.420) (-1195.693) (-1189.250) -- 0:02:34
120000 -- (-1192.302) (-1194.283) (-1192.755) [-1192.464] * (-1198.853) (-1193.650) [-1189.241] (-1197.334) -- 0:02:34
Average standard deviation of split frequencies: 0.022659
120500 -- (-1194.276) (-1201.669) (-1197.243) [-1198.355] * (-1193.706) (-1195.341) [-1190.837] (-1193.515) -- 0:02:33
121000 -- (-1198.688) (-1198.209) (-1195.058) [-1194.172] * (-1192.647) [-1191.252] (-1202.491) (-1193.944) -- 0:02:32
121500 -- [-1189.625] (-1194.649) (-1198.899) (-1193.653) * (-1193.387) (-1195.504) (-1195.162) [-1193.019] -- 0:02:31
122000 -- (-1195.687) (-1196.701) [-1200.083] (-1196.364) * (-1192.216) (-1199.711) (-1199.447) [-1192.781] -- 0:02:38
122500 -- (-1197.217) (-1193.350) [-1196.720] (-1193.623) * [-1196.815] (-1196.680) (-1194.190) (-1193.954) -- 0:02:37
123000 -- (-1193.470) (-1192.722) [-1196.158] (-1195.113) * (-1197.651) (-1196.328) [-1196.617] (-1195.634) -- 0:02:36
123500 -- (-1195.148) [-1194.810] (-1193.032) (-1199.324) * (-1195.972) (-1193.751) (-1200.832) [-1198.978] -- 0:02:36
124000 -- (-1203.443) [-1199.631] (-1191.167) (-1192.936) * (-1191.582) (-1194.589) [-1189.287] (-1205.424) -- 0:02:35
124500 -- [-1192.982] (-1193.471) (-1200.494) (-1190.673) * (-1196.261) (-1191.887) [-1199.230] (-1195.477) -- 0:02:34
125000 -- (-1195.841) [-1194.146] (-1197.436) (-1192.590) * [-1194.354] (-1193.313) (-1196.734) (-1195.178) -- 0:02:34
Average standard deviation of split frequencies: 0.021700
125500 -- (-1192.656) (-1193.134) (-1192.116) [-1192.859] * (-1203.494) (-1200.818) [-1195.228] (-1196.902) -- 0:02:33
126000 -- (-1190.678) (-1202.847) (-1196.439) [-1193.480] * [-1193.225] (-1193.881) (-1195.529) (-1189.373) -- 0:02:32
126500 -- (-1193.092) (-1198.003) (-1189.754) [-1192.067] * (-1191.858) (-1197.267) [-1200.122] (-1196.596) -- 0:02:31
127000 -- [-1188.475] (-1196.471) (-1195.166) (-1196.889) * [-1189.638] (-1206.158) (-1200.036) (-1194.121) -- 0:02:31
127500 -- (-1192.122) [-1188.242] (-1198.660) (-1199.866) * (-1194.907) (-1196.575) [-1200.579] (-1197.854) -- 0:02:37
128000 -- [-1189.319] (-1199.339) (-1199.455) (-1201.804) * (-1195.274) [-1194.408] (-1197.321) (-1195.951) -- 0:02:36
128500 -- (-1196.921) (-1197.443) [-1202.508] (-1201.765) * (-1193.529) (-1198.136) (-1190.936) [-1197.118] -- 0:02:35
129000 -- (-1195.959) [-1192.919] (-1196.258) (-1194.331) * (-1191.388) [-1193.776] (-1191.971) (-1207.320) -- 0:02:35
129500 -- (-1197.888) (-1195.807) [-1198.695] (-1197.732) * (-1196.967) [-1192.828] (-1190.982) (-1195.789) -- 0:02:34
130000 -- [-1198.271] (-1197.630) (-1196.925) (-1195.552) * (-1198.991) (-1190.957) [-1194.272] (-1194.946) -- 0:02:33
Average standard deviation of split frequencies: 0.022368
130500 -- (-1195.821) [-1196.261] (-1195.569) (-1209.771) * [-1194.626] (-1206.330) (-1195.727) (-1192.753) -- 0:02:33
131000 -- [-1193.994] (-1193.876) (-1197.651) (-1198.816) * (-1192.430) (-1199.147) (-1199.204) [-1192.470] -- 0:02:32
131500 -- [-1198.358] (-1197.111) (-1199.932) (-1199.149) * (-1200.867) (-1194.002) (-1191.361) [-1196.923] -- 0:02:31
132000 -- [-1202.209] (-1191.491) (-1200.674) (-1203.934) * [-1196.486] (-1201.799) (-1189.880) (-1198.886) -- 0:02:31
132500 -- (-1196.059) [-1192.302] (-1194.784) (-1196.510) * (-1195.662) (-1203.736) [-1189.096] (-1199.236) -- 0:02:30
133000 -- (-1195.116) (-1195.516) [-1191.042] (-1198.875) * [-1189.358] (-1192.138) (-1188.944) (-1195.624) -- 0:02:36
133500 -- [-1194.944] (-1192.680) (-1196.170) (-1202.280) * [-1190.759] (-1189.815) (-1190.493) (-1193.645) -- 0:02:35
134000 -- (-1202.148) (-1205.077) [-1192.734] (-1206.068) * (-1186.204) (-1193.684) [-1193.266] (-1196.111) -- 0:02:35
134500 -- (-1196.672) (-1197.496) (-1194.843) [-1196.536] * (-1193.059) (-1196.136) [-1192.263] (-1193.278) -- 0:02:34
135000 -- (-1196.188) (-1203.145) [-1195.679] (-1196.670) * [-1192.115] (-1197.991) (-1196.093) (-1199.484) -- 0:02:33
Average standard deviation of split frequencies: 0.019411
135500 -- (-1193.635) (-1195.788) (-1195.011) [-1189.247] * (-1193.499) [-1194.300] (-1191.806) (-1199.673) -- 0:02:33
136000 -- (-1202.876) (-1192.667) [-1193.284] (-1202.720) * (-1198.512) [-1189.855] (-1193.231) (-1206.348) -- 0:02:32
136500 -- (-1205.523) (-1192.472) (-1200.174) [-1196.405] * (-1193.272) (-1190.458) (-1194.193) [-1192.595] -- 0:02:31
137000 -- (-1202.281) (-1196.302) (-1201.906) [-1191.928] * (-1195.104) (-1190.860) [-1195.903] (-1196.565) -- 0:02:31
137500 -- (-1198.122) (-1197.371) (-1197.001) [-1196.729] * (-1197.374) (-1191.616) [-1195.307] (-1193.185) -- 0:02:30
138000 -- (-1199.626) (-1198.505) [-1190.425] (-1190.028) * (-1200.805) [-1191.179] (-1196.105) (-1194.835) -- 0:02:29
138500 -- (-1199.737) (-1196.131) [-1192.449] (-1191.114) * (-1194.657) (-1194.770) (-1199.768) [-1194.065] -- 0:02:29
139000 -- (-1196.207) [-1195.383] (-1194.080) (-1195.350) * [-1198.067] (-1192.472) (-1193.827) (-1191.680) -- 0:02:34
139500 -- (-1197.015) [-1196.047] (-1195.262) (-1189.590) * [-1192.859] (-1193.564) (-1194.323) (-1197.551) -- 0:02:34
140000 -- (-1193.757) [-1204.031] (-1205.438) (-1193.109) * [-1198.517] (-1196.302) (-1201.299) (-1201.502) -- 0:02:33
Average standard deviation of split frequencies: 0.020107
140500 -- (-1194.409) [-1194.926] (-1199.450) (-1197.823) * (-1194.237) (-1193.381) (-1195.266) [-1194.206] -- 0:02:32
141000 -- (-1191.580) (-1199.963) (-1207.266) [-1193.460] * [-1192.215] (-1190.937) (-1195.346) (-1197.043) -- 0:02:32
141500 -- (-1193.544) [-1196.146] (-1197.029) (-1190.402) * (-1193.906) [-1192.542] (-1192.110) (-1190.982) -- 0:02:31
142000 -- (-1190.401) (-1195.202) [-1196.057] (-1190.917) * (-1191.889) (-1192.178) [-1194.016] (-1189.292) -- 0:02:31
142500 -- (-1191.978) [-1189.972] (-1202.253) (-1196.736) * (-1197.713) (-1192.672) [-1187.709] (-1200.046) -- 0:02:30
143000 -- (-1196.807) [-1193.205] (-1202.670) (-1200.725) * (-1195.038) [-1197.302] (-1194.697) (-1201.137) -- 0:02:29
143500 -- [-1187.904] (-1197.849) (-1196.932) (-1198.873) * (-1202.581) (-1199.367) (-1193.710) [-1195.271] -- 0:02:29
144000 -- (-1189.247) (-1200.130) (-1202.192) [-1193.843] * (-1193.480) (-1187.933) [-1191.019] (-1197.126) -- 0:02:28
144500 -- (-1195.822) (-1193.830) [-1195.951] (-1197.751) * (-1191.674) [-1190.529] (-1196.114) (-1194.074) -- 0:02:33
145000 -- (-1192.731) (-1196.672) (-1197.196) [-1191.277] * (-1198.506) [-1187.198] (-1190.360) (-1188.451) -- 0:02:33
Average standard deviation of split frequencies: 0.021956
145500 -- (-1192.570) (-1190.919) (-1199.982) [-1192.292] * (-1204.116) (-1196.607) (-1195.087) [-1197.684] -- 0:02:32
146000 -- [-1198.125] (-1196.167) (-1201.633) (-1193.486) * (-1191.213) (-1192.139) (-1192.092) [-1197.614] -- 0:02:32
146500 -- (-1200.544) (-1193.571) [-1196.875] (-1204.607) * (-1202.276) (-1193.622) (-1193.866) [-1186.628] -- 0:02:31
147000 -- [-1191.633] (-1191.151) (-1192.776) (-1193.610) * (-1201.291) (-1190.504) (-1189.300) [-1195.900] -- 0:02:30
147500 -- (-1198.145) (-1193.784) [-1196.674] (-1194.247) * [-1194.847] (-1188.600) (-1195.051) (-1199.256) -- 0:02:30
148000 -- (-1194.565) (-1193.266) (-1196.217) [-1194.219] * [-1193.335] (-1199.017) (-1197.329) (-1189.354) -- 0:02:29
148500 -- (-1192.912) [-1193.833] (-1189.549) (-1200.382) * (-1199.527) (-1198.815) [-1194.830] (-1194.242) -- 0:02:29
149000 -- (-1190.250) [-1194.716] (-1193.637) (-1194.629) * (-1198.394) (-1195.477) (-1190.391) [-1189.826] -- 0:02:28
149500 -- (-1196.506) [-1192.081] (-1194.441) (-1201.579) * (-1193.851) (-1195.405) [-1197.559] (-1192.945) -- 0:02:27
150000 -- (-1198.455) (-1194.145) [-1194.054] (-1191.339) * (-1193.747) (-1193.741) (-1200.474) [-1198.122] -- 0:02:33
Average standard deviation of split frequencies: 0.020650
150500 -- (-1198.592) (-1190.251) [-1197.428] (-1192.976) * (-1195.363) (-1192.702) (-1197.214) [-1194.720] -- 0:02:32
151000 -- (-1195.450) (-1192.458) (-1200.954) [-1192.117] * (-1193.850) (-1194.704) (-1199.359) [-1189.556] -- 0:02:31
151500 -- (-1194.371) (-1192.918) [-1199.004] (-1190.790) * (-1196.964) (-1193.220) (-1198.444) [-1193.676] -- 0:02:31
152000 -- (-1192.674) (-1190.433) (-1198.231) [-1188.624] * [-1195.188] (-1195.375) (-1197.515) (-1189.039) -- 0:02:30
152500 -- (-1196.953) (-1190.655) [-1199.646] (-1197.037) * (-1191.242) (-1199.060) (-1197.650) [-1191.067] -- 0:02:30
153000 -- (-1195.864) (-1192.499) (-1193.923) [-1192.653] * (-1197.780) (-1197.339) (-1190.010) [-1195.244] -- 0:02:29
153500 -- (-1199.627) (-1192.305) [-1193.273] (-1191.342) * [-1189.887] (-1194.353) (-1197.609) (-1191.414) -- 0:02:28
154000 -- (-1196.465) [-1196.853] (-1201.987) (-1197.075) * (-1191.352) (-1192.221) (-1192.424) [-1195.039] -- 0:02:28
154500 -- (-1188.561) [-1198.191] (-1193.165) (-1195.013) * (-1201.251) (-1190.487) [-1197.588] (-1199.395) -- 0:02:27
155000 -- [-1189.281] (-1191.704) (-1194.876) (-1194.832) * (-1192.743) [-1190.370] (-1200.051) (-1190.628) -- 0:02:27
Average standard deviation of split frequencies: 0.022361
155500 -- (-1190.645) [-1195.120] (-1190.615) (-1194.256) * (-1187.579) [-1190.754] (-1199.014) (-1188.512) -- 0:02:32
156000 -- [-1190.801] (-1193.892) (-1191.545) (-1191.703) * (-1191.301) [-1188.885] (-1192.565) (-1191.264) -- 0:02:31
156500 -- (-1191.748) [-1198.822] (-1197.430) (-1193.582) * (-1194.456) [-1191.583] (-1195.746) (-1193.744) -- 0:02:30
157000 -- [-1189.177] (-1190.287) (-1193.810) (-1190.146) * (-1190.777) (-1203.057) (-1211.766) [-1189.903] -- 0:02:30
157500 -- (-1190.113) [-1198.796] (-1194.209) (-1198.353) * (-1193.262) (-1201.825) (-1197.318) [-1192.541] -- 0:02:29
158000 -- [-1191.874] (-1198.139) (-1194.448) (-1195.630) * (-1200.645) [-1192.247] (-1193.732) (-1192.190) -- 0:02:29
158500 -- (-1194.917) (-1193.437) (-1192.180) [-1195.184] * (-1193.520) (-1192.737) (-1197.958) [-1189.511] -- 0:02:28
159000 -- (-1198.613) (-1192.415) [-1192.021] (-1202.295) * (-1195.118) [-1193.151] (-1209.739) (-1192.082) -- 0:02:28
159500 -- (-1199.278) (-1193.030) [-1189.058] (-1198.806) * (-1192.148) (-1198.425) (-1198.768) [-1190.026] -- 0:02:27
160000 -- (-1198.693) (-1195.732) [-1193.103] (-1201.343) * (-1194.584) [-1190.783] (-1196.232) (-1196.238) -- 0:02:27
Average standard deviation of split frequencies: 0.019952
160500 -- [-1191.028] (-1192.470) (-1199.649) (-1193.602) * (-1196.704) (-1191.787) [-1193.101] (-1197.759) -- 0:02:26
161000 -- (-1191.686) [-1191.629] (-1208.139) (-1191.384) * (-1198.882) (-1193.667) (-1194.605) [-1186.940] -- 0:02:25
161500 -- (-1195.042) (-1200.095) (-1203.460) [-1192.779] * (-1191.280) [-1192.785] (-1198.702) (-1206.598) -- 0:02:30
162000 -- [-1188.627] (-1201.593) (-1195.109) (-1194.300) * [-1190.328] (-1197.556) (-1195.416) (-1194.557) -- 0:02:30
162500 -- (-1197.792) (-1194.668) [-1197.403] (-1190.645) * (-1198.060) (-1195.148) (-1194.586) [-1196.588] -- 0:02:29
163000 -- (-1195.969) (-1194.887) (-1192.294) [-1191.379] * (-1199.866) (-1193.469) (-1194.087) [-1193.590] -- 0:02:28
163500 -- (-1203.237) (-1200.748) (-1204.727) [-1196.503] * (-1201.155) (-1195.641) [-1198.221] (-1197.495) -- 0:02:28
164000 -- (-1194.471) (-1192.199) (-1197.412) [-1190.300] * [-1199.419] (-1196.905) (-1193.855) (-1206.493) -- 0:02:27
164500 -- (-1194.374) (-1193.477) (-1199.523) [-1193.451] * (-1196.743) (-1194.281) [-1194.887] (-1205.941) -- 0:02:27
165000 -- [-1188.537] (-1191.350) (-1197.059) (-1191.520) * (-1194.230) (-1195.849) (-1200.522) [-1207.838] -- 0:02:26
Average standard deviation of split frequencies: 0.020446
165500 -- (-1196.098) [-1190.467] (-1197.261) (-1193.487) * [-1190.980] (-1196.204) (-1199.427) (-1209.770) -- 0:02:26
166000 -- (-1191.784) (-1204.071) [-1191.368] (-1200.422) * [-1192.781] (-1199.948) (-1205.684) (-1207.664) -- 0:02:25
166500 -- (-1192.266) [-1190.254] (-1187.857) (-1195.580) * (-1191.251) [-1194.603] (-1194.030) (-1203.891) -- 0:02:25
167000 -- (-1188.722) (-1192.180) (-1193.869) [-1198.103] * (-1190.254) (-1193.250) [-1192.787] (-1213.697) -- 0:02:29
167500 -- (-1191.713) (-1197.790) [-1192.198] (-1199.378) * [-1190.921] (-1204.015) (-1194.375) (-1200.914) -- 0:02:29
168000 -- (-1193.151) (-1195.626) (-1196.509) [-1189.449] * (-1192.130) (-1190.245) [-1193.198] (-1201.275) -- 0:02:28
168500 -- (-1191.248) (-1191.078) (-1204.248) [-1196.875] * (-1191.785) (-1191.935) [-1193.241] (-1203.453) -- 0:02:28
169000 -- (-1193.340) [-1189.665] (-1195.300) (-1199.420) * [-1193.510] (-1190.730) (-1197.962) (-1196.169) -- 0:02:27
169500 -- (-1202.286) (-1192.867) [-1192.118] (-1200.614) * (-1198.540) (-1188.943) (-1192.825) [-1197.096] -- 0:02:26
170000 -- (-1192.769) (-1190.449) (-1196.482) [-1194.454] * [-1190.927] (-1193.429) (-1191.246) (-1197.446) -- 0:02:26
Average standard deviation of split frequencies: 0.018783
170500 -- (-1195.621) (-1194.091) [-1190.609] (-1191.013) * (-1195.504) (-1194.808) [-1197.446] (-1200.035) -- 0:02:25
171000 -- (-1196.852) (-1199.494) [-1189.163] (-1191.914) * [-1189.021] (-1190.940) (-1194.116) (-1192.851) -- 0:02:25
171500 -- (-1194.365) [-1194.918] (-1194.686) (-1194.641) * (-1191.714) (-1195.644) (-1189.578) [-1189.648] -- 0:02:24
172000 -- [-1198.577] (-1192.796) (-1198.887) (-1189.906) * [-1190.998] (-1197.202) (-1186.711) (-1191.205) -- 0:02:24
172500 -- [-1194.109] (-1192.449) (-1190.815) (-1198.459) * [-1191.058] (-1193.893) (-1189.073) (-1192.035) -- 0:02:28
173000 -- (-1201.443) [-1189.745] (-1198.217) (-1192.279) * [-1192.702] (-1190.096) (-1194.519) (-1198.309) -- 0:02:28
173500 -- [-1201.971] (-1192.413) (-1198.299) (-1197.646) * (-1198.322) [-1192.705] (-1190.375) (-1190.426) -- 0:02:27
174000 -- (-1187.770) (-1191.015) [-1196.253] (-1198.900) * (-1203.583) [-1191.272] (-1195.244) (-1205.653) -- 0:02:27
174500 -- [-1195.625] (-1193.289) (-1192.331) (-1191.722) * (-1199.458) (-1188.848) [-1191.382] (-1194.686) -- 0:02:26
175000 -- (-1198.950) [-1191.357] (-1192.224) (-1193.298) * (-1197.463) (-1199.154) (-1190.166) [-1197.320] -- 0:02:26
Average standard deviation of split frequencies: 0.016071
175500 -- (-1194.722) (-1194.615) (-1195.336) [-1193.242] * (-1190.846) [-1190.463] (-1190.042) (-1202.161) -- 0:02:25
176000 -- [-1193.061] (-1193.823) (-1192.134) (-1191.907) * (-1197.633) [-1191.791] (-1196.902) (-1192.841) -- 0:02:25
176500 -- (-1197.208) [-1187.939] (-1191.347) (-1196.044) * (-1196.493) (-1192.406) (-1194.863) [-1188.628] -- 0:02:24
177000 -- (-1195.776) (-1195.837) [-1186.480] (-1202.050) * [-1186.816] (-1204.033) (-1191.814) (-1194.273) -- 0:02:24
177500 -- (-1194.492) [-1192.516] (-1192.473) (-1200.854) * (-1191.351) [-1192.299] (-1187.669) (-1189.779) -- 0:02:23
178000 -- (-1196.719) (-1192.950) (-1194.795) [-1191.302] * [-1196.104] (-1193.927) (-1195.818) (-1193.909) -- 0:02:23
178500 -- (-1189.024) (-1193.197) [-1194.380] (-1194.859) * [-1197.152] (-1195.259) (-1195.232) (-1192.013) -- 0:02:27
179000 -- (-1189.181) [-1193.739] (-1199.047) (-1194.160) * (-1199.660) (-1193.522) (-1191.121) [-1195.203] -- 0:02:26
179500 -- (-1196.212) [-1194.064] (-1190.516) (-1191.128) * (-1189.622) (-1192.422) (-1198.828) [-1200.195] -- 0:02:26
180000 -- (-1195.009) [-1194.566] (-1191.039) (-1192.123) * [-1193.563] (-1191.706) (-1198.665) (-1192.909) -- 0:02:25
Average standard deviation of split frequencies: 0.018265
180500 -- [-1198.121] (-1193.375) (-1188.390) (-1195.535) * (-1191.375) (-1191.999) (-1195.297) [-1188.136] -- 0:02:25
181000 -- (-1201.968) [-1191.238] (-1194.595) (-1194.044) * (-1191.779) [-1191.876] (-1195.051) (-1196.946) -- 0:02:24
181500 -- (-1203.249) (-1193.704) (-1189.420) [-1191.497] * (-1192.780) [-1196.158] (-1191.109) (-1188.276) -- 0:02:24
182000 -- (-1192.635) [-1193.400] (-1194.853) (-1194.653) * (-1195.205) (-1200.115) (-1192.302) [-1192.267] -- 0:02:23
182500 -- (-1199.359) [-1192.303] (-1191.388) (-1195.478) * (-1201.257) (-1199.537) (-1195.372) [-1194.672] -- 0:02:23
183000 -- [-1195.330] (-1197.909) (-1196.945) (-1197.838) * [-1195.657] (-1195.158) (-1201.184) (-1192.887) -- 0:02:22
183500 -- (-1201.484) [-1197.086] (-1195.693) (-1196.351) * (-1197.194) (-1192.104) [-1199.406] (-1195.606) -- 0:02:22
184000 -- (-1200.544) [-1199.181] (-1196.268) (-1195.619) * (-1190.464) (-1196.262) (-1189.954) [-1194.098] -- 0:02:26
184500 -- (-1191.902) (-1195.607) (-1200.973) [-1194.505] * (-1203.615) (-1191.577) [-1194.347] (-1201.476) -- 0:02:25
185000 -- (-1196.043) [-1198.097] (-1201.225) (-1190.930) * (-1197.348) (-1191.940) (-1194.293) [-1193.987] -- 0:02:25
Average standard deviation of split frequencies: 0.015713
185500 -- [-1191.263] (-1198.810) (-1207.391) (-1199.347) * (-1198.484) (-1188.219) (-1197.405) [-1197.348] -- 0:02:24
186000 -- [-1198.116] (-1196.854) (-1194.303) (-1194.383) * (-1193.335) (-1190.823) [-1193.539] (-1194.138) -- 0:02:24
186500 -- (-1201.805) (-1196.371) [-1197.641] (-1195.954) * [-1191.713] (-1190.027) (-1195.091) (-1189.755) -- 0:02:23
187000 -- (-1205.366) (-1194.689) (-1194.955) [-1193.514] * (-1192.223) [-1192.056] (-1187.365) (-1193.264) -- 0:02:23
187500 -- (-1194.880) (-1199.304) (-1200.369) [-1195.375] * (-1200.279) [-1192.435] (-1197.167) (-1192.499) -- 0:02:23
188000 -- (-1191.615) (-1201.354) [-1196.865] (-1190.879) * (-1196.721) (-1193.967) (-1194.058) [-1194.833] -- 0:02:22
188500 -- (-1201.082) [-1200.926] (-1196.425) (-1195.210) * [-1193.944] (-1192.136) (-1189.955) (-1190.087) -- 0:02:22
189000 -- (-1193.470) (-1190.785) [-1197.491] (-1196.627) * (-1193.175) [-1192.632] (-1193.203) (-1193.699) -- 0:02:21
189500 -- (-1187.544) (-1195.557) (-1201.343) [-1193.784] * (-1190.346) (-1190.353) (-1193.378) [-1193.481] -- 0:02:25
190000 -- (-1196.171) [-1196.595] (-1195.854) (-1191.843) * (-1194.552) (-1193.643) (-1202.822) [-1192.408] -- 0:02:24
Average standard deviation of split frequencies: 0.008406
190500 -- (-1194.139) (-1194.579) (-1192.849) [-1191.345] * [-1195.376] (-1192.102) (-1199.783) (-1197.682) -- 0:02:24
191000 -- [-1196.813] (-1196.805) (-1190.126) (-1200.260) * (-1192.813) (-1197.447) [-1193.001] (-1190.992) -- 0:02:24
191500 -- (-1195.569) (-1203.032) (-1192.026) [-1190.681] * (-1193.958) [-1193.563] (-1190.584) (-1198.432) -- 0:02:23
192000 -- (-1197.878) (-1197.847) [-1188.681] (-1193.889) * (-1194.226) [-1190.707] (-1189.559) (-1200.625) -- 0:02:23
192500 -- (-1192.679) (-1196.104) [-1197.763] (-1192.862) * (-1193.633) (-1196.204) [-1190.917] (-1208.505) -- 0:02:22
193000 -- (-1194.585) (-1202.765) (-1188.981) [-1192.494] * (-1194.614) (-1200.533) (-1187.673) [-1192.138] -- 0:02:22
193500 -- (-1198.473) [-1198.423] (-1188.972) (-1197.065) * (-1198.417) (-1194.525) [-1186.726] (-1197.056) -- 0:02:21
194000 -- (-1193.949) (-1200.750) (-1193.960) [-1197.757] * (-1209.694) (-1193.603) [-1195.285] (-1193.921) -- 0:02:21
194500 -- [-1196.861] (-1195.082) (-1193.118) (-1202.075) * (-1199.415) (-1197.530) (-1190.057) [-1190.723] -- 0:02:24
195000 -- [-1192.337] (-1195.225) (-1194.432) (-1198.275) * (-1196.457) (-1192.057) [-1189.167] (-1188.988) -- 0:02:24
Average standard deviation of split frequencies: 0.004329
195500 -- (-1195.205) (-1192.457) (-1197.582) [-1193.934] * (-1203.238) [-1193.233] (-1194.087) (-1192.061) -- 0:02:24
196000 -- (-1192.149) [-1192.620] (-1197.296) (-1202.955) * (-1195.242) (-1198.786) (-1197.039) [-1192.497] -- 0:02:23
196500 -- (-1199.784) (-1194.969) [-1197.346] (-1196.995) * (-1196.976) (-1189.081) (-1200.991) [-1192.382] -- 0:02:23
197000 -- (-1194.972) (-1194.676) [-1197.160] (-1195.640) * (-1198.830) (-1201.843) [-1194.540] (-1193.324) -- 0:02:22
197500 -- (-1191.478) (-1200.052) [-1190.462] (-1191.554) * (-1193.271) (-1193.285) (-1195.330) [-1198.444] -- 0:02:22
198000 -- (-1199.209) [-1192.777] (-1201.921) (-1188.619) * [-1191.768] (-1191.767) (-1200.119) (-1195.320) -- 0:02:21
198500 -- (-1200.346) [-1199.248] (-1195.389) (-1190.266) * (-1189.212) [-1190.563] (-1197.284) (-1192.775) -- 0:02:21
199000 -- (-1203.928) [-1189.821] (-1191.897) (-1187.305) * (-1193.464) [-1190.977] (-1190.984) (-1194.298) -- 0:02:20
199500 -- [-1199.207] (-1190.863) (-1193.794) (-1188.165) * (-1191.749) (-1187.113) [-1192.228] (-1194.245) -- 0:02:20
200000 -- (-1196.730) [-1194.413] (-1188.407) (-1192.533) * [-1190.474] (-1199.848) (-1200.752) (-1192.612) -- 0:02:24
Average standard deviation of split frequencies: 0.004229
200500 -- (-1190.276) (-1195.864) [-1191.780] (-1191.146) * (-1194.460) (-1190.696) (-1196.736) [-1191.135] -- 0:02:23
201000 -- (-1195.779) (-1201.766) [-1197.473] (-1196.112) * (-1197.926) (-1194.848) (-1198.768) [-1190.664] -- 0:02:23
201500 -- (-1192.578) (-1198.162) [-1191.888] (-1194.106) * (-1196.790) (-1188.571) [-1191.984] (-1191.424) -- 0:02:22
202000 -- [-1193.615] (-1197.290) (-1191.661) (-1192.453) * [-1194.689] (-1190.541) (-1191.040) (-1198.285) -- 0:02:22
202500 -- (-1191.093) (-1197.952) [-1198.116] (-1189.665) * (-1193.801) (-1190.307) (-1190.003) [-1188.510] -- 0:02:21
203000 -- (-1190.321) (-1204.604) [-1190.433] (-1192.289) * (-1200.343) (-1194.882) (-1196.830) [-1191.553] -- 0:02:21
203500 -- (-1193.532) (-1196.264) (-1197.837) [-1189.214] * (-1204.845) (-1198.134) [-1191.280] (-1193.141) -- 0:02:20
204000 -- (-1196.394) [-1189.597] (-1191.385) (-1190.518) * (-1194.408) (-1195.962) [-1187.966] (-1195.645) -- 0:02:20
204500 -- (-1193.391) [-1197.146] (-1192.977) (-1195.799) * (-1192.181) (-1199.004) (-1196.252) [-1191.354] -- 0:02:20
205000 -- [-1192.945] (-1192.522) (-1194.841) (-1202.082) * (-1196.510) (-1204.144) (-1193.890) [-1189.479] -- 0:02:19
Average standard deviation of split frequencies: 0.004119
205500 -- (-1188.678) (-1194.396) [-1192.676] (-1196.376) * (-1198.882) (-1199.524) (-1196.065) [-1190.032] -- 0:02:23
206000 -- (-1192.199) (-1197.904) (-1208.858) [-1195.131] * [-1197.310] (-1197.241) (-1191.841) (-1191.238) -- 0:02:22
206500 -- (-1195.388) (-1197.462) (-1195.617) [-1188.760] * (-1198.406) (-1201.281) [-1196.943] (-1202.971) -- 0:02:22
207000 -- (-1195.851) (-1195.555) (-1202.673) [-1197.307] * [-1194.755] (-1197.690) (-1194.829) (-1198.792) -- 0:02:21
207500 -- [-1189.623] (-1193.347) (-1195.329) (-1194.565) * (-1194.129) [-1191.787] (-1194.364) (-1196.151) -- 0:02:21
208000 -- (-1193.020) [-1193.324] (-1196.386) (-1192.549) * (-1191.643) [-1191.834] (-1199.516) (-1194.796) -- 0:02:20
208500 -- (-1198.018) (-1193.136) [-1193.323] (-1191.160) * [-1189.381] (-1195.479) (-1195.131) (-1193.182) -- 0:02:20
209000 -- (-1193.301) [-1191.662] (-1194.992) (-1198.022) * (-1195.822) (-1196.663) (-1194.948) [-1198.926] -- 0:02:20
209500 -- [-1191.269] (-1192.129) (-1189.640) (-1195.600) * (-1192.531) [-1191.769] (-1197.288) (-1196.587) -- 0:02:19
210000 -- (-1194.201) (-1194.457) (-1200.147) [-1191.275] * (-1192.809) (-1193.503) (-1200.403) [-1190.828] -- 0:02:19
Average standard deviation of split frequencies: 0.009398
210500 -- (-1191.412) [-1197.289] (-1198.681) (-1192.339) * [-1186.325] (-1191.292) (-1194.865) (-1188.367) -- 0:02:22
211000 -- [-1189.199] (-1192.416) (-1193.740) (-1192.954) * [-1190.033] (-1197.297) (-1197.351) (-1193.721) -- 0:02:22
211500 -- (-1193.269) [-1194.398] (-1191.607) (-1199.604) * (-1190.548) [-1199.300] (-1194.805) (-1194.396) -- 0:02:21
212000 -- (-1203.520) (-1196.633) [-1195.417] (-1196.095) * (-1198.268) [-1194.233] (-1195.481) (-1197.300) -- 0:02:21
212500 -- (-1192.932) (-1190.242) [-1194.867] (-1188.492) * (-1190.631) (-1188.975) [-1193.959] (-1197.278) -- 0:02:20
213000 -- (-1195.444) (-1196.210) (-1202.516) [-1192.736] * (-1192.407) (-1192.988) (-1195.544) [-1193.752] -- 0:02:20
213500 -- (-1193.291) (-1195.777) [-1198.646] (-1191.339) * (-1198.835) [-1193.379] (-1199.591) (-1195.404) -- 0:02:19
214000 -- [-1193.326] (-1195.395) (-1190.805) (-1192.027) * (-1188.112) [-1192.321] (-1199.680) (-1196.107) -- 0:02:19
214500 -- (-1191.570) (-1193.715) (-1192.971) [-1194.306] * [-1190.436] (-1199.939) (-1194.129) (-1192.401) -- 0:02:19
215000 -- (-1189.596) [-1195.979] (-1194.014) (-1194.854) * (-1194.551) (-1198.883) [-1192.570] (-1190.962) -- 0:02:18
Average standard deviation of split frequencies: 0.010039
215500 -- (-1188.542) (-1197.811) (-1194.769) [-1193.455] * (-1197.528) [-1191.410] (-1193.843) (-1195.749) -- 0:02:21
216000 -- (-1189.532) (-1197.792) (-1197.428) [-1200.559] * (-1189.279) (-1194.676) (-1195.076) [-1188.806] -- 0:02:21
216500 -- [-1196.409] (-1193.376) (-1195.752) (-1195.243) * (-1196.689) (-1195.000) (-1196.230) [-1189.441] -- 0:02:21
217000 -- (-1194.584) (-1191.332) [-1200.534] (-1204.684) * (-1195.964) (-1194.430) (-1198.060) [-1188.183] -- 0:02:20
217500 -- (-1191.959) (-1193.599) [-1199.738] (-1197.210) * [-1190.545] (-1191.120) (-1192.956) (-1193.405) -- 0:02:20
218000 -- (-1198.365) (-1191.043) (-1198.465) [-1196.532] * [-1190.614] (-1190.852) (-1193.121) (-1195.893) -- 0:02:19
218500 -- (-1195.675) (-1197.271) (-1195.950) [-1191.989] * [-1195.579] (-1190.828) (-1194.742) (-1199.496) -- 0:02:19
219000 -- (-1196.130) (-1200.307) (-1195.692) [-1196.901] * (-1198.364) (-1194.095) [-1192.891] (-1194.562) -- 0:02:19
219500 -- [-1191.023] (-1199.343) (-1194.565) (-1191.934) * [-1192.779] (-1197.311) (-1194.318) (-1202.879) -- 0:02:18
220000 -- (-1196.572) (-1199.147) [-1190.998] (-1192.306) * (-1198.363) (-1190.345) (-1195.664) [-1194.790] -- 0:02:18
Average standard deviation of split frequencies: 0.009827
220500 -- (-1196.260) (-1194.899) [-1196.976] (-1197.203) * (-1196.211) [-1202.300] (-1201.455) (-1202.398) -- 0:02:17
221000 -- (-1193.418) (-1199.792) (-1208.807) [-1191.123] * (-1198.393) [-1190.149] (-1192.417) (-1190.304) -- 0:02:20
221500 -- (-1200.832) [-1194.797] (-1200.897) (-1193.043) * (-1194.352) (-1198.999) [-1195.186] (-1189.849) -- 0:02:20
222000 -- (-1197.554) (-1197.799) (-1201.531) [-1195.915] * (-1192.884) (-1198.257) (-1197.886) [-1193.090] -- 0:02:20
222500 -- [-1193.360] (-1197.470) (-1201.038) (-1188.291) * [-1197.659] (-1195.145) (-1196.725) (-1196.636) -- 0:02:19
223000 -- (-1194.569) (-1207.588) (-1194.923) [-1188.455] * [-1193.549] (-1194.498) (-1196.730) (-1197.439) -- 0:02:19
223500 -- (-1196.123) (-1190.350) (-1195.474) [-1192.257] * (-1191.096) [-1202.063] (-1204.272) (-1200.406) -- 0:02:18
224000 -- (-1188.711) [-1192.204] (-1197.898) (-1195.209) * [-1195.643] (-1197.805) (-1190.537) (-1196.158) -- 0:02:18
224500 -- (-1195.012) (-1194.343) (-1193.497) [-1191.636] * (-1196.851) (-1197.498) [-1192.055] (-1196.292) -- 0:02:18
225000 -- (-1195.189) (-1190.952) (-1193.103) [-1194.296] * [-1191.650] (-1194.503) (-1193.123) (-1198.459) -- 0:02:17
Average standard deviation of split frequencies: 0.006258
225500 -- (-1201.533) [-1189.648] (-1192.942) (-1189.268) * (-1193.511) (-1195.142) [-1194.924] (-1203.413) -- 0:02:17
226000 -- (-1200.643) (-1191.401) (-1193.331) [-1193.170] * [-1191.501] (-1200.032) (-1192.905) (-1198.107) -- 0:02:20
226500 -- (-1199.761) [-1186.020] (-1193.336) (-1195.273) * [-1193.974] (-1199.816) (-1192.733) (-1192.332) -- 0:02:20
227000 -- (-1201.306) [-1192.256] (-1191.073) (-1190.694) * (-1193.681) (-1197.966) [-1191.136] (-1195.375) -- 0:02:19
227500 -- (-1192.829) (-1195.607) [-1191.815] (-1190.250) * (-1189.089) [-1191.775] (-1194.175) (-1200.077) -- 0:02:19
228000 -- (-1191.731) [-1190.437] (-1194.585) (-1194.757) * (-1192.601) (-1189.541) (-1187.909) [-1200.506] -- 0:02:18
228500 -- (-1195.011) [-1190.381] (-1192.766) (-1190.104) * (-1201.411) [-1189.418] (-1192.740) (-1196.875) -- 0:02:18
229000 -- (-1198.139) (-1187.701) [-1196.194] (-1198.741) * [-1194.152] (-1199.885) (-1189.930) (-1195.039) -- 0:02:18
229500 -- (-1191.245) [-1197.596] (-1197.517) (-1193.477) * [-1190.359] (-1200.393) (-1195.910) (-1190.533) -- 0:02:17
230000 -- (-1191.219) [-1193.948] (-1191.256) (-1198.435) * (-1193.423) (-1200.451) (-1189.957) [-1191.969] -- 0:02:17
Average standard deviation of split frequencies: 0.007766
230500 -- (-1193.988) (-1191.850) (-1192.339) [-1193.494] * (-1198.518) [-1187.880] (-1201.940) (-1193.669) -- 0:02:16
231000 -- (-1190.907) (-1193.570) [-1194.065] (-1193.243) * (-1200.790) (-1191.249) (-1197.113) [-1190.887] -- 0:02:16
231500 -- [-1192.213] (-1194.933) (-1198.043) (-1196.672) * (-1201.382) (-1200.526) (-1197.671) [-1188.665] -- 0:02:16
232000 -- (-1193.153) (-1203.692) (-1192.271) [-1190.862] * (-1196.192) (-1194.492) [-1195.778] (-1200.434) -- 0:02:19
232500 -- (-1191.279) (-1193.276) (-1195.698) [-1189.891] * (-1204.351) (-1200.892) [-1196.529] (-1193.271) -- 0:02:18
233000 -- [-1194.347] (-1192.399) (-1196.534) (-1192.743) * (-1198.794) (-1193.968) (-1199.955) [-1197.053] -- 0:02:18
233500 -- [-1190.844] (-1193.740) (-1198.111) (-1196.068) * (-1195.495) (-1190.898) [-1195.863] (-1191.591) -- 0:02:17
234000 -- (-1189.820) (-1204.366) (-1201.027) [-1192.094] * (-1208.444) (-1195.797) [-1190.437] (-1202.864) -- 0:02:17
234500 -- [-1194.006] (-1193.014) (-1204.682) (-1195.470) * [-1195.022] (-1192.037) (-1197.476) (-1198.769) -- 0:02:17
235000 -- (-1188.590) (-1198.839) [-1200.306] (-1200.582) * (-1199.552) (-1188.824) (-1192.454) [-1192.957] -- 0:02:16
Average standard deviation of split frequencies: 0.007191
235500 -- [-1192.714] (-1194.091) (-1200.015) (-1205.674) * (-1196.700) (-1197.491) [-1193.909] (-1189.974) -- 0:02:16
236000 -- [-1193.103] (-1200.382) (-1195.348) (-1194.509) * (-1198.662) [-1188.856] (-1194.581) (-1187.209) -- 0:02:15
236500 -- [-1192.513] (-1195.487) (-1203.963) (-1193.477) * (-1202.454) (-1193.434) (-1194.586) [-1189.396] -- 0:02:15
237000 -- (-1194.382) [-1191.221] (-1200.596) (-1192.550) * (-1194.968) [-1191.811] (-1199.229) (-1196.711) -- 0:02:15
237500 -- (-1200.345) [-1190.160] (-1197.933) (-1195.316) * (-1201.135) (-1188.067) [-1191.895] (-1195.959) -- 0:02:18
238000 -- (-1199.873) (-1194.313) (-1199.306) [-1196.101] * (-1199.936) (-1196.354) (-1194.885) [-1192.700] -- 0:02:17
238500 -- [-1190.988] (-1192.177) (-1195.595) (-1196.560) * (-1198.747) (-1192.613) (-1189.442) [-1191.217] -- 0:02:17
239000 -- [-1190.248] (-1191.833) (-1195.252) (-1200.851) * (-1198.791) (-1188.768) (-1196.087) [-1194.386] -- 0:02:16
239500 -- [-1192.041] (-1195.680) (-1200.527) (-1194.321) * (-1193.856) (-1192.033) [-1194.656] (-1199.827) -- 0:02:16
240000 -- (-1192.628) (-1197.482) (-1199.530) [-1204.356] * (-1201.886) (-1192.619) [-1194.002] (-1194.599) -- 0:02:16
Average standard deviation of split frequencies: 0.008227
240500 -- (-1196.573) (-1194.627) [-1189.016] (-1196.364) * (-1194.135) (-1195.811) (-1198.681) [-1188.931] -- 0:02:15
241000 -- [-1193.142] (-1194.736) (-1198.868) (-1204.553) * (-1191.425) (-1205.198) (-1194.823) [-1193.412] -- 0:02:15
241500 -- [-1188.892] (-1193.566) (-1197.774) (-1194.504) * (-1195.118) (-1195.877) [-1195.489] (-1193.723) -- 0:02:15
242000 -- (-1195.097) (-1198.260) [-1191.280] (-1195.926) * (-1191.284) (-1195.241) [-1196.730] (-1208.911) -- 0:02:14
242500 -- [-1194.177] (-1197.770) (-1194.757) (-1199.265) * (-1189.703) [-1195.992] (-1190.146) (-1205.226) -- 0:02:14
243000 -- (-1196.495) [-1196.091] (-1200.249) (-1201.248) * (-1189.470) (-1196.624) (-1195.178) [-1195.280] -- 0:02:17
243500 -- (-1189.824) (-1195.534) (-1192.138) [-1199.203] * (-1194.051) (-1195.805) (-1196.501) [-1191.441] -- 0:02:16
244000 -- (-1192.767) [-1202.048] (-1206.635) (-1198.289) * (-1194.771) [-1187.066] (-1191.334) (-1194.160) -- 0:02:16
244500 -- (-1195.513) (-1196.098) (-1190.762) [-1192.290] * [-1191.589] (-1191.958) (-1193.866) (-1203.563) -- 0:02:15
245000 -- [-1194.178] (-1195.853) (-1198.771) (-1194.207) * [-1193.895] (-1194.221) (-1190.807) (-1202.610) -- 0:02:15
Average standard deviation of split frequencies: 0.013797
245500 -- (-1195.326) (-1191.396) [-1192.834] (-1192.815) * (-1191.992) (-1192.394) [-1191.298] (-1192.856) -- 0:02:15
246000 -- (-1195.608) (-1188.940) [-1193.625] (-1196.409) * (-1201.863) (-1195.667) (-1196.037) [-1194.758] -- 0:02:14
246500 -- (-1196.714) (-1198.668) (-1190.559) [-1186.291] * [-1196.854] (-1200.833) (-1196.783) (-1199.227) -- 0:02:14
247000 -- (-1194.692) (-1191.565) [-1190.713] (-1199.991) * (-1195.787) [-1195.220] (-1190.384) (-1195.188) -- 0:02:14
247500 -- (-1197.423) [-1197.530] (-1196.878) (-1194.940) * (-1192.732) [-1191.455] (-1190.175) (-1196.675) -- 0:02:13
248000 -- [-1193.172] (-1198.847) (-1198.499) (-1196.496) * (-1191.189) [-1193.293] (-1190.711) (-1204.461) -- 0:02:13
248500 -- (-1194.256) (-1197.744) [-1192.769] (-1195.328) * (-1195.383) [-1190.942] (-1196.782) (-1209.276) -- 0:02:16
249000 -- (-1195.822) (-1199.926) (-1193.888) [-1191.429] * (-1188.857) (-1195.851) (-1195.659) [-1195.742] -- 0:02:15
249500 -- [-1191.611] (-1190.977) (-1194.515) (-1194.294) * (-1193.972) (-1192.889) [-1193.243] (-1204.280) -- 0:02:15
250000 -- (-1190.008) (-1190.292) [-1193.831] (-1191.498) * (-1195.289) [-1195.361] (-1207.476) (-1200.270) -- 0:02:15
Average standard deviation of split frequencies: 0.012788
250500 -- [-1196.136] (-1194.927) (-1195.067) (-1196.355) * (-1201.865) (-1196.313) (-1196.406) [-1198.468] -- 0:02:14
251000 -- (-1196.310) (-1191.586) [-1192.360] (-1200.072) * (-1196.006) [-1196.805] (-1204.218) (-1191.205) -- 0:02:14
251500 -- (-1197.423) [-1189.686] (-1190.505) (-1202.624) * [-1192.549] (-1197.819) (-1201.871) (-1202.178) -- 0:02:13
252000 -- (-1201.309) [-1195.206] (-1192.750) (-1198.281) * [-1195.132] (-1199.659) (-1192.160) (-1195.744) -- 0:02:13
252500 -- (-1199.373) (-1194.890) [-1190.690] (-1194.507) * (-1196.705) (-1195.625) [-1195.109] (-1191.408) -- 0:02:13
253000 -- (-1200.322) (-1198.247) [-1195.598] (-1198.883) * (-1193.974) (-1200.050) [-1195.792] (-1194.003) -- 0:02:12
253500 -- (-1189.312) (-1194.677) [-1194.736] (-1198.934) * (-1203.712) (-1195.770) (-1198.840) [-1188.218] -- 0:02:12
254000 -- [-1196.835] (-1193.017) (-1199.189) (-1203.309) * [-1201.150] (-1196.741) (-1204.227) (-1192.413) -- 0:02:12
254500 -- (-1194.618) (-1193.912) [-1197.392] (-1195.810) * (-1196.401) [-1193.887] (-1203.279) (-1190.347) -- 0:02:14
255000 -- (-1197.272) [-1201.695] (-1196.946) (-1199.605) * [-1191.130] (-1198.882) (-1193.197) (-1198.575) -- 0:02:14
Average standard deviation of split frequencies: 0.013258
255500 -- [-1194.646] (-1195.233) (-1197.153) (-1193.833) * (-1191.729) (-1201.815) [-1192.362] (-1200.274) -- 0:02:14
256000 -- [-1195.160] (-1197.053) (-1197.734) (-1192.828) * (-1195.747) (-1193.606) (-1194.723) [-1190.694] -- 0:02:13
256500 -- [-1190.741] (-1196.551) (-1198.079) (-1194.674) * (-1189.794) [-1190.896] (-1193.572) (-1201.920) -- 0:02:13
257000 -- (-1188.451) (-1194.138) (-1197.635) [-1191.413] * (-1197.043) (-1192.769) (-1188.602) [-1195.705] -- 0:02:12
257500 -- (-1197.640) (-1196.821) [-1197.867] (-1194.686) * [-1195.112] (-1195.237) (-1197.657) (-1193.811) -- 0:02:12
258000 -- (-1192.412) (-1197.700) [-1192.115] (-1198.911) * [-1193.237] (-1192.779) (-1195.705) (-1192.601) -- 0:02:12
258500 -- (-1192.610) [-1196.772] (-1192.042) (-1199.359) * [-1193.494] (-1194.950) (-1192.228) (-1190.523) -- 0:02:11
259000 -- (-1192.435) (-1191.258) [-1193.610] (-1208.654) * (-1192.927) [-1191.685] (-1191.461) (-1198.238) -- 0:02:11
259500 -- (-1201.700) [-1189.348] (-1195.308) (-1207.279) * (-1196.526) [-1191.977] (-1189.691) (-1195.513) -- 0:02:11
260000 -- [-1194.376] (-1187.335) (-1194.321) (-1199.865) * (-1193.537) (-1195.171) (-1196.816) [-1192.092] -- 0:02:13
Average standard deviation of split frequencies: 0.012298
260500 -- [-1196.414] (-1197.460) (-1194.693) (-1204.163) * [-1190.724] (-1207.372) (-1192.086) (-1188.072) -- 0:02:13
261000 -- [-1190.361] (-1197.124) (-1191.402) (-1193.436) * [-1193.333] (-1206.377) (-1194.541) (-1191.130) -- 0:02:13
261500 -- (-1189.667) (-1199.560) (-1196.191) [-1193.219] * (-1192.301) [-1192.378] (-1192.637) (-1201.693) -- 0:02:12
262000 -- (-1192.249) (-1196.872) (-1194.100) [-1196.400] * [-1196.260] (-1191.095) (-1192.675) (-1197.738) -- 0:02:12
262500 -- (-1195.850) [-1195.976] (-1198.801) (-1195.189) * (-1200.649) (-1196.043) [-1191.956] (-1190.914) -- 0:02:12
263000 -- (-1197.642) (-1195.337) (-1191.236) [-1190.916] * (-1194.447) (-1196.654) [-1192.622] (-1199.530) -- 0:02:11
263500 -- (-1192.559) (-1195.544) [-1188.948] (-1193.323) * (-1193.091) (-1197.246) (-1195.443) [-1187.897] -- 0:02:11
264000 -- [-1195.140] (-1195.633) (-1193.846) (-1193.339) * (-1194.112) [-1190.961] (-1190.604) (-1190.012) -- 0:02:11
264500 -- (-1194.613) (-1192.206) (-1203.237) [-1191.926] * (-1191.820) [-1189.215] (-1195.171) (-1203.536) -- 0:02:10
265000 -- (-1195.880) (-1196.837) (-1196.564) [-1200.323] * (-1192.473) (-1191.706) (-1199.471) [-1191.235] -- 0:02:10
Average standard deviation of split frequencies: 0.010988
265500 -- (-1189.804) (-1197.700) [-1191.084] (-1193.719) * (-1191.125) (-1195.715) [-1190.978] (-1189.293) -- 0:02:12
266000 -- (-1191.654) [-1190.516] (-1192.343) (-1189.488) * (-1193.324) (-1196.429) [-1195.356] (-1194.477) -- 0:02:12
266500 -- (-1190.598) [-1196.038] (-1193.071) (-1193.762) * (-1197.334) [-1192.833] (-1196.887) (-1187.687) -- 0:02:12
267000 -- (-1191.758) (-1191.016) [-1196.375] (-1192.414) * (-1196.880) (-1191.854) (-1193.552) [-1194.836] -- 0:02:11
267500 -- (-1191.109) (-1192.404) [-1189.636] (-1192.245) * [-1199.536] (-1190.198) (-1201.273) (-1192.532) -- 0:02:11
268000 -- (-1195.762) (-1195.504) (-1195.944) [-1197.324] * (-1193.235) (-1194.690) (-1195.389) [-1196.060] -- 0:02:11
268500 -- (-1194.860) (-1191.106) (-1195.786) [-1187.982] * (-1197.769) [-1194.739] (-1194.316) (-1195.531) -- 0:02:10
269000 -- (-1188.271) (-1194.475) (-1193.871) [-1192.928] * (-1196.433) [-1190.836] (-1187.440) (-1189.898) -- 0:02:10
269500 -- [-1193.078] (-1194.482) (-1193.008) (-1195.877) * (-1209.138) [-1193.997] (-1190.043) (-1192.820) -- 0:02:10
270000 -- (-1202.239) [-1200.089] (-1192.372) (-1199.152) * (-1198.281) (-1192.416) [-1194.452] (-1194.436) -- 0:02:09
Average standard deviation of split frequencies: 0.008360
270500 -- (-1196.288) [-1195.717] (-1194.651) (-1208.493) * (-1195.412) (-1198.274) (-1189.327) [-1190.897] -- 0:02:09
271000 -- (-1191.796) (-1202.371) (-1191.375) [-1199.726] * [-1195.771] (-1192.663) (-1196.903) (-1201.168) -- 0:02:09
271500 -- (-1192.465) (-1198.505) [-1191.211] (-1199.147) * (-1197.761) (-1195.124) (-1198.888) [-1193.475] -- 0:02:11
272000 -- (-1194.547) [-1189.803] (-1190.101) (-1192.231) * (-1196.681) (-1196.843) [-1191.803] (-1191.844) -- 0:02:11
272500 -- (-1195.167) [-1194.926] (-1193.207) (-1193.177) * (-1194.941) (-1199.117) [-1199.016] (-1193.337) -- 0:02:10
273000 -- [-1194.603] (-1205.034) (-1199.962) (-1197.466) * (-1193.253) (-1194.709) [-1195.907] (-1192.254) -- 0:02:10
273500 -- [-1196.384] (-1197.903) (-1195.485) (-1193.537) * (-1192.149) (-1199.270) (-1195.530) [-1198.099] -- 0:02:10
274000 -- [-1198.910] (-1194.540) (-1195.540) (-1194.702) * [-1193.637] (-1205.329) (-1192.666) (-1197.537) -- 0:02:09
274500 -- (-1206.104) [-1197.478] (-1193.994) (-1191.492) * [-1188.173] (-1197.417) (-1195.141) (-1194.703) -- 0:02:09
275000 -- (-1191.841) [-1195.242] (-1191.866) (-1200.106) * (-1192.106) [-1195.225] (-1198.800) (-1191.681) -- 0:02:09
Average standard deviation of split frequencies: 0.003416
275500 -- [-1193.811] (-1194.196) (-1197.347) (-1203.893) * (-1193.954) [-1194.661] (-1193.372) (-1196.082) -- 0:02:08
276000 -- (-1189.086) (-1189.774) [-1191.538] (-1199.378) * (-1191.944) (-1194.491) (-1193.617) [-1196.800] -- 0:02:08
276500 -- (-1190.006) (-1190.083) (-1196.945) [-1196.130] * (-1199.142) (-1197.527) [-1195.092] (-1192.866) -- 0:02:08
277000 -- (-1195.227) (-1194.857) (-1193.581) [-1193.157] * (-1202.281) (-1201.856) (-1197.042) [-1196.177] -- 0:02:10
277500 -- (-1194.464) (-1191.715) [-1194.788] (-1199.218) * (-1195.565) (-1197.325) [-1193.838] (-1199.299) -- 0:02:10
278000 -- [-1191.034] (-1192.583) (-1191.000) (-1190.784) * (-1198.853) (-1202.760) [-1193.144] (-1190.315) -- 0:02:09
278500 -- (-1195.066) [-1191.541] (-1188.246) (-1191.993) * (-1193.950) [-1196.420] (-1200.398) (-1198.240) -- 0:02:09
279000 -- (-1197.639) (-1207.522) [-1189.304] (-1192.795) * (-1194.828) (-1193.354) (-1196.899) [-1191.918] -- 0:02:09
279500 -- [-1192.897] (-1193.686) (-1195.105) (-1204.162) * (-1191.203) (-1197.866) [-1192.206] (-1195.640) -- 0:02:08
280000 -- [-1194.585] (-1193.471) (-1189.628) (-1197.263) * [-1189.700] (-1194.448) (-1198.236) (-1195.621) -- 0:02:08
Average standard deviation of split frequencies: 0.006047
280500 -- (-1187.898) (-1196.834) [-1194.069] (-1198.821) * [-1194.603] (-1196.785) (-1194.743) (-1197.857) -- 0:02:08
281000 -- (-1193.714) (-1201.784) [-1189.537] (-1203.447) * (-1196.295) (-1192.770) [-1189.899] (-1200.031) -- 0:02:07
281500 -- (-1189.282) [-1194.815] (-1192.881) (-1189.790) * [-1192.973] (-1193.477) (-1196.048) (-1200.713) -- 0:02:07
282000 -- (-1190.954) (-1194.402) (-1192.258) [-1188.559] * [-1189.243] (-1189.806) (-1192.914) (-1200.682) -- 0:02:07
282500 -- (-1187.993) (-1191.560) [-1192.399] (-1191.932) * (-1197.891) (-1199.307) [-1190.843] (-1193.786) -- 0:02:09
283000 -- (-1194.912) (-1192.568) [-1188.056] (-1190.646) * (-1187.616) [-1190.171] (-1192.661) (-1193.118) -- 0:02:09
283500 -- (-1191.663) (-1194.887) (-1188.719) [-1192.582] * (-1196.720) (-1190.996) (-1191.638) [-1200.960] -- 0:02:08
284000 -- (-1190.101) (-1190.971) (-1193.692) [-1190.250] * (-1192.810) (-1198.316) (-1191.839) [-1195.808] -- 0:02:08
284500 -- (-1191.010) [-1190.613] (-1194.565) (-1198.501) * (-1193.895) [-1190.361] (-1196.069) (-1193.526) -- 0:02:08
285000 -- [-1200.650] (-1193.129) (-1188.546) (-1190.658) * [-1194.125] (-1192.296) (-1190.412) (-1197.829) -- 0:02:07
Average standard deviation of split frequencies: 0.005604
285500 -- (-1191.881) (-1204.704) (-1203.431) [-1190.052] * (-1194.817) (-1198.935) [-1195.824] (-1200.136) -- 0:02:07
286000 -- (-1187.636) [-1208.805] (-1202.388) (-1196.135) * (-1195.114) [-1190.532] (-1201.440) (-1192.610) -- 0:02:07
286500 -- [-1191.442] (-1198.713) (-1194.566) (-1194.344) * (-1194.400) [-1193.237] (-1199.573) (-1193.990) -- 0:02:07
287000 -- (-1199.616) (-1199.207) [-1199.490] (-1190.428) * (-1197.574) (-1203.408) (-1189.805) [-1195.580] -- 0:02:06
287500 -- [-1191.855] (-1198.711) (-1196.208) (-1200.553) * [-1190.686] (-1190.780) (-1196.638) (-1205.406) -- 0:02:06
288000 -- (-1192.693) (-1193.720) (-1202.343) [-1188.000] * [-1189.119] (-1193.548) (-1192.199) (-1199.235) -- 0:02:08
288500 -- [-1194.016] (-1191.626) (-1204.299) (-1194.991) * (-1194.275) (-1197.012) [-1194.336] (-1194.432) -- 0:02:08
289000 -- (-1197.694) (-1194.393) [-1197.131] (-1194.629) * (-1200.661) (-1197.935) [-1195.341] (-1193.683) -- 0:02:07
289500 -- (-1193.913) (-1198.560) (-1194.146) [-1201.501] * (-1198.948) (-1192.012) [-1189.334] (-1198.002) -- 0:02:07
290000 -- (-1201.847) (-1194.600) [-1190.887] (-1196.039) * (-1207.065) [-1193.314] (-1201.550) (-1194.936) -- 0:02:07
Average standard deviation of split frequencies: 0.004217
290500 -- (-1194.912) (-1198.665) (-1193.019) [-1195.851] * (-1197.008) [-1189.834] (-1189.009) (-1189.853) -- 0:02:07
291000 -- (-1208.142) (-1192.982) (-1202.984) [-1198.420] * (-1197.670) (-1189.787) [-1193.395] (-1192.674) -- 0:02:06
291500 -- (-1194.308) (-1199.224) (-1195.294) [-1192.374] * (-1191.102) (-1194.698) (-1193.590) [-1192.507] -- 0:02:06
292000 -- (-1191.806) (-1193.934) (-1195.977) [-1191.392] * (-1196.882) (-1193.413) [-1202.819] (-1196.549) -- 0:02:06
292500 -- (-1194.948) (-1204.572) (-1186.277) [-1193.022] * [-1196.417] (-1189.383) (-1198.888) (-1203.713) -- 0:02:05
293000 -- (-1200.201) (-1198.777) (-1191.140) [-1192.894] * (-1200.604) [-1188.477] (-1193.435) (-1203.683) -- 0:02:05
293500 -- (-1203.822) [-1197.168] (-1186.824) (-1197.934) * [-1198.223] (-1192.221) (-1196.450) (-1214.364) -- 0:02:07
294000 -- (-1194.958) (-1198.158) [-1193.287] (-1193.881) * (-1193.337) (-1194.783) [-1196.977] (-1207.213) -- 0:02:07
294500 -- [-1196.459] (-1201.399) (-1191.982) (-1194.731) * (-1196.006) (-1192.392) [-1190.488] (-1201.278) -- 0:02:06
295000 -- (-1195.493) (-1201.391) [-1190.030] (-1198.234) * (-1194.279) [-1192.372] (-1189.965) (-1201.441) -- 0:02:06
Average standard deviation of split frequencies: 0.005415
295500 -- (-1191.882) (-1198.857) (-1193.635) [-1191.894] * (-1195.629) (-1195.625) [-1196.390] (-1202.406) -- 0:02:06
296000 -- (-1197.972) (-1191.143) [-1192.722] (-1203.146) * [-1196.175] (-1192.755) (-1196.051) (-1205.992) -- 0:02:06
296500 -- (-1203.039) (-1195.878) (-1192.351) [-1195.517] * (-1195.868) (-1189.850) (-1194.954) [-1193.816] -- 0:02:05
297000 -- [-1192.166] (-1200.755) (-1191.808) (-1192.631) * (-1196.530) [-1192.009] (-1195.523) (-1197.813) -- 0:02:05
297500 -- (-1196.576) (-1199.025) (-1199.428) [-1197.803] * (-1196.606) [-1191.729] (-1194.742) (-1210.440) -- 0:02:05
298000 -- [-1192.666] (-1190.578) (-1198.688) (-1192.066) * (-1194.629) (-1196.579) [-1190.861] (-1205.971) -- 0:02:04
298500 -- (-1199.804) (-1194.075) (-1192.988) [-1193.605] * (-1198.757) [-1190.227] (-1191.188) (-1195.038) -- 0:02:04
299000 -- (-1198.295) (-1197.469) (-1193.154) [-1196.681] * (-1197.449) [-1192.575] (-1193.985) (-1198.142) -- 0:02:04
299500 -- [-1195.059] (-1194.729) (-1199.284) (-1199.574) * (-1199.476) (-1191.421) [-1192.315] (-1200.319) -- 0:02:06
300000 -- (-1196.840) (-1198.944) [-1193.318] (-1201.928) * (-1202.501) (-1195.385) [-1198.058] (-1191.754) -- 0:02:06
Average standard deviation of split frequencies: 0.006899
300500 -- [-1198.175] (-1198.999) (-1200.460) (-1197.058) * (-1195.981) [-1194.021] (-1192.368) (-1190.818) -- 0:02:05
301000 -- (-1205.823) [-1194.964] (-1194.588) (-1202.541) * [-1195.030] (-1195.108) (-1192.900) (-1192.672) -- 0:02:05
301500 -- (-1194.397) (-1197.804) [-1191.498] (-1192.169) * (-1191.103) (-1193.210) (-1195.044) [-1188.667] -- 0:02:05
302000 -- (-1197.427) (-1194.433) [-1191.092] (-1191.864) * (-1189.788) [-1187.618] (-1187.751) (-1194.801) -- 0:02:04
302500 -- [-1189.054] (-1193.590) (-1192.282) (-1190.833) * (-1194.860) (-1196.245) (-1205.298) [-1192.355] -- 0:02:04
303000 -- (-1199.568) [-1191.789] (-1192.397) (-1204.235) * (-1189.684) (-1193.297) [-1188.455] (-1191.756) -- 0:02:04
303500 -- (-1199.347) (-1197.132) [-1194.829] (-1197.749) * (-1194.727) (-1192.913) [-1193.731] (-1192.898) -- 0:02:03
304000 -- [-1192.798] (-1195.869) (-1189.178) (-1196.478) * [-1192.244] (-1193.225) (-1195.028) (-1202.929) -- 0:02:03
304500 -- (-1188.945) (-1192.419) (-1193.930) [-1198.191] * (-1192.165) [-1195.184] (-1193.181) (-1187.759) -- 0:02:03
305000 -- [-1191.059] (-1193.063) (-1200.321) (-1203.823) * (-1197.020) (-1195.282) (-1191.125) [-1198.819] -- 0:02:05
Average standard deviation of split frequencies: 0.006778
305500 -- (-1191.833) (-1192.824) [-1192.612] (-1198.857) * [-1195.494] (-1196.688) (-1192.914) (-1194.908) -- 0:02:05
306000 -- (-1188.666) (-1198.187) [-1196.395] (-1197.422) * [-1195.275] (-1191.779) (-1201.164) (-1194.749) -- 0:02:04
306500 -- [-1188.826] (-1197.972) (-1189.432) (-1196.093) * (-1206.105) (-1191.169) (-1190.889) [-1193.686] -- 0:02:04
307000 -- [-1190.982] (-1198.762) (-1191.430) (-1196.897) * (-1192.741) (-1193.614) [-1189.407] (-1193.804) -- 0:02:04
307500 -- (-1193.298) (-1191.792) (-1192.534) [-1200.880] * (-1190.551) [-1193.425] (-1192.889) (-1194.356) -- 0:02:03
308000 -- (-1198.271) (-1198.952) [-1192.552] (-1198.613) * (-1190.492) (-1188.992) [-1190.086] (-1217.327) -- 0:02:03
308500 -- (-1193.788) (-1194.844) [-1195.459] (-1192.888) * (-1195.948) (-1195.357) (-1200.036) [-1200.836] -- 0:02:03
309000 -- (-1191.336) [-1194.143] (-1197.626) (-1196.061) * (-1197.989) (-1192.682) (-1197.718) [-1194.731] -- 0:02:02
309500 -- (-1190.589) (-1197.239) (-1192.501) [-1191.892] * (-1196.534) (-1191.760) (-1189.084) [-1189.328] -- 0:02:02
310000 -- (-1192.085) (-1198.943) [-1197.089] (-1196.086) * (-1196.973) [-1195.962] (-1193.136) (-1194.365) -- 0:02:02
Average standard deviation of split frequencies: 0.006677
310500 -- [-1194.241] (-1196.285) (-1205.686) (-1193.816) * (-1191.963) (-1194.791) (-1199.768) [-1190.361] -- 0:02:04
311000 -- (-1190.265) (-1196.184) [-1191.297] (-1192.845) * (-1197.867) (-1189.961) [-1194.055] (-1198.066) -- 0:02:04
311500 -- (-1197.739) (-1196.836) (-1191.256) [-1191.808] * (-1202.482) [-1188.129] (-1188.369) (-1197.720) -- 0:02:03
312000 -- (-1195.325) (-1190.224) [-1188.550] (-1194.826) * (-1198.786) (-1196.721) [-1188.275] (-1198.128) -- 0:02:03
312500 -- (-1194.289) [-1199.375] (-1195.981) (-1190.730) * (-1197.912) [-1192.615] (-1195.722) (-1195.116) -- 0:02:03
313000 -- [-1195.168] (-1192.788) (-1212.138) (-1190.554) * (-1197.234) (-1195.503) [-1191.117] (-1194.683) -- 0:02:02
313500 -- (-1195.660) [-1199.893] (-1195.705) (-1192.130) * (-1195.374) (-1198.102) [-1189.004] (-1193.680) -- 0:02:02
314000 -- (-1196.142) [-1197.838] (-1199.858) (-1193.411) * (-1192.561) [-1196.960] (-1189.660) (-1191.863) -- 0:02:02
314500 -- [-1196.410] (-1195.975) (-1195.347) (-1200.405) * (-1196.258) (-1190.788) (-1192.856) [-1197.690] -- 0:02:02
315000 -- (-1196.448) (-1197.073) (-1202.363) [-1192.273] * (-1191.270) (-1189.822) [-1195.496] (-1195.217) -- 0:02:01
Average standard deviation of split frequencies: 0.007161
315500 -- (-1195.616) (-1197.109) [-1194.076] (-1191.880) * [-1189.062] (-1199.972) (-1196.326) (-1195.713) -- 0:02:01
316000 -- (-1195.794) [-1192.538] (-1203.180) (-1190.214) * (-1194.036) (-1189.513) [-1190.965] (-1197.908) -- 0:02:01
316500 -- (-1198.288) [-1194.434] (-1196.346) (-1193.521) * (-1198.306) (-1194.943) [-1189.697] (-1199.562) -- 0:02:03
317000 -- (-1200.270) (-1196.995) (-1197.115) [-1190.716] * (-1191.340) [-1187.349] (-1190.699) (-1200.152) -- 0:02:02
317500 -- [-1194.012] (-1193.395) (-1191.693) (-1205.946) * (-1189.083) [-1186.482] (-1192.328) (-1197.640) -- 0:02:02
318000 -- (-1196.008) (-1193.386) (-1196.112) [-1203.640] * (-1196.919) (-1196.484) [-1199.951] (-1192.330) -- 0:02:02
318500 -- (-1196.340) [-1190.069] (-1194.991) (-1195.686) * [-1192.480] (-1189.898) (-1191.418) (-1191.909) -- 0:02:01
319000 -- [-1196.003] (-1195.412) (-1190.747) (-1193.279) * (-1194.536) [-1199.484] (-1192.845) (-1196.402) -- 0:02:01
319500 -- [-1194.015] (-1195.386) (-1191.595) (-1203.649) * [-1191.500] (-1198.493) (-1194.618) (-1189.635) -- 0:02:01
320000 -- (-1193.302) (-1193.289) (-1203.528) [-1187.703] * [-1193.799] (-1193.739) (-1194.756) (-1193.962) -- 0:02:01
Average standard deviation of split frequencies: 0.007644
320500 -- (-1190.153) [-1191.661] (-1195.961) (-1198.177) * (-1195.568) [-1194.940] (-1194.319) (-1194.364) -- 0:02:00
321000 -- (-1195.722) [-1195.815] (-1193.044) (-1189.807) * (-1198.117) [-1189.926] (-1195.460) (-1191.855) -- 0:02:00
321500 -- (-1192.113) [-1193.741] (-1194.304) (-1196.629) * (-1191.630) (-1198.558) [-1190.475] (-1192.239) -- 0:02:00
322000 -- (-1199.069) (-1193.310) (-1202.242) [-1189.842] * (-1190.202) [-1192.079] (-1189.543) (-1191.651) -- 0:02:02
322500 -- (-1198.036) (-1197.195) [-1194.653] (-1198.264) * (-1200.625) (-1193.731) [-1188.733] (-1185.494) -- 0:02:01
323000 -- [-1198.342] (-1194.179) (-1193.761) (-1193.865) * (-1195.351) (-1196.352) (-1192.927) [-1193.410] -- 0:02:01
323500 -- (-1197.331) (-1192.646) [-1196.014] (-1193.686) * (-1192.446) (-1195.641) [-1187.473] (-1191.161) -- 0:02:01
324000 -- (-1192.053) (-1189.305) (-1197.032) [-1191.824] * (-1190.085) [-1194.034] (-1195.309) (-1196.861) -- 0:02:01
324500 -- (-1191.836) [-1192.707] (-1195.311) (-1189.946) * (-1194.818) [-1194.811] (-1191.295) (-1190.771) -- 0:02:00
325000 -- (-1193.808) (-1194.230) (-1197.146) [-1197.155] * (-1197.033) (-1193.542) [-1191.750] (-1194.444) -- 0:02:00
Average standard deviation of split frequencies: 0.009833
325500 -- (-1197.068) [-1189.258] (-1194.694) (-1193.445) * (-1199.304) [-1191.005] (-1192.386) (-1196.755) -- 0:02:00
326000 -- (-1191.298) (-1202.305) [-1194.813] (-1194.755) * [-1194.237] (-1197.774) (-1195.425) (-1196.540) -- 0:01:59
326500 -- [-1189.960] (-1194.237) (-1201.969) (-1201.888) * [-1189.954] (-1199.131) (-1191.877) (-1198.562) -- 0:01:59
327000 -- [-1193.056] (-1194.719) (-1191.255) (-1203.694) * [-1198.285] (-1197.143) (-1201.238) (-1195.710) -- 0:01:59
327500 -- (-1192.672) (-1200.915) [-1200.094] (-1196.020) * [-1195.326] (-1200.627) (-1195.883) (-1197.290) -- 0:02:01
328000 -- (-1191.214) (-1198.081) [-1196.314] (-1198.004) * (-1197.833) (-1203.803) [-1191.307] (-1194.080) -- 0:02:00
328500 -- (-1189.961) (-1197.650) (-1190.828) [-1195.302] * (-1192.089) (-1198.168) [-1187.851] (-1191.797) -- 0:02:00
329000 -- (-1192.802) [-1192.129] (-1192.968) (-1190.627) * (-1196.583) (-1197.365) (-1196.098) [-1194.583] -- 0:02:00
329500 -- [-1191.197] (-1192.360) (-1193.421) (-1191.572) * (-1199.034) (-1198.570) [-1189.807] (-1191.638) -- 0:02:00
330000 -- [-1188.255] (-1198.223) (-1198.458) (-1195.455) * (-1197.826) (-1203.170) (-1190.263) [-1192.872] -- 0:01:59
Average standard deviation of split frequencies: 0.010264
330500 -- [-1191.098] (-1193.376) (-1193.132) (-1193.376) * (-1194.690) [-1198.283] (-1199.398) (-1191.030) -- 0:01:59
331000 -- (-1193.781) [-1195.369] (-1189.882) (-1199.667) * [-1190.740] (-1197.701) (-1195.461) (-1193.044) -- 0:01:59
331500 -- [-1189.386] (-1193.968) (-1197.423) (-1191.960) * (-1190.827) [-1193.905] (-1191.899) (-1191.372) -- 0:01:58
332000 -- (-1200.351) [-1193.469] (-1194.855) (-1195.671) * (-1199.126) (-1196.018) [-1193.994] (-1193.697) -- 0:01:58
332500 -- [-1192.850] (-1195.274) (-1191.947) (-1198.483) * (-1191.398) (-1194.122) (-1188.683) [-1199.093] -- 0:01:58
333000 -- [-1187.785] (-1192.853) (-1196.921) (-1201.020) * (-1191.478) [-1196.092] (-1195.409) (-1197.461) -- 0:02:00
333500 -- [-1192.129] (-1193.837) (-1197.750) (-1199.784) * [-1191.191] (-1190.909) (-1190.160) (-1204.200) -- 0:01:59
334000 -- (-1198.544) (-1195.048) (-1198.111) [-1195.264] * (-1193.582) (-1195.307) [-1190.764] (-1192.660) -- 0:01:59
334500 -- (-1197.741) (-1201.670) [-1191.946] (-1197.292) * (-1205.409) [-1192.336] (-1202.786) (-1199.157) -- 0:01:59
335000 -- (-1192.720) (-1203.633) (-1197.024) [-1196.838] * (-1195.831) [-1189.904] (-1200.091) (-1192.746) -- 0:01:59
Average standard deviation of split frequencies: 0.010663
335500 -- (-1192.004) [-1192.669] (-1194.992) (-1196.909) * [-1196.262] (-1202.167) (-1197.444) (-1193.413) -- 0:01:58
336000 -- (-1200.086) (-1194.056) [-1190.242] (-1190.839) * (-1193.226) [-1193.379] (-1190.540) (-1192.548) -- 0:01:58
336500 -- (-1195.304) [-1195.269] (-1187.658) (-1189.361) * [-1191.869] (-1191.135) (-1197.461) (-1196.072) -- 0:01:58
337000 -- (-1202.901) (-1200.527) [-1198.874] (-1194.943) * (-1192.081) [-1200.410] (-1189.302) (-1198.570) -- 0:01:58
337500 -- [-1191.214] (-1202.227) (-1193.692) (-1190.854) * (-1196.149) (-1197.223) (-1196.316) [-1194.675] -- 0:01:57
338000 -- (-1195.738) (-1196.453) [-1187.734] (-1196.891) * [-1192.949] (-1194.811) (-1199.393) (-1191.906) -- 0:01:57
338500 -- (-1199.733) (-1196.702) (-1196.005) [-1194.738] * (-1192.924) (-1192.433) [-1201.866] (-1200.006) -- 0:01:59
339000 -- (-1196.332) [-1196.905] (-1193.805) (-1198.173) * (-1199.245) [-1194.165] (-1198.580) (-1198.251) -- 0:01:58
339500 -- (-1208.564) (-1190.029) (-1191.393) [-1191.331] * (-1198.702) (-1190.214) (-1206.334) [-1194.842] -- 0:01:58
340000 -- [-1196.125] (-1192.671) (-1193.822) (-1195.835) * (-1197.570) [-1195.391] (-1195.877) (-1205.004) -- 0:01:58
Average standard deviation of split frequencies: 0.011070
340500 -- [-1198.106] (-1195.580) (-1193.174) (-1187.720) * [-1191.828] (-1193.798) (-1201.735) (-1201.657) -- 0:01:58
341000 -- (-1192.152) [-1193.148] (-1189.914) (-1197.184) * (-1194.143) (-1190.268) (-1203.145) [-1188.321] -- 0:01:57
341500 -- (-1193.926) (-1196.427) [-1189.940] (-1190.470) * (-1195.891) [-1199.020] (-1198.109) (-1197.963) -- 0:01:57
342000 -- [-1192.330] (-1193.442) (-1193.864) (-1192.685) * (-1193.636) [-1193.225] (-1190.760) (-1200.044) -- 0:01:57
342500 -- (-1195.841) (-1187.519) (-1200.065) [-1189.000] * (-1193.322) [-1194.185] (-1192.364) (-1195.613) -- 0:01:57
343000 -- (-1198.498) (-1193.077) [-1195.254] (-1191.409) * (-1196.591) (-1194.381) [-1204.284] (-1195.961) -- 0:01:56
343500 -- (-1193.922) [-1194.837] (-1194.844) (-1201.476) * (-1196.834) (-1195.866) (-1195.876) [-1190.458] -- 0:01:56
344000 -- [-1191.405] (-1195.085) (-1195.127) (-1191.520) * (-1188.412) (-1197.406) (-1202.002) [-1193.072] -- 0:01:56
344500 -- (-1188.624) (-1190.809) (-1199.176) [-1192.520] * (-1196.958) [-1188.479] (-1194.334) (-1198.824) -- 0:01:57
345000 -- (-1187.269) [-1189.296] (-1197.778) (-1199.732) * (-1203.974) (-1190.945) (-1190.624) [-1194.059] -- 0:01:57
Average standard deviation of split frequencies: 0.010355
345500 -- (-1190.545) [-1193.727] (-1201.309) (-1193.873) * (-1196.657) (-1196.638) (-1195.751) [-1193.347] -- 0:01:57
346000 -- (-1198.162) [-1191.723] (-1200.159) (-1193.980) * (-1195.865) (-1197.565) [-1191.432] (-1202.240) -- 0:01:57
346500 -- (-1201.701) (-1188.424) [-1195.660] (-1192.024) * (-1193.666) [-1198.366] (-1196.356) (-1197.928) -- 0:01:56
347000 -- (-1197.521) (-1189.570) [-1192.856] (-1204.275) * (-1194.478) (-1195.009) (-1195.853) [-1193.753] -- 0:01:56
347500 -- (-1199.873) [-1193.055] (-1188.714) (-1201.840) * (-1191.384) (-1199.571) (-1194.855) [-1198.945] -- 0:01:56
348000 -- [-1191.479] (-1192.347) (-1194.247) (-1197.143) * (-1195.084) (-1197.452) [-1188.980] (-1197.773) -- 0:01:56
348500 -- (-1192.939) [-1191.175] (-1195.065) (-1195.802) * (-1196.842) (-1191.829) [-1189.661] (-1193.807) -- 0:01:55
349000 -- [-1191.041] (-1190.574) (-1202.082) (-1194.018) * (-1197.856) [-1192.962] (-1197.187) (-1193.059) -- 0:01:55
349500 -- (-1195.362) (-1190.476) (-1203.348) [-1191.046] * [-1192.479] (-1194.293) (-1196.065) (-1193.834) -- 0:01:55
350000 -- (-1192.017) (-1188.032) (-1196.083) [-1199.103] * (-1197.732) (-1203.108) [-1197.641] (-1192.970) -- 0:01:57
Average standard deviation of split frequencies: 0.010217
350500 -- (-1193.212) [-1193.579] (-1191.311) (-1197.977) * [-1194.556] (-1201.053) (-1191.659) (-1195.435) -- 0:01:56
351000 -- (-1193.903) (-1192.636) [-1198.602] (-1193.766) * (-1195.163) (-1198.373) (-1197.692) [-1192.272] -- 0:01:56
351500 -- [-1198.531] (-1192.850) (-1196.870) (-1198.239) * (-1194.900) (-1203.716) (-1198.066) [-1198.112] -- 0:01:56
352000 -- (-1194.535) (-1194.599) [-1196.177] (-1191.050) * (-1190.019) (-1196.654) [-1188.922] (-1190.172) -- 0:01:55
352500 -- [-1196.380] (-1203.960) (-1204.658) (-1194.619) * (-1193.397) (-1196.901) [-1189.490] (-1194.949) -- 0:01:55
353000 -- [-1197.075] (-1197.924) (-1195.113) (-1192.781) * (-1190.225) (-1197.617) [-1192.030] (-1196.225) -- 0:01:55
353500 -- (-1193.541) (-1195.629) [-1196.249] (-1200.039) * (-1195.626) (-1192.884) [-1201.270] (-1194.819) -- 0:01:55
354000 -- (-1193.080) (-1195.297) [-1195.823] (-1197.445) * (-1187.520) (-1197.329) (-1199.453) [-1193.341] -- 0:01:54
354500 -- (-1195.903) [-1200.243] (-1195.830) (-1201.053) * [-1194.031] (-1195.949) (-1193.952) (-1188.372) -- 0:01:54
355000 -- (-1196.089) (-1195.389) [-1193.558] (-1197.179) * (-1199.977) (-1204.030) (-1194.967) [-1192.445] -- 0:01:54
Average standard deviation of split frequencies: 0.009534
355500 -- (-1194.468) [-1192.232] (-1194.492) (-1203.084) * (-1191.514) [-1191.461] (-1198.142) (-1192.100) -- 0:01:56
356000 -- (-1204.843) (-1194.541) [-1190.764] (-1195.127) * (-1189.778) (-1190.898) [-1202.029] (-1199.498) -- 0:01:55
356500 -- (-1193.184) [-1195.650] (-1191.538) (-1203.594) * (-1200.071) [-1190.312] (-1204.227) (-1197.553) -- 0:01:55
357000 -- (-1196.823) (-1197.547) [-1197.563] (-1195.041) * (-1197.910) (-1195.058) [-1193.796] (-1199.873) -- 0:01:55
357500 -- (-1198.629) (-1196.492) (-1201.982) [-1196.539] * (-1193.223) (-1197.490) [-1192.493] (-1194.840) -- 0:01:55
358000 -- (-1194.377) (-1199.232) [-1193.219] (-1199.537) * (-1191.625) [-1198.956] (-1194.008) (-1207.023) -- 0:01:54
358500 -- (-1202.775) (-1193.636) (-1195.888) [-1193.958] * (-1193.341) (-1197.707) [-1189.394] (-1201.317) -- 0:01:54
359000 -- (-1196.471) (-1196.479) [-1190.684] (-1195.005) * (-1201.388) (-1198.557) (-1196.283) [-1202.352] -- 0:01:54
359500 -- (-1193.861) (-1193.953) [-1197.697] (-1197.332) * (-1192.757) (-1198.199) [-1199.805] (-1193.432) -- 0:01:54
360000 -- (-1198.335) [-1189.694] (-1194.222) (-1199.008) * (-1198.379) (-1196.831) (-1196.894) [-1194.413] -- 0:01:53
Average standard deviation of split frequencies: 0.008888
360500 -- (-1197.026) [-1199.738] (-1193.085) (-1195.934) * [-1200.460] (-1195.407) (-1199.717) (-1189.789) -- 0:01:53
361000 -- (-1200.922) (-1192.519) (-1190.184) [-1195.217] * [-1194.777] (-1200.817) (-1200.213) (-1194.259) -- 0:01:55
361500 -- [-1195.514] (-1197.520) (-1193.964) (-1203.457) * (-1199.069) (-1193.729) (-1197.038) [-1194.855] -- 0:01:54
362000 -- (-1191.041) [-1194.141] (-1191.915) (-1192.578) * (-1192.246) [-1189.196] (-1197.161) (-1201.221) -- 0:01:54
362500 -- (-1190.069) (-1193.767) (-1190.848) [-1194.652] * (-1192.234) [-1186.013] (-1193.171) (-1195.052) -- 0:01:54
363000 -- (-1189.836) [-1190.934] (-1188.616) (-1191.131) * [-1190.813] (-1193.871) (-1191.913) (-1197.677) -- 0:01:54
363500 -- (-1192.384) (-1194.494) (-1195.825) [-1190.988] * (-1198.849) [-1193.551] (-1191.749) (-1197.164) -- 0:01:53
364000 -- [-1195.439] (-1195.067) (-1192.971) (-1190.379) * [-1193.064] (-1192.858) (-1190.548) (-1201.545) -- 0:01:53
364500 -- (-1200.451) (-1194.250) (-1189.819) [-1190.045] * (-1193.393) [-1192.575] (-1200.245) (-1192.596) -- 0:01:53
365000 -- (-1193.349) [-1197.711] (-1190.352) (-1205.874) * (-1192.330) [-1190.630] (-1196.384) (-1190.190) -- 0:01:53
Average standard deviation of split frequencies: 0.008501
365500 -- (-1195.648) [-1195.805] (-1198.318) (-1201.834) * (-1203.516) (-1191.595) (-1196.787) [-1188.342] -- 0:01:52
366000 -- [-1194.064] (-1204.844) (-1193.377) (-1198.075) * (-1194.564) (-1197.695) (-1193.413) [-1196.938] -- 0:01:52
366500 -- (-1188.098) (-1199.014) [-1198.897] (-1200.571) * (-1197.128) (-1198.372) (-1197.669) [-1191.373] -- 0:01:52
367000 -- [-1189.337] (-1199.433) (-1196.817) (-1191.537) * [-1194.606] (-1198.991) (-1195.585) (-1202.499) -- 0:01:53
367500 -- (-1202.674) (-1197.398) [-1194.774] (-1192.071) * [-1190.743] (-1192.617) (-1196.415) (-1198.755) -- 0:01:53
368000 -- [-1190.691] (-1204.854) (-1190.729) (-1195.673) * [-1189.989] (-1194.814) (-1201.685) (-1201.087) -- 0:01:53
368500 -- (-1195.432) (-1203.255) [-1191.245] (-1194.179) * (-1194.288) [-1190.097] (-1196.526) (-1193.648) -- 0:01:53
369000 -- [-1194.246] (-1198.383) (-1199.174) (-1192.000) * [-1190.942] (-1191.954) (-1195.406) (-1197.115) -- 0:01:52
369500 -- (-1197.934) (-1195.196) [-1198.003] (-1200.941) * (-1189.587) (-1197.069) (-1197.931) [-1194.103] -- 0:01:52
370000 -- [-1194.099] (-1205.166) (-1197.904) (-1197.463) * (-1192.810) (-1203.013) [-1207.907] (-1196.627) -- 0:01:52
Average standard deviation of split frequencies: 0.009920
370500 -- (-1194.346) [-1200.206] (-1197.468) (-1191.174) * (-1192.875) (-1200.195) (-1196.263) [-1190.615] -- 0:01:52
371000 -- (-1199.517) (-1199.684) (-1196.082) [-1192.113] * (-1198.041) [-1198.741] (-1195.159) (-1198.023) -- 0:01:51
371500 -- (-1197.572) (-1197.874) [-1194.721] (-1198.619) * [-1192.127] (-1202.967) (-1194.383) (-1195.968) -- 0:01:51
372000 -- (-1199.969) (-1193.487) (-1197.902) [-1190.721] * [-1197.093] (-1200.209) (-1195.494) (-1196.870) -- 0:01:51
372500 -- (-1194.104) (-1195.322) [-1187.222] (-1192.466) * [-1195.053] (-1195.264) (-1201.269) (-1194.887) -- 0:01:52
373000 -- (-1196.303) [-1190.372] (-1195.947) (-1193.515) * (-1197.448) [-1195.203] (-1193.430) (-1191.088) -- 0:01:52
373500 -- (-1194.098) (-1201.278) [-1191.680] (-1196.890) * (-1192.667) (-1192.151) [-1190.945] (-1190.259) -- 0:01:52
374000 -- (-1195.019) [-1194.550] (-1190.995) (-1196.476) * (-1195.850) (-1195.332) [-1196.773] (-1191.466) -- 0:01:52
374500 -- [-1193.140] (-1195.373) (-1196.954) (-1190.481) * [-1195.142] (-1193.607) (-1190.885) (-1192.974) -- 0:01:51
375000 -- (-1194.205) (-1187.613) [-1193.465] (-1193.405) * (-1191.625) (-1195.654) [-1191.782] (-1197.400) -- 0:01:51
Average standard deviation of split frequencies: 0.009779
375500 -- (-1193.537) [-1187.911] (-1195.185) (-1198.383) * [-1192.222] (-1199.294) (-1196.406) (-1199.365) -- 0:01:51
376000 -- (-1193.052) [-1191.124] (-1194.330) (-1193.607) * (-1192.366) (-1194.706) [-1194.062] (-1196.675) -- 0:01:51
376500 -- (-1194.707) (-1192.053) [-1195.211] (-1190.015) * [-1191.381] (-1192.759) (-1199.827) (-1192.800) -- 0:01:50
377000 -- (-1194.890) (-1195.870) [-1195.508] (-1199.410) * [-1190.174] (-1192.832) (-1195.281) (-1192.650) -- 0:01:50
377500 -- (-1206.885) [-1189.250] (-1195.881) (-1196.906) * [-1190.729] (-1194.406) (-1192.789) (-1204.440) -- 0:01:50
378000 -- [-1187.857] (-1201.458) (-1195.614) (-1194.326) * (-1207.061) [-1192.613] (-1197.975) (-1200.891) -- 0:01:51
378500 -- [-1188.421] (-1188.980) (-1191.871) (-1194.279) * (-1189.731) [-1193.958] (-1193.187) (-1200.876) -- 0:01:51
379000 -- [-1198.953] (-1196.808) (-1193.758) (-1202.273) * (-1190.614) [-1197.751] (-1193.979) (-1198.685) -- 0:01:51
379500 -- (-1195.472) (-1190.261) [-1190.787] (-1196.169) * (-1187.679) (-1199.095) [-1192.984] (-1198.439) -- 0:01:51
380000 -- (-1194.707) (-1196.830) [-1196.477] (-1196.130) * (-1193.893) (-1195.986) (-1201.014) [-1189.514] -- 0:01:50
Average standard deviation of split frequencies: 0.008173
380500 -- [-1192.667] (-1195.546) (-1194.518) (-1194.939) * (-1204.420) [-1197.821] (-1190.702) (-1191.178) -- 0:01:50
381000 -- (-1196.639) (-1192.283) (-1190.522) [-1190.183] * (-1189.773) [-1193.342] (-1195.940) (-1191.238) -- 0:01:50
381500 -- (-1194.633) (-1189.652) [-1190.676] (-1198.848) * [-1192.317] (-1192.336) (-1197.118) (-1196.527) -- 0:01:50
382000 -- (-1195.974) (-1198.627) [-1198.422] (-1198.585) * (-1188.484) (-1195.221) (-1192.239) [-1185.369] -- 0:01:50
382500 -- (-1194.857) [-1194.409] (-1195.647) (-1200.361) * (-1194.616) [-1191.696] (-1197.373) (-1191.252) -- 0:01:49
383000 -- [-1195.566] (-1187.776) (-1191.881) (-1197.014) * [-1191.363] (-1191.874) (-1199.775) (-1195.524) -- 0:01:49
383500 -- (-1189.445) [-1189.895] (-1191.874) (-1189.959) * (-1193.902) [-1191.543] (-1191.667) (-1195.625) -- 0:01:50
384000 -- (-1195.474) (-1194.743) (-1195.553) [-1197.475] * [-1194.011] (-1195.328) (-1195.610) (-1197.165) -- 0:01:50
384500 -- (-1191.372) [-1190.960] (-1189.332) (-1199.369) * (-1193.700) (-1196.061) [-1197.037] (-1195.396) -- 0:01:50
385000 -- (-1191.229) (-1192.546) [-1193.745] (-1207.055) * (-1199.852) [-1190.662] (-1204.031) (-1191.534) -- 0:01:50
Average standard deviation of split frequencies: 0.007083
385500 -- (-1187.684) (-1191.885) (-1194.295) [-1190.322] * (-1196.911) [-1196.639] (-1190.665) (-1192.203) -- 0:01:49
386000 -- (-1192.976) (-1193.325) [-1189.407] (-1193.915) * (-1206.327) [-1189.752] (-1197.891) (-1196.573) -- 0:01:49
386500 -- [-1195.407] (-1191.775) (-1188.586) (-1191.350) * (-1195.646) [-1195.645] (-1192.909) (-1193.898) -- 0:01:49
387000 -- (-1196.507) (-1192.339) (-1198.072) [-1191.363] * (-1194.966) [-1195.436] (-1191.398) (-1189.132) -- 0:01:49
387500 -- (-1196.955) [-1194.622] (-1191.107) (-1189.741) * [-1198.843] (-1198.678) (-1194.271) (-1197.920) -- 0:01:49
388000 -- (-1196.225) (-1199.112) [-1189.978] (-1198.357) * (-1198.219) (-1197.092) [-1187.531] (-1193.433) -- 0:01:48
388500 -- (-1196.180) (-1196.741) [-1189.746] (-1195.357) * (-1195.134) (-1202.331) (-1190.363) [-1192.793] -- 0:01:48
389000 -- [-1189.462] (-1191.952) (-1193.337) (-1189.043) * (-1198.895) [-1194.533] (-1197.641) (-1192.494) -- 0:01:49
389500 -- [-1196.873] (-1193.643) (-1195.576) (-1190.197) * (-1195.904) (-1191.940) (-1192.961) [-1194.076] -- 0:01:49
390000 -- [-1195.103] (-1188.549) (-1194.621) (-1197.735) * (-1202.913) (-1198.520) (-1196.976) [-1191.660] -- 0:01:49
Average standard deviation of split frequencies: 0.005551
390500 -- (-1189.784) [-1192.442] (-1196.724) (-1193.003) * (-1194.755) (-1191.132) (-1194.461) [-1190.058] -- 0:01:49
391000 -- [-1189.147] (-1190.164) (-1195.423) (-1194.733) * (-1196.358) (-1190.898) (-1189.396) [-1195.448] -- 0:01:49
391500 -- (-1196.644) (-1196.850) (-1198.753) [-1190.856] * (-1199.605) [-1210.294] (-1194.028) (-1195.065) -- 0:01:48
392000 -- (-1196.340) (-1188.557) (-1199.748) [-1192.615] * [-1198.179] (-1198.238) (-1192.346) (-1190.793) -- 0:01:48
392500 -- (-1198.481) (-1194.713) (-1194.598) [-1192.961] * (-1198.039) (-1193.383) (-1196.167) [-1192.894] -- 0:01:48
393000 -- (-1193.701) (-1193.847) (-1196.592) [-1194.553] * [-1189.740] (-1196.646) (-1195.289) (-1193.100) -- 0:01:48
393500 -- (-1193.017) (-1197.322) [-1192.441] (-1195.437) * (-1197.626) (-1189.184) [-1194.276] (-1193.317) -- 0:01:47
394000 -- (-1197.930) (-1195.322) [-1203.308] (-1193.405) * (-1192.193) [-1198.687] (-1193.151) (-1193.085) -- 0:01:47
394500 -- (-1201.445) [-1187.146] (-1195.177) (-1192.646) * [-1193.699] (-1193.184) (-1191.761) (-1196.135) -- 0:01:48
395000 -- (-1194.798) (-1196.129) [-1198.191] (-1191.753) * [-1194.006] (-1198.516) (-1195.409) (-1194.877) -- 0:01:48
Average standard deviation of split frequencies: 0.006904
395500 -- (-1200.240) [-1193.769] (-1199.722) (-1192.371) * (-1192.236) (-1199.033) (-1192.116) [-1196.934] -- 0:01:48
396000 -- [-1193.071] (-1197.703) (-1195.999) (-1192.908) * (-1203.034) (-1195.689) (-1192.151) [-1194.176] -- 0:01:48
396500 -- (-1198.523) (-1195.769) [-1193.736] (-1197.507) * (-1199.207) (-1202.430) [-1190.565] (-1194.986) -- 0:01:48
397000 -- (-1204.029) (-1200.657) [-1190.179] (-1193.540) * (-1200.573) (-1210.193) [-1199.482] (-1194.226) -- 0:01:47
397500 -- [-1193.050] (-1201.623) (-1190.491) (-1199.174) * (-1197.427) (-1202.656) [-1195.460] (-1193.006) -- 0:01:47
398000 -- (-1191.107) (-1199.093) [-1192.851] (-1191.366) * (-1193.509) (-1198.285) [-1188.667] (-1197.755) -- 0:01:47
398500 -- (-1199.057) (-1202.664) (-1196.951) [-1199.611] * (-1196.468) (-1198.497) (-1191.540) [-1195.863] -- 0:01:47
399000 -- (-1195.002) (-1200.210) [-1199.202] (-1190.730) * (-1195.840) (-1200.191) [-1194.600] (-1195.303) -- 0:01:46
399500 -- (-1192.832) (-1192.648) [-1195.628] (-1187.282) * (-1194.507) [-1192.589] (-1192.602) (-1201.039) -- 0:01:46
400000 -- [-1191.761] (-1193.604) (-1194.723) (-1203.165) * (-1197.148) (-1200.332) [-1190.633] (-1197.485) -- 0:01:48
Average standard deviation of split frequencies: 0.007765
400500 -- [-1187.211] (-1198.209) (-1187.168) (-1197.985) * (-1197.064) (-1194.773) [-1194.379] (-1192.375) -- 0:01:47
401000 -- [-1190.753] (-1191.390) (-1196.267) (-1200.005) * (-1193.607) (-1192.975) (-1195.677) [-1192.182] -- 0:01:47
401500 -- (-1199.522) [-1193.415] (-1191.268) (-1195.464) * (-1199.032) (-1201.992) [-1196.411] (-1196.965) -- 0:01:47
402000 -- (-1193.391) (-1199.642) [-1190.833] (-1192.911) * (-1202.815) (-1204.022) (-1196.316) [-1193.700] -- 0:01:47
402500 -- (-1193.731) [-1193.071] (-1193.814) (-1189.320) * (-1198.717) (-1198.691) (-1192.423) [-1197.187] -- 0:01:46
403000 -- [-1188.045] (-1192.802) (-1194.590) (-1207.227) * (-1195.447) (-1198.072) [-1198.095] (-1206.021) -- 0:01:46
403500 -- [-1190.814] (-1193.345) (-1197.538) (-1195.614) * [-1196.766] (-1201.058) (-1195.884) (-1204.579) -- 0:01:46
404000 -- [-1191.114] (-1196.453) (-1189.097) (-1187.391) * (-1197.113) [-1203.181] (-1189.884) (-1203.654) -- 0:01:46
404500 -- (-1200.153) [-1190.206] (-1194.912) (-1190.558) * (-1194.293) (-1198.756) [-1191.598] (-1210.073) -- 0:01:45
405000 -- [-1191.198] (-1195.953) (-1192.097) (-1195.192) * (-1193.597) (-1204.454) [-1189.847] (-1198.447) -- 0:01:45
Average standard deviation of split frequencies: 0.008592
405500 -- (-1201.755) (-1196.055) [-1196.805] (-1193.740) * (-1189.302) (-1199.177) [-1188.053] (-1193.394) -- 0:01:47
406000 -- (-1192.544) (-1195.942) (-1190.935) [-1191.538] * (-1194.202) (-1195.782) (-1194.619) [-1188.942] -- 0:01:46
406500 -- [-1191.574] (-1202.221) (-1194.699) (-1191.729) * (-1194.236) (-1195.753) (-1190.932) [-1191.992] -- 0:01:46
407000 -- (-1203.609) [-1191.419] (-1195.151) (-1200.851) * [-1191.308] (-1190.233) (-1191.588) (-1192.067) -- 0:01:46
407500 -- (-1194.780) (-1191.480) [-1194.606] (-1192.268) * (-1192.273) [-1201.483] (-1191.078) (-1195.619) -- 0:01:46
408000 -- (-1195.360) (-1194.061) [-1197.138] (-1197.627) * (-1199.752) [-1189.615] (-1192.466) (-1195.368) -- 0:01:45
408500 -- (-1191.559) [-1191.166] (-1199.782) (-1205.333) * (-1198.070) [-1191.283] (-1192.209) (-1199.389) -- 0:01:45
409000 -- (-1195.769) (-1193.938) (-1200.964) [-1192.710] * (-1191.789) (-1199.718) (-1202.310) [-1191.861] -- 0:01:45
409500 -- (-1191.017) (-1195.988) (-1198.109) [-1193.274] * [-1196.015] (-1193.833) (-1198.485) (-1196.436) -- 0:01:45
410000 -- (-1201.493) [-1190.857] (-1199.748) (-1193.254) * [-1194.529] (-1194.956) (-1196.777) (-1192.242) -- 0:01:45
Average standard deviation of split frequencies: 0.008724
410500 -- (-1203.642) (-1189.883) [-1197.632] (-1189.499) * [-1188.575] (-1196.789) (-1197.004) (-1200.966) -- 0:01:44
411000 -- (-1193.039) (-1190.744) (-1197.921) [-1194.486] * (-1192.196) (-1199.803) [-1192.081] (-1196.565) -- 0:01:46
411500 -- [-1197.517] (-1194.866) (-1197.222) (-1196.417) * (-1200.526) (-1192.920) [-1188.796] (-1195.973) -- 0:01:45
412000 -- (-1192.640) [-1196.819] (-1195.595) (-1192.704) * (-1198.636) (-1197.419) (-1190.255) [-1197.189] -- 0:01:45
412500 -- [-1193.434] (-1196.736) (-1204.370) (-1194.956) * (-1200.020) [-1190.550] (-1199.902) (-1194.244) -- 0:01:45
413000 -- (-1190.344) (-1191.275) (-1198.476) [-1193.175] * (-1198.958) (-1188.049) (-1194.923) [-1193.629] -- 0:01:45
413500 -- (-1191.545) [-1194.955] (-1201.128) (-1192.453) * (-1194.759) [-1194.050] (-1192.237) (-1198.369) -- 0:01:44
414000 -- [-1191.855] (-1198.515) (-1196.326) (-1194.798) * (-1191.795) (-1192.866) [-1196.146] (-1200.077) -- 0:01:44
414500 -- (-1192.541) (-1196.760) [-1192.805] (-1191.721) * (-1195.635) [-1193.463] (-1197.199) (-1198.817) -- 0:01:44
415000 -- [-1190.077] (-1200.816) (-1193.283) (-1190.394) * (-1195.202) [-1196.520] (-1203.157) (-1197.847) -- 0:01:44
Average standard deviation of split frequencies: 0.008612
415500 -- (-1191.279) (-1192.567) [-1193.745] (-1197.499) * (-1195.169) [-1193.453] (-1190.627) (-1199.789) -- 0:01:44
416000 -- (-1198.222) [-1196.450] (-1200.078) (-1199.973) * (-1206.311) (-1194.573) [-1191.848] (-1197.907) -- 0:01:45
416500 -- (-1195.186) (-1197.185) [-1190.727] (-1197.944) * (-1194.595) (-1194.277) [-1188.045] (-1193.809) -- 0:01:45
417000 -- (-1192.692) (-1190.630) [-1191.722] (-1191.255) * [-1197.369] (-1205.971) (-1196.468) (-1194.140) -- 0:01:44
417500 -- (-1201.260) [-1192.444] (-1194.416) (-1194.360) * (-1194.991) (-1189.773) [-1194.682] (-1191.875) -- 0:01:44
418000 -- (-1197.508) [-1192.665] (-1190.686) (-1193.012) * (-1198.755) (-1193.330) [-1198.318] (-1195.296) -- 0:01:44
418500 -- (-1200.144) (-1195.213) [-1192.179] (-1194.453) * (-1194.854) (-1197.967) (-1195.034) [-1195.231] -- 0:01:44
419000 -- (-1203.560) (-1196.390) (-1189.967) [-1192.314] * (-1194.829) (-1194.215) [-1188.387] (-1192.103) -- 0:01:43
419500 -- (-1199.209) (-1191.415) (-1199.071) [-1192.284] * (-1197.807) (-1193.708) [-1194.990] (-1192.314) -- 0:01:43
420000 -- (-1201.741) (-1192.247) (-1190.441) [-1190.919] * (-1197.154) (-1192.657) [-1191.421] (-1190.051) -- 0:01:43
Average standard deviation of split frequencies: 0.007620
420500 -- (-1201.305) (-1195.441) [-1194.014] (-1192.165) * (-1191.690) (-1188.039) [-1191.775] (-1190.987) -- 0:01:43
421000 -- (-1190.943) (-1198.369) (-1195.962) [-1190.692] * (-1189.866) [-1195.783] (-1195.442) (-1195.254) -- 0:01:43
421500 -- (-1200.071) (-1194.640) [-1196.264] (-1190.376) * [-1189.576] (-1195.646) (-1195.133) (-1199.493) -- 0:01:42
422000 -- [-1193.338] (-1193.273) (-1199.050) (-1201.768) * [-1198.900] (-1199.003) (-1191.791) (-1196.770) -- 0:01:44
422500 -- (-1192.718) [-1195.513] (-1201.609) (-1194.368) * (-1187.031) (-1202.097) [-1191.891] (-1201.102) -- 0:01:43
423000 -- (-1199.724) (-1191.664) (-1209.620) [-1196.303] * (-1196.172) (-1191.806) [-1196.246] (-1195.791) -- 0:01:43
423500 -- (-1191.848) [-1193.480] (-1193.810) (-1190.258) * (-1195.221) (-1195.954) (-1193.336) [-1192.276] -- 0:01:43
424000 -- [-1191.747] (-1197.117) (-1194.582) (-1200.335) * (-1194.317) [-1196.788] (-1192.035) (-1190.574) -- 0:01:43
424500 -- (-1192.508) (-1202.129) (-1193.046) [-1190.444] * [-1190.992] (-1195.443) (-1195.045) (-1188.146) -- 0:01:43
425000 -- (-1196.994) (-1208.918) [-1192.010] (-1190.020) * (-1194.026) [-1193.573] (-1207.226) (-1192.902) -- 0:01:42
Average standard deviation of split frequencies: 0.007082
425500 -- (-1197.805) (-1199.073) [-1197.239] (-1188.323) * (-1198.365) [-1189.683] (-1202.707) (-1193.716) -- 0:01:42
426000 -- (-1196.850) (-1199.075) [-1197.207] (-1196.964) * (-1193.458) (-1195.219) (-1197.909) [-1194.299] -- 0:01:42
426500 -- [-1194.280] (-1193.739) (-1196.317) (-1192.208) * (-1200.798) (-1190.155) (-1197.171) [-1188.247] -- 0:01:42
427000 -- (-1192.627) (-1194.877) (-1202.463) [-1195.225] * (-1195.583) [-1192.096] (-1194.569) (-1207.580) -- 0:01:41
427500 -- [-1191.356] (-1198.688) (-1196.335) (-1188.957) * [-1192.955] (-1191.992) (-1193.985) (-1212.889) -- 0:01:43
428000 -- [-1189.129] (-1195.378) (-1194.027) (-1190.592) * (-1195.882) (-1194.198) (-1196.033) [-1193.107] -- 0:01:42
428500 -- (-1193.826) [-1200.351] (-1195.045) (-1194.502) * (-1195.956) (-1194.772) (-1199.487) [-1188.604] -- 0:01:42
429000 -- (-1201.216) (-1193.184) [-1197.785] (-1192.788) * (-1196.896) [-1190.383] (-1193.116) (-1200.472) -- 0:01:42
429500 -- (-1200.999) (-1197.237) (-1198.091) [-1193.539] * (-1198.794) (-1195.364) [-1192.124] (-1191.505) -- 0:01:42
430000 -- (-1193.797) [-1190.039] (-1196.818) (-1200.678) * (-1197.126) (-1192.509) (-1193.162) [-1192.856] -- 0:01:42
Average standard deviation of split frequencies: 0.006130
430500 -- (-1201.669) (-1191.690) (-1199.268) [-1200.514] * (-1196.026) (-1193.849) (-1200.475) [-1192.877] -- 0:01:41
431000 -- (-1195.040) (-1192.224) (-1190.931) [-1194.012] * (-1198.093) (-1199.326) (-1197.702) [-1190.523] -- 0:01:41
431500 -- (-1195.630) [-1193.632] (-1188.822) (-1190.765) * (-1196.449) (-1194.754) (-1195.177) [-1191.162] -- 0:01:41
432000 -- [-1196.042] (-1198.274) (-1193.457) (-1189.757) * (-1190.504) (-1188.957) [-1190.996] (-1189.047) -- 0:01:41
432500 -- (-1192.859) (-1198.191) (-1189.941) [-1190.230] * [-1196.897] (-1205.708) (-1192.902) (-1191.365) -- 0:01:41
433000 -- (-1193.912) (-1205.677) [-1188.037] (-1194.890) * [-1189.907] (-1193.886) (-1191.559) (-1191.927) -- 0:01:42
433500 -- (-1194.215) (-1203.907) (-1198.822) [-1191.904] * (-1191.979) [-1193.932] (-1196.196) (-1197.486) -- 0:01:41
434000 -- (-1196.638) (-1193.020) (-1190.581) [-1192.631] * (-1201.295) (-1190.666) (-1197.281) [-1190.844] -- 0:01:41
434500 -- (-1195.637) (-1188.275) (-1202.171) [-1194.246] * [-1195.208] (-1192.276) (-1201.916) (-1190.551) -- 0:01:41
435000 -- (-1200.605) [-1195.949] (-1200.606) (-1191.309) * (-1195.765) (-1203.924) [-1194.827] (-1190.207) -- 0:01:41
Average standard deviation of split frequencies: 0.005622
435500 -- (-1195.559) (-1197.205) [-1193.552] (-1194.002) * (-1192.448) (-1191.754) (-1196.817) [-1189.983] -- 0:01:41
436000 -- (-1195.811) (-1191.223) [-1190.566] (-1189.850) * [-1191.107] (-1194.314) (-1197.807) (-1192.260) -- 0:01:40
436500 -- (-1194.846) (-1194.661) (-1192.013) [-1188.623] * [-1201.398] (-1195.468) (-1200.719) (-1202.142) -- 0:01:40
437000 -- [-1194.683] (-1197.791) (-1191.234) (-1193.059) * (-1194.994) [-1201.655] (-1199.820) (-1195.513) -- 0:01:40
437500 -- (-1193.099) [-1191.006] (-1193.206) (-1194.796) * (-1199.571) (-1203.664) (-1195.625) [-1195.782] -- 0:01:40
438000 -- (-1189.694) (-1192.538) [-1191.309] (-1197.181) * (-1197.222) (-1199.483) [-1199.731] (-1194.073) -- 0:01:40
438500 -- (-1194.469) (-1194.613) [-1188.567] (-1194.476) * (-1197.644) (-1191.380) [-1198.318] (-1196.627) -- 0:01:39
439000 -- [-1192.633] (-1188.656) (-1189.302) (-1194.566) * (-1197.623) (-1190.547) [-1197.281] (-1195.954) -- 0:01:40
439500 -- [-1191.609] (-1196.501) (-1201.249) (-1194.689) * (-1206.728) (-1192.719) [-1190.061] (-1195.409) -- 0:01:40
440000 -- (-1189.650) (-1205.833) (-1201.660) [-1191.175] * (-1194.394) [-1197.730] (-1203.457) (-1192.827) -- 0:01:40
Average standard deviation of split frequencies: 0.005991
440500 -- [-1193.606] (-1193.830) (-1199.470) (-1191.999) * (-1200.836) (-1210.584) (-1195.825) [-1194.807] -- 0:01:40
441000 -- (-1196.278) (-1192.348) (-1198.882) [-1189.297] * (-1204.756) [-1192.754] (-1195.373) (-1191.370) -- 0:01:40
441500 -- (-1194.987) [-1190.932] (-1205.506) (-1190.347) * (-1203.010) [-1191.989] (-1193.096) (-1190.259) -- 0:01:39
442000 -- [-1191.331] (-1189.525) (-1192.943) (-1194.441) * (-1206.794) (-1193.201) [-1193.784] (-1196.513) -- 0:01:39
442500 -- [-1195.448] (-1197.800) (-1198.413) (-1191.305) * [-1202.440] (-1192.634) (-1195.883) (-1195.673) -- 0:01:39
443000 -- [-1193.397] (-1201.075) (-1195.259) (-1196.862) * (-1198.732) (-1188.126) [-1203.264] (-1190.808) -- 0:01:39
443500 -- (-1195.659) (-1197.293) [-1194.155] (-1190.838) * [-1194.778] (-1195.830) (-1199.019) (-1193.281) -- 0:01:39
444000 -- (-1190.245) (-1193.030) (-1201.360) [-1189.986] * (-1199.806) [-1195.842] (-1199.526) (-1196.164) -- 0:01:38
444500 -- (-1190.012) [-1191.776] (-1200.930) (-1198.515) * (-1198.586) (-1197.092) [-1197.305] (-1198.974) -- 0:01:39
445000 -- (-1191.532) (-1194.377) (-1195.102) [-1194.504] * [-1202.344] (-1194.266) (-1194.577) (-1196.835) -- 0:01:39
Average standard deviation of split frequencies: 0.005073
445500 -- (-1197.229) (-1194.798) [-1190.039] (-1198.603) * (-1199.677) (-1188.517) (-1193.319) [-1192.229] -- 0:01:39
446000 -- (-1193.228) (-1194.484) (-1197.211) [-1192.100] * (-1200.556) (-1189.185) [-1192.495] (-1199.314) -- 0:01:39
446500 -- (-1191.195) (-1194.904) [-1195.448] (-1199.249) * (-1194.526) [-1189.727] (-1194.524) (-1198.852) -- 0:01:39
447000 -- (-1193.091) [-1197.920] (-1192.072) (-1192.046) * (-1194.159) [-1196.062] (-1197.338) (-1199.247) -- 0:01:38
447500 -- (-1202.830) [-1193.110] (-1202.627) (-1198.539) * [-1191.689] (-1190.309) (-1198.760) (-1191.413) -- 0:01:38
448000 -- (-1196.574) [-1189.327] (-1196.318) (-1199.962) * (-1194.921) (-1194.735) (-1199.300) [-1195.730] -- 0:01:38
448500 -- (-1193.051) (-1193.567) (-1194.562) [-1194.548] * (-1191.372) [-1190.031] (-1194.495) (-1192.537) -- 0:01:38
449000 -- [-1196.621] (-1194.436) (-1203.909) (-1194.224) * (-1192.740) (-1196.742) [-1190.760] (-1208.795) -- 0:01:38
449500 -- [-1199.862] (-1200.456) (-1204.302) (-1189.555) * (-1188.754) [-1194.329] (-1196.194) (-1197.054) -- 0:01:37
450000 -- (-1199.245) (-1195.852) (-1191.930) [-1197.899] * (-1194.803) (-1196.615) (-1200.458) [-1198.361] -- 0:01:37
Average standard deviation of split frequencies: 0.003975
450500 -- [-1191.167] (-1193.492) (-1192.867) (-1194.810) * [-1188.431] (-1198.682) (-1192.594) (-1194.370) -- 0:01:38
451000 -- (-1193.595) (-1192.736) [-1191.167] (-1197.849) * [-1195.862] (-1197.436) (-1192.278) (-1198.990) -- 0:01:38
451500 -- (-1192.396) (-1194.803) (-1199.810) [-1200.477] * (-1193.587) (-1194.749) [-1194.519] (-1196.081) -- 0:01:38
452000 -- (-1193.952) (-1199.233) (-1195.506) [-1189.320] * [-1194.917] (-1192.833) (-1190.083) (-1198.971) -- 0:01:38
452500 -- (-1192.906) (-1196.969) (-1192.185) [-1186.458] * (-1195.947) [-1194.108] (-1192.251) (-1191.877) -- 0:01:38
453000 -- (-1196.319) (-1196.282) [-1197.785] (-1193.716) * (-1194.481) (-1198.420) (-1198.843) [-1192.407] -- 0:01:37
453500 -- [-1193.930] (-1194.439) (-1196.974) (-1191.023) * (-1199.956) [-1192.266] (-1189.757) (-1194.579) -- 0:01:37
454000 -- (-1195.756) [-1202.974] (-1192.758) (-1192.816) * (-1194.402) (-1193.813) [-1188.325] (-1194.274) -- 0:01:37
454500 -- (-1192.186) (-1199.606) [-1194.728] (-1191.122) * (-1191.131) (-1194.476) [-1192.036] (-1197.786) -- 0:01:37
455000 -- [-1196.555] (-1196.074) (-1192.133) (-1192.376) * (-1196.571) [-1194.300] (-1195.298) (-1196.474) -- 0:01:37
Average standard deviation of split frequencies: 0.004135
455500 -- (-1196.377) (-1190.600) (-1191.190) [-1188.731] * (-1195.258) (-1192.885) (-1190.914) [-1192.724] -- 0:01:36
456000 -- (-1200.205) (-1195.742) [-1190.512] (-1191.184) * (-1196.313) [-1189.512] (-1196.538) (-1194.531) -- 0:01:37
456500 -- [-1196.030] (-1192.969) (-1194.802) (-1194.696) * (-1193.632) (-1189.413) [-1193.593] (-1201.043) -- 0:01:37
457000 -- (-1193.832) (-1199.309) [-1190.812] (-1192.156) * (-1193.942) [-1197.077] (-1187.659) (-1194.829) -- 0:01:37
457500 -- (-1190.795) (-1197.782) [-1195.917] (-1189.386) * [-1199.369] (-1195.558) (-1190.804) (-1196.042) -- 0:01:37
458000 -- (-1193.203) [-1195.306] (-1195.670) (-1189.496) * (-1199.477) (-1193.272) [-1197.549] (-1193.092) -- 0:01:37
458500 -- (-1189.985) (-1195.106) (-1197.747) [-1190.173] * (-1194.560) [-1196.585] (-1188.884) (-1200.404) -- 0:01:36
459000 -- (-1189.548) (-1189.521) [-1195.855] (-1188.221) * (-1202.550) (-1191.775) [-1191.822] (-1188.787) -- 0:01:36
459500 -- (-1193.566) (-1190.949) [-1193.011] (-1190.437) * (-1191.496) [-1191.731] (-1193.327) (-1195.142) -- 0:01:36
460000 -- [-1193.696] (-1197.256) (-1199.497) (-1191.318) * (-1192.432) (-1190.311) (-1195.844) [-1193.192] -- 0:01:36
Average standard deviation of split frequencies: 0.004503
460500 -- (-1188.601) [-1200.859] (-1196.938) (-1195.287) * (-1195.193) (-1194.270) (-1194.272) [-1191.581] -- 0:01:36
461000 -- (-1189.833) [-1187.261] (-1197.808) (-1191.948) * (-1195.663) (-1196.094) [-1201.434] (-1190.994) -- 0:01:35
461500 -- (-1190.333) (-1190.662) (-1204.105) [-1198.790] * (-1197.409) (-1192.639) [-1190.001] (-1194.088) -- 0:01:36
462000 -- (-1192.190) [-1195.636] (-1202.090) (-1198.574) * [-1201.042] (-1192.865) (-1193.108) (-1193.323) -- 0:01:36
462500 -- [-1188.615] (-1194.658) (-1195.807) (-1197.334) * (-1196.610) (-1188.213) [-1194.883] (-1200.727) -- 0:01:36
463000 -- [-1188.367] (-1195.369) (-1198.128) (-1191.415) * (-1192.954) [-1193.407] (-1196.105) (-1192.960) -- 0:01:36
463500 -- [-1191.233] (-1197.792) (-1190.397) (-1189.490) * (-1197.123) (-1194.080) [-1188.937] (-1190.104) -- 0:01:36
464000 -- (-1196.197) (-1199.215) [-1195.266] (-1194.916) * [-1203.772] (-1188.589) (-1196.189) (-1193.992) -- 0:01:35
464500 -- [-1188.756] (-1199.599) (-1192.945) (-1198.516) * (-1193.893) [-1190.493] (-1188.970) (-1198.677) -- 0:01:35
465000 -- (-1189.096) (-1190.013) [-1191.144] (-1194.717) * (-1201.401) [-1188.988] (-1196.579) (-1191.905) -- 0:01:35
Average standard deviation of split frequencies: 0.004451
465500 -- (-1191.718) (-1190.691) [-1194.685] (-1194.150) * [-1193.990] (-1192.762) (-1192.573) (-1191.425) -- 0:01:35
466000 -- (-1193.721) (-1196.938) [-1193.403] (-1190.906) * (-1196.509) (-1196.931) (-1195.109) [-1191.406] -- 0:01:35
466500 -- [-1191.978] (-1193.140) (-1197.484) (-1199.270) * (-1198.475) (-1191.263) (-1194.201) [-1194.389] -- 0:01:34
467000 -- [-1196.276] (-1197.520) (-1194.808) (-1192.996) * (-1199.726) (-1194.408) [-1193.292] (-1189.820) -- 0:01:35
467500 -- (-1191.253) (-1196.535) [-1194.088] (-1193.469) * (-1190.763) (-1187.362) (-1195.225) [-1193.191] -- 0:01:35
468000 -- (-1198.175) (-1196.645) [-1190.667] (-1196.920) * (-1195.019) (-1189.792) [-1196.249] (-1196.098) -- 0:01:35
468500 -- (-1198.971) [-1190.497] (-1190.514) (-1198.145) * (-1198.984) [-1191.725] (-1201.463) (-1194.349) -- 0:01:35
469000 -- (-1196.581) (-1194.570) (-1190.313) [-1190.962] * (-1194.124) [-1188.814] (-1191.415) (-1192.460) -- 0:01:35
469500 -- (-1196.986) (-1190.587) [-1193.978] (-1198.902) * (-1189.833) (-1203.776) (-1190.997) [-1189.991] -- 0:01:34
470000 -- (-1193.059) (-1195.870) (-1198.795) [-1191.324] * [-1187.747] (-1193.872) (-1195.722) (-1191.551) -- 0:01:34
Average standard deviation of split frequencies: 0.004808
470500 -- [-1188.563] (-1191.800) (-1191.018) (-1194.015) * [-1193.164] (-1199.019) (-1201.560) (-1196.255) -- 0:01:34
471000 -- (-1190.393) [-1201.058] (-1190.048) (-1192.853) * (-1195.235) [-1194.308] (-1192.605) (-1192.200) -- 0:01:34
471500 -- (-1193.009) [-1192.419] (-1195.885) (-1187.753) * (-1199.358) (-1200.840) (-1190.823) [-1190.573] -- 0:01:34
472000 -- (-1194.891) [-1198.861] (-1197.628) (-1192.441) * (-1195.043) [-1191.746] (-1197.811) (-1193.873) -- 0:01:33
472500 -- (-1190.409) [-1192.568] (-1201.785) (-1194.200) * (-1198.741) (-1196.047) (-1200.888) [-1194.155] -- 0:01:34
473000 -- (-1195.767) (-1191.138) (-1194.611) [-1191.955] * (-1199.464) (-1192.267) (-1194.323) [-1192.226] -- 0:01:34
473500 -- [-1189.876] (-1195.395) (-1200.552) (-1195.970) * (-1201.619) [-1194.983] (-1194.707) (-1192.082) -- 0:01:34
474000 -- [-1193.514] (-1192.981) (-1193.299) (-1189.182) * [-1192.510] (-1189.983) (-1192.895) (-1189.118) -- 0:01:34
474500 -- (-1197.863) (-1192.493) [-1191.498] (-1196.018) * (-1196.108) (-1192.516) [-1193.527] (-1190.978) -- 0:01:34
475000 -- [-1201.000] (-1195.920) (-1196.257) (-1194.681) * (-1193.944) (-1191.001) (-1192.513) [-1196.756] -- 0:01:33
Average standard deviation of split frequencies: 0.005150
475500 -- (-1198.827) (-1198.135) (-1192.108) [-1194.543] * (-1199.950) (-1192.485) (-1195.391) [-1190.048] -- 0:01:33
476000 -- [-1197.499] (-1192.756) (-1191.064) (-1202.125) * (-1194.491) (-1187.154) (-1193.077) [-1193.124] -- 0:01:33
476500 -- (-1196.370) [-1193.847] (-1193.128) (-1195.933) * (-1194.616) (-1193.869) [-1193.345] (-1193.502) -- 0:01:33
477000 -- [-1194.661] (-1194.129) (-1197.600) (-1206.270) * (-1195.080) [-1194.004] (-1191.128) (-1193.426) -- 0:01:33
477500 -- (-1189.278) (-1198.813) (-1195.546) [-1194.736] * [-1195.030] (-1190.245) (-1201.689) (-1201.561) -- 0:01:33
478000 -- [-1189.148] (-1197.494) (-1194.284) (-1191.555) * (-1198.089) (-1212.073) [-1190.033] (-1197.076) -- 0:01:32
478500 -- (-1189.212) (-1198.672) (-1197.463) [-1195.225] * (-1192.368) (-1196.150) [-1194.447] (-1193.362) -- 0:01:33
479000 -- (-1199.560) [-1192.611] (-1198.445) (-1197.640) * [-1190.769] (-1195.910) (-1190.669) (-1192.202) -- 0:01:33
479500 -- (-1194.514) [-1195.937] (-1202.214) (-1190.243) * (-1194.072) [-1193.557] (-1191.811) (-1189.341) -- 0:01:33
480000 -- (-1193.067) (-1194.988) [-1198.554] (-1199.291) * (-1194.054) [-1196.314] (-1201.436) (-1201.541) -- 0:01:33
Average standard deviation of split frequencies: 0.003923
480500 -- (-1196.913) (-1198.529) (-1188.412) [-1196.624] * (-1192.293) [-1191.155] (-1198.605) (-1200.320) -- 0:01:32
481000 -- [-1195.350] (-1196.040) (-1194.880) (-1195.711) * (-1192.898) [-1192.386] (-1201.742) (-1191.871) -- 0:01:32
481500 -- (-1194.143) (-1202.209) (-1193.477) [-1197.894] * [-1189.396] (-1188.827) (-1206.435) (-1196.412) -- 0:01:32
482000 -- (-1200.729) (-1193.735) (-1195.447) [-1192.513] * (-1192.640) [-1191.900] (-1192.323) (-1192.972) -- 0:01:32
482500 -- (-1192.519) (-1195.834) [-1192.208] (-1189.651) * [-1198.285] (-1195.603) (-1199.091) (-1205.006) -- 0:01:32
483000 -- (-1195.356) [-1192.175] (-1192.459) (-1193.322) * (-1194.616) (-1189.338) [-1191.287] (-1195.400) -- 0:01:32
483500 -- (-1194.864) (-1194.217) (-1192.947) [-1194.909] * (-1198.054) (-1198.982) (-1188.708) [-1191.937] -- 0:01:31
484000 -- (-1194.909) (-1204.155) (-1191.013) [-1194.847] * (-1194.487) (-1195.011) (-1200.313) [-1188.650] -- 0:01:32
484500 -- (-1197.477) [-1199.916] (-1199.813) (-1191.568) * (-1198.118) (-1191.210) [-1201.260] (-1196.614) -- 0:01:32
485000 -- (-1195.142) (-1198.667) (-1199.947) [-1195.364] * (-1200.547) (-1195.619) (-1199.251) [-1200.530] -- 0:01:32
Average standard deviation of split frequencies: 0.003880
485500 -- (-1201.142) (-1197.431) (-1198.916) [-1190.289] * (-1196.397) (-1193.467) (-1197.884) [-1190.468] -- 0:01:32
486000 -- (-1194.665) (-1193.327) (-1192.463) [-1189.763] * (-1202.427) (-1196.211) (-1191.958) [-1191.771] -- 0:01:32
486500 -- (-1199.726) [-1191.775] (-1198.001) (-1191.625) * (-1195.893) [-1193.482] (-1188.753) (-1196.588) -- 0:01:31
487000 -- (-1199.422) (-1195.458) [-1190.170] (-1199.583) * (-1192.803) (-1192.041) (-1193.345) [-1186.748] -- 0:01:31
487500 -- (-1197.413) (-1197.970) (-1193.270) [-1193.900] * (-1187.064) [-1191.525] (-1193.767) (-1190.296) -- 0:01:31
488000 -- (-1196.550) (-1198.449) (-1189.879) [-1189.251] * (-1195.593) (-1196.113) [-1190.843] (-1194.599) -- 0:01:31
488500 -- (-1201.015) (-1193.021) [-1188.068] (-1190.775) * (-1195.636) (-1195.264) (-1191.936) [-1194.198] -- 0:01:31
489000 -- (-1198.867) (-1191.919) (-1188.097) [-1192.159] * (-1196.336) [-1189.740] (-1192.334) (-1193.879) -- 0:01:30
489500 -- (-1192.241) (-1190.519) (-1191.614) [-1192.740] * (-1210.279) [-1191.920] (-1192.090) (-1202.642) -- 0:01:31
490000 -- (-1202.118) (-1190.593) (-1195.493) [-1194.066] * (-1197.250) (-1192.978) (-1205.324) [-1194.690] -- 0:01:31
Average standard deviation of split frequencies: 0.003459
490500 -- (-1194.737) (-1198.485) [-1192.457] (-1194.524) * (-1190.227) (-1194.371) (-1197.358) [-1191.528] -- 0:01:31
491000 -- [-1190.649] (-1194.917) (-1193.137) (-1192.865) * [-1187.582] (-1191.742) (-1197.366) (-1198.014) -- 0:01:31
491500 -- (-1193.566) (-1193.462) [-1194.745] (-1195.837) * (-1190.423) [-1187.529] (-1196.928) (-1201.118) -- 0:01:31
492000 -- (-1192.163) (-1188.890) [-1189.740] (-1200.826) * (-1191.352) (-1190.071) [-1191.397] (-1194.036) -- 0:01:30
492500 -- [-1194.530] (-1193.960) (-1195.574) (-1192.513) * (-1191.610) (-1192.833) (-1193.466) [-1190.946] -- 0:01:30
493000 -- (-1196.543) (-1193.305) [-1198.948] (-1194.010) * (-1192.927) [-1190.112] (-1193.583) (-1197.374) -- 0:01:30
493500 -- [-1201.859] (-1200.529) (-1200.593) (-1196.711) * [-1192.855] (-1188.203) (-1193.595) (-1195.882) -- 0:01:30
494000 -- [-1195.013] (-1208.296) (-1193.754) (-1200.103) * (-1191.066) [-1192.889] (-1194.420) (-1199.033) -- 0:01:30
494500 -- (-1193.991) (-1188.497) (-1203.168) [-1192.235] * [-1193.265] (-1195.568) (-1190.546) (-1196.707) -- 0:01:29
495000 -- (-1199.186) (-1197.116) [-1191.303] (-1201.798) * (-1194.599) (-1190.778) [-1187.625] (-1194.862) -- 0:01:29
Average standard deviation of split frequencies: 0.003421
495500 -- (-1199.264) (-1195.610) (-1193.516) [-1189.708] * (-1193.593) [-1194.003] (-1204.868) (-1193.103) -- 0:01:30
496000 -- (-1193.656) (-1190.877) [-1189.396] (-1196.751) * (-1192.423) [-1196.353] (-1198.197) (-1204.815) -- 0:01:30
496500 -- [-1193.523] (-1193.176) (-1194.904) (-1191.124) * (-1192.385) [-1196.286] (-1193.624) (-1198.724) -- 0:01:30
497000 -- (-1194.209) (-1191.831) [-1194.080] (-1196.005) * [-1188.473] (-1195.409) (-1195.422) (-1194.240) -- 0:01:30
497500 -- (-1193.138) (-1197.271) [-1195.312] (-1194.849) * [-1187.379] (-1194.653) (-1197.586) (-1198.035) -- 0:01:29
498000 -- (-1193.746) [-1196.572] (-1193.976) (-1190.930) * [-1190.311] (-1191.598) (-1194.451) (-1196.188) -- 0:01:29
498500 -- (-1192.671) (-1191.328) [-1187.019] (-1189.248) * (-1193.863) (-1195.408) (-1195.465) [-1189.230] -- 0:01:29
499000 -- (-1200.370) (-1192.997) [-1196.641] (-1197.813) * (-1193.591) [-1187.823] (-1191.157) (-1197.657) -- 0:01:29
499500 -- (-1188.404) [-1191.739] (-1198.968) (-1194.793) * (-1192.182) (-1196.422) [-1191.923] (-1191.148) -- 0:01:29
500000 -- (-1192.285) (-1193.112) [-1197.386] (-1200.528) * (-1191.566) (-1205.351) [-1193.024] (-1189.580) -- 0:01:29
Average standard deviation of split frequencies: 0.003766
500500 -- [-1195.274] (-1190.713) (-1194.338) (-1194.813) * (-1198.162) (-1197.770) (-1200.960) [-1197.411] -- 0:01:28
501000 -- (-1194.504) [-1190.792] (-1195.297) (-1192.121) * (-1194.361) [-1197.775] (-1199.641) (-1201.703) -- 0:01:29
501500 -- (-1196.918) (-1189.709) [-1190.326] (-1195.291) * (-1200.137) (-1198.853) (-1194.049) [-1195.766] -- 0:01:29
502000 -- (-1194.595) [-1191.534] (-1189.723) (-1197.439) * (-1201.464) (-1193.998) (-1195.926) [-1191.231] -- 0:01:29
502500 -- [-1193.244] (-1195.966) (-1193.870) (-1199.798) * (-1199.521) [-1194.080] (-1201.673) (-1199.151) -- 0:01:29
503000 -- (-1191.654) (-1202.130) (-1188.718) [-1191.076] * (-1192.408) (-1200.196) (-1192.674) [-1187.797] -- 0:01:28
503500 -- (-1189.641) [-1196.635] (-1194.167) (-1193.033) * (-1192.036) (-1196.227) [-1198.064] (-1197.735) -- 0:01:28
504000 -- (-1195.828) (-1197.433) (-1202.004) [-1191.385] * (-1191.375) [-1192.047] (-1206.466) (-1195.692) -- 0:01:28
504500 -- (-1197.433) [-1190.825] (-1195.900) (-1196.658) * (-1190.912) (-1196.645) (-1194.014) [-1197.263] -- 0:01:28
505000 -- (-1196.938) [-1193.395] (-1198.212) (-1192.976) * [-1189.304] (-1196.815) (-1194.607) (-1199.677) -- 0:01:28
Average standard deviation of split frequencies: 0.004285
505500 -- (-1196.905) (-1190.023) [-1191.358] (-1195.444) * (-1191.428) (-1192.832) [-1198.948] (-1195.604) -- 0:01:28
506000 -- (-1196.860) [-1187.012] (-1196.677) (-1195.050) * [-1195.486] (-1191.393) (-1193.214) (-1199.126) -- 0:01:27
506500 -- (-1194.467) (-1196.593) (-1196.199) [-1193.343] * [-1194.905] (-1195.914) (-1195.905) (-1202.385) -- 0:01:27
507000 -- (-1197.914) (-1199.058) [-1197.820] (-1192.860) * (-1192.563) (-1201.460) [-1192.700] (-1196.758) -- 0:01:28
507500 -- [-1192.716] (-1194.608) (-1195.199) (-1196.283) * [-1194.846] (-1190.485) (-1195.331) (-1192.877) -- 0:01:28
508000 -- [-1191.544] (-1190.081) (-1195.917) (-1195.131) * (-1193.522) (-1193.673) [-1193.367] (-1201.594) -- 0:01:28
508500 -- (-1193.255) (-1195.923) (-1194.007) [-1196.260] * (-1204.676) [-1191.856] (-1190.346) (-1198.042) -- 0:01:27
509000 -- [-1196.617] (-1194.963) (-1193.317) (-1193.571) * [-1194.995] (-1192.051) (-1192.821) (-1195.088) -- 0:01:27
509500 -- (-1193.235) [-1191.608] (-1198.660) (-1194.516) * [-1193.726] (-1205.067) (-1194.906) (-1194.532) -- 0:01:27
510000 -- (-1201.648) (-1200.648) [-1191.136] (-1189.854) * (-1200.670) [-1195.573] (-1208.172) (-1203.652) -- 0:01:27
Average standard deviation of split frequencies: 0.003692
510500 -- (-1203.320) [-1193.690] (-1203.455) (-1196.237) * (-1206.071) (-1189.848) (-1195.695) [-1194.127] -- 0:01:27
511000 -- (-1202.752) (-1197.286) [-1190.133] (-1195.094) * (-1206.535) (-1193.302) [-1199.709] (-1193.103) -- 0:01:27
511500 -- (-1193.690) (-1196.267) [-1194.983] (-1198.149) * [-1194.209] (-1194.449) (-1192.136) (-1196.446) -- 0:01:26
512000 -- (-1193.723) [-1189.897] (-1190.590) (-1198.379) * [-1193.819] (-1193.169) (-1194.408) (-1196.461) -- 0:01:26
512500 -- (-1199.866) (-1194.598) [-1193.108] (-1198.686) * (-1194.347) (-1201.551) [-1195.016] (-1193.296) -- 0:01:27
513000 -- (-1199.757) (-1197.722) [-1186.992] (-1200.622) * (-1190.566) (-1193.669) [-1197.075] (-1198.375) -- 0:01:27
513500 -- (-1194.972) (-1198.498) (-1194.293) [-1195.098] * [-1196.203] (-1192.347) (-1197.029) (-1194.915) -- 0:01:27
514000 -- (-1195.830) [-1198.889] (-1196.338) (-1194.481) * [-1193.293] (-1197.215) (-1203.583) (-1199.161) -- 0:01:26
514500 -- (-1193.822) (-1200.025) [-1196.862] (-1203.039) * (-1194.835) [-1193.487] (-1199.937) (-1198.486) -- 0:01:26
515000 -- (-1198.289) (-1204.337) [-1188.047] (-1199.764) * [-1192.317] (-1197.083) (-1199.578) (-1200.419) -- 0:01:26
Average standard deviation of split frequencies: 0.004020
515500 -- (-1194.916) [-1194.577] (-1188.611) (-1195.986) * (-1194.550) [-1188.869] (-1207.006) (-1192.733) -- 0:01:26
516000 -- (-1192.571) (-1194.901) (-1207.418) [-1193.821] * (-1193.380) [-1191.392] (-1198.156) (-1196.327) -- 0:01:26
516500 -- (-1190.671) [-1198.228] (-1191.536) (-1197.627) * (-1190.551) [-1193.908] (-1197.233) (-1193.949) -- 0:01:26
517000 -- (-1196.857) (-1193.253) (-1191.874) [-1193.342] * (-1192.162) (-1196.370) (-1197.488) [-1192.463] -- 0:01:25
517500 -- (-1193.721) (-1196.186) [-1189.323] (-1201.682) * (-1193.829) (-1201.678) (-1205.715) [-1200.404] -- 0:01:25
518000 -- (-1203.251) (-1186.636) [-1200.422] (-1196.968) * (-1201.165) [-1193.203] (-1194.808) (-1194.481) -- 0:01:26
518500 -- (-1195.604) (-1198.419) [-1189.955] (-1191.776) * (-1193.668) (-1193.010) (-1196.129) [-1192.202] -- 0:01:26
519000 -- [-1191.377] (-1191.674) (-1192.974) (-1192.281) * (-1199.121) [-1191.092] (-1195.952) (-1194.137) -- 0:01:26
519500 -- (-1189.798) (-1195.367) (-1198.196) [-1193.585] * [-1196.127] (-1198.473) (-1204.933) (-1201.812) -- 0:01:26
520000 -- [-1193.895] (-1195.429) (-1194.643) (-1197.766) * (-1207.517) [-1191.602] (-1195.556) (-1196.725) -- 0:01:25
Average standard deviation of split frequencies: 0.003803
520500 -- (-1204.877) (-1202.644) [-1203.915] (-1191.167) * (-1204.940) (-1189.082) [-1189.491] (-1200.784) -- 0:01:25
521000 -- (-1196.823) [-1192.940] (-1191.422) (-1192.970) * (-1203.668) [-1191.999] (-1190.781) (-1199.077) -- 0:01:25
521500 -- (-1191.539) (-1198.208) (-1189.872) [-1192.266] * (-1199.501) (-1191.564) [-1190.743] (-1197.129) -- 0:01:25
522000 -- (-1191.979) (-1194.320) [-1199.241] (-1195.879) * (-1198.151) (-1192.145) (-1190.501) [-1198.626] -- 0:01:25
522500 -- [-1194.394] (-1188.631) (-1187.282) (-1198.477) * (-1195.694) (-1193.681) [-1192.984] (-1190.089) -- 0:01:24
523000 -- (-1196.856) [-1194.211] (-1193.106) (-1198.821) * [-1200.491] (-1201.262) (-1190.448) (-1194.929) -- 0:01:24
523500 -- (-1194.997) [-1191.741] (-1193.706) (-1199.179) * (-1196.526) (-1197.031) [-1190.975] (-1193.312) -- 0:01:24
524000 -- (-1194.607) (-1195.398) [-1190.672] (-1195.852) * (-1194.470) (-1195.466) [-1189.936] (-1193.585) -- 0:01:25
524500 -- [-1192.596] (-1196.116) (-1192.884) (-1192.340) * (-1199.678) (-1198.145) (-1189.002) [-1194.872] -- 0:01:25
525000 -- (-1194.246) [-1192.037] (-1196.105) (-1193.810) * (-1194.264) [-1196.365] (-1190.487) (-1198.140) -- 0:01:25
Average standard deviation of split frequencies: 0.003047
525500 -- [-1195.513] (-1192.369) (-1191.029) (-1193.594) * (-1191.928) [-1199.155] (-1193.213) (-1189.154) -- 0:01:24
526000 -- [-1193.103] (-1199.647) (-1191.612) (-1200.798) * [-1196.756] (-1197.707) (-1194.545) (-1197.279) -- 0:01:24
526500 -- (-1189.697) (-1195.323) [-1193.443] (-1199.496) * (-1203.099) (-1198.178) [-1189.299] (-1192.076) -- 0:01:24
527000 -- (-1201.407) (-1191.978) (-1191.468) [-1190.263] * (-1204.874) (-1198.126) (-1193.635) [-1194.341] -- 0:01:24
527500 -- (-1194.693) [-1194.618] (-1194.265) (-1195.402) * (-1198.460) (-1193.256) (-1194.039) [-1195.815] -- 0:01:24
528000 -- (-1194.609) (-1197.622) [-1191.257] (-1191.670) * [-1198.093] (-1195.030) (-1197.551) (-1197.330) -- 0:01:24
528500 -- (-1198.797) (-1194.599) (-1193.193) [-1193.694] * [-1190.925] (-1191.229) (-1196.158) (-1198.360) -- 0:01:23
529000 -- (-1193.298) (-1192.555) [-1193.252] (-1189.836) * (-1197.531) (-1194.776) [-1191.666] (-1192.529) -- 0:01:23
529500 -- (-1197.139) (-1199.319) [-1194.866] (-1195.276) * (-1195.888) (-1199.136) [-1200.351] (-1193.177) -- 0:01:24
530000 -- (-1191.580) (-1190.768) (-1200.925) [-1190.619] * [-1188.176] (-1200.258) (-1200.389) (-1198.623) -- 0:01:24
Average standard deviation of split frequencies: 0.003553
530500 -- (-1196.842) [-1195.542] (-1196.255) (-1190.488) * (-1191.919) (-1195.216) [-1196.414] (-1194.766) -- 0:01:24
531000 -- (-1196.669) (-1186.509) [-1197.311] (-1194.718) * (-1193.576) (-1191.423) (-1198.488) [-1201.060] -- 0:01:23
531500 -- (-1196.169) [-1190.811] (-1195.838) (-1194.995) * (-1190.063) (-1193.472) [-1196.810] (-1197.162) -- 0:01:23
532000 -- (-1201.091) [-1188.887] (-1199.886) (-1192.820) * (-1192.694) [-1197.085] (-1193.529) (-1200.943) -- 0:01:23
532500 -- (-1198.227) (-1192.647) (-1195.231) [-1193.780] * (-1192.881) (-1199.648) [-1198.663] (-1192.233) -- 0:01:23
533000 -- (-1196.730) (-1198.391) [-1193.363] (-1196.680) * (-1190.607) (-1196.399) (-1196.950) [-1201.057] -- 0:01:23
533500 -- (-1198.526) (-1193.193) (-1197.517) [-1190.757] * (-1194.955) (-1191.785) [-1196.180] (-1191.374) -- 0:01:23
534000 -- (-1192.776) (-1201.959) (-1195.264) [-1196.315] * (-1194.077) (-1199.188) (-1204.558) [-1189.089] -- 0:01:22
534500 -- (-1197.060) (-1196.776) (-1200.701) [-1192.592] * (-1192.309) (-1194.003) (-1197.681) [-1186.179] -- 0:01:22
535000 -- (-1199.718) [-1193.228] (-1191.738) (-1195.050) * (-1195.149) [-1196.778] (-1203.780) (-1191.960) -- 0:01:22
Average standard deviation of split frequencies: 0.003870
535500 -- (-1213.072) [-1200.930] (-1196.401) (-1197.764) * (-1197.822) [-1191.435] (-1193.443) (-1193.252) -- 0:01:23
536000 -- (-1200.184) (-1193.996) (-1197.366) [-1191.730] * [-1195.113] (-1191.500) (-1197.810) (-1197.016) -- 0:01:23
536500 -- (-1201.892) (-1194.499) (-1205.461) [-1192.793] * [-1189.801] (-1189.306) (-1198.942) (-1200.989) -- 0:01:22
537000 -- (-1201.875) (-1195.815) [-1199.078] (-1196.718) * (-1194.061) (-1197.788) [-1191.476] (-1194.024) -- 0:01:22
537500 -- [-1196.487] (-1191.985) (-1205.902) (-1193.885) * (-1198.793) [-1190.372] (-1200.162) (-1197.195) -- 0:01:22
538000 -- (-1192.518) (-1199.459) [-1197.133] (-1193.323) * (-1193.876) (-1190.610) [-1204.534] (-1195.862) -- 0:01:22
538500 -- (-1191.739) (-1198.786) (-1191.802) [-1193.293] * (-1190.315) (-1194.627) [-1191.001] (-1194.388) -- 0:01:22
539000 -- (-1197.392) (-1195.235) (-1194.020) [-1193.850] * (-1191.564) (-1195.299) [-1196.553] (-1192.162) -- 0:01:22
539500 -- (-1198.626) (-1189.189) [-1195.755] (-1199.942) * (-1190.723) [-1199.553] (-1195.905) (-1193.876) -- 0:01:21
540000 -- [-1193.822] (-1200.344) (-1190.311) (-1195.291) * [-1191.528] (-1194.616) (-1191.342) (-1192.308) -- 0:01:21
Average standard deviation of split frequencies: 0.004011
540500 -- (-1196.295) (-1191.713) [-1198.203] (-1213.323) * (-1199.452) (-1202.764) (-1194.584) [-1190.796] -- 0:01:21
541000 -- (-1190.066) (-1193.524) (-1201.799) [-1192.525] * (-1191.244) (-1200.765) [-1191.823] (-1189.427) -- 0:01:22
541500 -- (-1197.122) (-1199.670) (-1203.921) [-1191.278] * (-1201.850) [-1199.731] (-1191.523) (-1200.045) -- 0:01:22
542000 -- [-1195.088] (-1196.818) (-1195.739) (-1195.345) * (-1192.782) (-1205.955) (-1192.624) [-1192.798] -- 0:01:21
542500 -- (-1204.928) [-1197.815] (-1203.277) (-1200.095) * (-1189.935) (-1210.265) (-1204.507) [-1190.334] -- 0:01:21
543000 -- (-1192.427) (-1194.154) (-1198.911) [-1191.944] * (-1190.928) (-1204.700) [-1197.800] (-1195.058) -- 0:01:21
543500 -- (-1197.014) [-1193.502] (-1192.370) (-1192.708) * [-1190.020] (-1199.023) (-1192.384) (-1200.069) -- 0:01:21
544000 -- (-1193.532) (-1194.958) (-1195.101) [-1195.652] * [-1192.393] (-1196.699) (-1192.543) (-1197.398) -- 0:01:21
544500 -- (-1191.248) [-1195.957] (-1193.779) (-1195.958) * (-1199.220) (-1196.002) [-1195.348] (-1191.062) -- 0:01:21
545000 -- (-1189.411) [-1202.770] (-1195.965) (-1188.039) * [-1191.726] (-1194.754) (-1194.887) (-1191.868) -- 0:01:20
Average standard deviation of split frequencies: 0.004662
545500 -- (-1198.029) [-1194.919] (-1196.407) (-1196.246) * (-1192.199) [-1195.471] (-1196.774) (-1195.030) -- 0:01:20
546000 -- (-1189.667) (-1191.729) (-1194.269) [-1200.951] * (-1194.672) [-1193.093] (-1191.496) (-1193.065) -- 0:01:20
546500 -- (-1195.165) (-1196.696) [-1194.143] (-1193.928) * (-1192.768) (-1194.071) (-1198.021) [-1190.504] -- 0:01:21
547000 -- (-1199.364) (-1190.524) [-1191.461] (-1191.216) * (-1194.256) (-1194.141) (-1192.978) [-1190.646] -- 0:01:21
547500 -- (-1195.424) [-1190.084] (-1192.958) (-1200.848) * (-1198.499) [-1194.164] (-1191.679) (-1192.564) -- 0:01:20
548000 -- (-1192.738) [-1187.880] (-1201.859) (-1192.660) * [-1200.291] (-1188.804) (-1191.919) (-1195.762) -- 0:01:20
548500 -- (-1199.726) [-1191.362] (-1198.636) (-1195.007) * (-1191.432) (-1193.667) [-1193.254] (-1198.025) -- 0:01:20
549000 -- (-1192.081) (-1188.965) [-1193.387] (-1197.085) * (-1193.756) (-1195.634) [-1188.316] (-1192.616) -- 0:01:20
549500 -- [-1192.085] (-1193.482) (-1189.354) (-1198.150) * (-1191.331) (-1196.948) [-1191.897] (-1193.788) -- 0:01:20
550000 -- [-1194.387] (-1196.208) (-1193.557) (-1192.507) * (-1195.907) [-1196.685] (-1194.149) (-1195.086) -- 0:01:20
Average standard deviation of split frequencies: 0.005308
550500 -- (-1196.642) [-1190.756] (-1189.345) (-1192.370) * [-1192.158] (-1196.722) (-1199.514) (-1196.080) -- 0:01:20
551000 -- [-1194.582] (-1190.405) (-1198.774) (-1197.871) * [-1190.159] (-1198.353) (-1195.492) (-1195.570) -- 0:01:19
551500 -- (-1190.686) (-1194.549) [-1195.730] (-1196.537) * (-1194.176) [-1199.042] (-1193.109) (-1194.952) -- 0:01:19
552000 -- (-1195.188) (-1193.782) (-1198.869) [-1192.760] * [-1187.883] (-1200.247) (-1200.485) (-1196.366) -- 0:01:20
552500 -- (-1191.757) (-1194.091) (-1192.290) [-1192.665] * (-1196.514) [-1195.517] (-1207.215) (-1197.020) -- 0:01:20
553000 -- (-1197.444) (-1194.386) [-1192.162] (-1194.401) * (-1189.274) [-1194.884] (-1203.713) (-1194.910) -- 0:01:20
553500 -- (-1196.253) [-1193.307] (-1192.030) (-1196.008) * [-1187.609] (-1192.562) (-1200.475) (-1201.243) -- 0:01:19
554000 -- [-1194.224] (-1200.604) (-1192.355) (-1197.152) * (-1189.072) [-1195.177] (-1195.792) (-1194.839) -- 0:01:19
554500 -- (-1192.419) [-1196.310] (-1194.947) (-1196.106) * (-1191.620) (-1196.836) [-1197.160] (-1191.804) -- 0:01:19
555000 -- (-1200.736) [-1190.539] (-1197.929) (-1189.419) * (-1196.027) [-1188.507] (-1196.908) (-1198.049) -- 0:01:19
Average standard deviation of split frequencies: 0.005596
555500 -- (-1195.425) (-1188.390) [-1191.323] (-1190.451) * (-1189.625) (-1206.244) (-1190.322) [-1196.490] -- 0:01:19
556000 -- (-1206.239) [-1189.180] (-1193.641) (-1189.583) * (-1197.019) (-1204.240) (-1201.568) [-1199.079] -- 0:01:19
556500 -- (-1192.262) (-1190.088) (-1193.216) [-1189.593] * (-1196.389) [-1191.875] (-1200.062) (-1192.215) -- 0:01:18
557000 -- (-1199.029) [-1191.539] (-1196.359) (-1197.066) * (-1198.483) (-1194.653) (-1193.698) [-1193.556] -- 0:01:18
557500 -- (-1194.142) (-1197.969) (-1194.504) [-1192.040] * (-1193.790) [-1192.828] (-1192.529) (-1191.696) -- 0:01:18
558000 -- (-1194.473) (-1194.589) [-1196.979] (-1206.392) * (-1192.173) (-1191.097) (-1189.414) [-1196.889] -- 0:01:19
558500 -- (-1191.639) [-1193.241] (-1197.431) (-1196.471) * (-1201.251) (-1192.507) [-1192.766] (-1202.264) -- 0:01:19
559000 -- (-1189.739) (-1194.164) [-1190.734] (-1199.918) * (-1200.263) (-1193.881) [-1188.646] (-1192.321) -- 0:01:18
559500 -- [-1192.205] (-1202.442) (-1190.367) (-1204.474) * (-1197.688) (-1194.051) [-1191.888] (-1197.457) -- 0:01:18
560000 -- [-1191.362] (-1189.454) (-1194.177) (-1201.792) * (-1192.628) (-1193.809) [-1194.431] (-1193.009) -- 0:01:18
Average standard deviation of split frequencies: 0.004877
560500 -- (-1198.971) (-1191.700) (-1201.410) [-1197.021] * (-1199.398) (-1191.787) [-1192.691] (-1198.886) -- 0:01:18
561000 -- [-1194.138] (-1194.141) (-1192.358) (-1194.536) * (-1199.777) [-1190.301] (-1189.858) (-1193.935) -- 0:01:18
561500 -- (-1192.155) [-1193.341] (-1192.901) (-1195.023) * (-1194.167) (-1191.369) (-1197.485) [-1195.967] -- 0:01:18
562000 -- [-1193.355] (-1204.553) (-1193.207) (-1199.941) * (-1199.033) (-1190.312) [-1198.633] (-1190.000) -- 0:01:17
562500 -- [-1193.856] (-1199.766) (-1195.450) (-1197.385) * (-1194.915) [-1193.049] (-1193.279) (-1191.423) -- 0:01:17
563000 -- [-1189.105] (-1196.068) (-1200.086) (-1203.671) * (-1190.582) [-1194.411] (-1198.081) (-1193.807) -- 0:01:17
563500 -- (-1196.849) (-1201.423) [-1196.508] (-1198.454) * (-1195.604) (-1194.040) (-1197.366) [-1188.953] -- 0:01:18
564000 -- (-1197.271) (-1196.797) (-1200.266) [-1192.147] * (-1198.176) (-1199.395) (-1195.985) [-1192.887] -- 0:01:18
564500 -- [-1197.532] (-1194.009) (-1193.473) (-1195.909) * (-1201.129) [-1193.384] (-1194.769) (-1196.053) -- 0:01:17
565000 -- (-1199.704) (-1205.261) (-1193.360) [-1192.765] * (-1200.531) (-1193.403) (-1194.212) [-1193.679] -- 0:01:17
Average standard deviation of split frequencies: 0.004831
565500 -- (-1193.534) (-1196.253) (-1192.796) [-1202.544] * [-1191.394] (-1198.371) (-1200.563) (-1192.845) -- 0:01:17
566000 -- [-1190.603] (-1194.566) (-1192.718) (-1194.879) * (-1193.813) (-1195.931) (-1191.614) [-1192.830] -- 0:01:17
566500 -- (-1194.148) (-1196.311) [-1191.277] (-1192.638) * (-1190.259) (-1194.325) [-1190.542] (-1187.810) -- 0:01:17
567000 -- (-1197.971) (-1192.820) [-1190.009] (-1196.594) * (-1195.250) (-1198.376) (-1193.310) [-1192.877] -- 0:01:17
567500 -- (-1202.153) (-1191.371) (-1200.857) [-1191.259] * (-1196.493) (-1206.817) (-1191.747) [-1194.599] -- 0:01:16
568000 -- (-1193.956) (-1201.724) (-1194.057) [-1190.949] * (-1192.353) [-1192.084] (-1194.396) (-1193.602) -- 0:01:16
568500 -- [-1195.795] (-1192.881) (-1188.790) (-1194.822) * (-1196.745) (-1197.769) [-1198.981] (-1198.111) -- 0:01:16
569000 -- (-1196.784) (-1205.315) (-1189.892) [-1195.246] * (-1192.783) (-1195.489) [-1198.313] (-1189.392) -- 0:01:17
569500 -- (-1192.258) [-1190.111] (-1190.658) (-1205.678) * (-1204.318) [-1195.052] (-1192.942) (-1191.907) -- 0:01:17
570000 -- (-1202.471) [-1195.657] (-1200.687) (-1197.396) * [-1187.929] (-1194.620) (-1196.918) (-1198.682) -- 0:01:16
Average standard deviation of split frequencies: 0.005287
570500 -- (-1204.045) (-1195.037) (-1195.202) [-1190.924] * (-1195.084) [-1197.541] (-1188.423) (-1199.538) -- 0:01:16
571000 -- [-1192.711] (-1198.761) (-1195.373) (-1203.354) * [-1197.432] (-1202.575) (-1192.964) (-1196.889) -- 0:01:16
571500 -- (-1194.478) (-1198.904) (-1196.776) [-1202.101] * (-1193.561) (-1191.365) (-1199.945) [-1196.027] -- 0:01:16
572000 -- (-1193.499) (-1198.486) (-1195.403) [-1199.432] * (-1190.796) [-1189.748] (-1193.403) (-1205.073) -- 0:01:16
572500 -- (-1190.252) [-1194.957] (-1193.203) (-1196.394) * (-1191.228) (-1198.782) [-1190.904] (-1195.426) -- 0:01:16
573000 -- (-1192.296) [-1189.844] (-1192.261) (-1199.464) * (-1191.762) (-1200.497) [-1191.594] (-1192.368) -- 0:01:16
573500 -- (-1192.609) (-1195.020) [-1192.764] (-1200.004) * (-1191.802) [-1193.067] (-1198.841) (-1195.185) -- 0:01:15
574000 -- (-1199.099) (-1193.345) [-1196.561] (-1203.122) * [-1188.107] (-1200.427) (-1208.918) (-1192.665) -- 0:01:15
574500 -- (-1192.133) [-1191.987] (-1197.566) (-1199.421) * (-1190.490) (-1189.993) [-1191.043] (-1199.511) -- 0:01:16
575000 -- [-1189.086] (-1196.950) (-1205.343) (-1199.091) * (-1192.387) (-1194.724) [-1192.775] (-1191.790) -- 0:01:16
Average standard deviation of split frequencies: 0.004910
575500 -- [-1188.733] (-1201.354) (-1195.603) (-1190.449) * (-1194.956) [-1193.057] (-1191.880) (-1204.944) -- 0:01:15
576000 -- (-1197.654) [-1187.371] (-1191.619) (-1194.486) * (-1193.550) (-1191.888) (-1195.045) [-1193.800] -- 0:01:15
576500 -- (-1194.380) (-1192.031) (-1188.850) [-1187.644] * (-1198.104) (-1192.144) (-1201.466) [-1189.833] -- 0:01:15
577000 -- (-1192.777) (-1206.353) (-1189.526) [-1194.199] * (-1191.797) (-1191.835) (-1195.526) [-1188.698] -- 0:01:15
577500 -- (-1197.151) [-1196.922] (-1192.441) (-1199.498) * (-1205.155) [-1192.579] (-1198.001) (-1196.016) -- 0:01:15
578000 -- (-1196.979) (-1191.930) (-1188.600) [-1196.262] * [-1198.134] (-1206.811) (-1195.287) (-1193.323) -- 0:01:15
578500 -- (-1197.236) (-1190.984) [-1197.565] (-1191.896) * (-1193.379) [-1195.336] (-1201.269) (-1197.326) -- 0:01:15
579000 -- [-1196.890] (-1198.987) (-1191.773) (-1197.694) * (-1190.794) [-1191.030] (-1196.449) (-1195.777) -- 0:01:14
579500 -- (-1193.151) (-1193.133) [-1194.807] (-1195.733) * (-1190.868) (-1191.570) [-1191.644] (-1194.462) -- 0:01:14
580000 -- [-1195.738] (-1197.181) (-1197.019) (-1197.715) * [-1189.544] (-1195.110) (-1190.639) (-1200.401) -- 0:01:15
Average standard deviation of split frequencies: 0.002923
580500 -- (-1195.575) (-1197.101) (-1200.919) [-1193.839] * (-1189.497) [-1191.262] (-1194.455) (-1193.244) -- 0:01:15
581000 -- (-1195.412) [-1190.734] (-1193.318) (-1197.459) * (-1198.636) (-1191.421) [-1192.359] (-1192.908) -- 0:01:15
581500 -- [-1201.192] (-1203.153) (-1190.625) (-1196.004) * [-1192.163] (-1193.847) (-1193.339) (-1198.572) -- 0:01:14
582000 -- (-1194.455) (-1197.754) (-1191.441) [-1192.474] * [-1198.730] (-1194.934) (-1196.783) (-1213.731) -- 0:01:14
582500 -- (-1198.954) (-1194.430) [-1193.089] (-1195.482) * (-1190.075) (-1203.655) (-1194.535) [-1192.995] -- 0:01:14
583000 -- (-1198.898) (-1200.083) (-1194.297) [-1194.767] * (-1191.838) (-1205.566) [-1191.331] (-1201.039) -- 0:01:14
583500 -- (-1195.294) (-1200.277) (-1198.561) [-1194.936] * [-1193.489] (-1197.967) (-1197.370) (-1191.282) -- 0:01:14
584000 -- (-1196.398) (-1197.896) (-1195.857) [-1193.886] * (-1188.895) (-1196.409) (-1197.306) [-1197.983] -- 0:01:14
584500 -- (-1195.182) (-1201.824) (-1192.878) [-1194.557] * (-1204.593) (-1192.122) (-1203.164) [-1192.771] -- 0:01:13
585000 -- (-1196.320) [-1195.506] (-1191.890) (-1192.578) * (-1193.740) (-1200.744) [-1195.684] (-1189.628) -- 0:01:13
Average standard deviation of split frequencies: 0.002896
585500 -- (-1199.192) [-1197.265] (-1190.637) (-1193.536) * (-1191.746) [-1190.856] (-1200.450) (-1197.527) -- 0:01:13
586000 -- [-1191.378] (-1199.640) (-1189.480) (-1197.139) * (-1196.996) (-1197.696) [-1195.862] (-1197.894) -- 0:01:14
586500 -- [-1195.432] (-1195.005) (-1200.705) (-1186.539) * (-1192.700) [-1189.299] (-1197.311) (-1197.801) -- 0:01:14
587000 -- (-1202.198) (-1197.812) (-1194.899) [-1190.992] * (-1202.778) (-1203.390) [-1194.380] (-1197.027) -- 0:01:13
587500 -- (-1190.923) (-1199.429) [-1190.456] (-1199.835) * (-1193.858) (-1198.173) [-1195.551] (-1202.460) -- 0:01:13
588000 -- (-1202.983) [-1193.735] (-1197.485) (-1189.629) * (-1198.581) [-1188.194] (-1199.474) (-1194.780) -- 0:01:13
588500 -- (-1196.712) (-1205.385) (-1196.393) [-1188.989] * [-1195.902] (-1191.008) (-1202.716) (-1201.468) -- 0:01:13
589000 -- [-1192.499] (-1197.935) (-1195.926) (-1195.450) * [-1201.115] (-1197.874) (-1200.740) (-1200.161) -- 0:01:13
589500 -- (-1188.956) [-1199.867] (-1196.816) (-1195.820) * (-1193.963) [-1194.356] (-1201.770) (-1193.049) -- 0:01:13
590000 -- (-1200.249) [-1199.781] (-1191.755) (-1195.413) * [-1190.299] (-1198.583) (-1209.392) (-1193.286) -- 0:01:12
Average standard deviation of split frequencies: 0.003192
590500 -- (-1198.452) (-1196.476) (-1198.983) [-1196.149] * (-1193.748) (-1202.773) (-1213.047) [-1197.346] -- 0:01:12
591000 -- [-1195.913] (-1193.721) (-1196.779) (-1196.550) * (-1194.909) [-1193.403] (-1202.069) (-1200.532) -- 0:01:12
591500 -- [-1189.690] (-1190.605) (-1189.952) (-1193.466) * (-1193.810) (-1201.479) (-1201.964) [-1193.473] -- 0:01:13
592000 -- (-1193.225) (-1197.500) (-1190.143) [-1195.123] * [-1188.631] (-1210.252) (-1201.056) (-1195.489) -- 0:01:13
592500 -- [-1191.553] (-1202.731) (-1192.893) (-1196.602) * [-1196.891] (-1195.510) (-1194.274) (-1191.295) -- 0:01:12
593000 -- (-1189.625) (-1189.054) (-1194.192) [-1193.812] * [-1191.069] (-1191.092) (-1202.255) (-1192.514) -- 0:01:12
593500 -- (-1195.304) [-1195.373] (-1193.424) (-1195.808) * (-1197.894) (-1193.784) (-1205.973) [-1188.313] -- 0:01:12
594000 -- (-1193.013) [-1193.758] (-1192.810) (-1194.438) * [-1194.621] (-1194.951) (-1201.872) (-1193.184) -- 0:01:12
594500 -- [-1192.727] (-1191.788) (-1193.013) (-1190.321) * (-1200.777) (-1207.705) [-1192.839] (-1191.749) -- 0:01:12
595000 -- (-1200.510) (-1197.703) (-1196.733) [-1197.038] * (-1194.830) (-1199.609) [-1195.191] (-1189.864) -- 0:01:12
Average standard deviation of split frequencies: 0.003164
595500 -- (-1190.744) (-1202.823) (-1195.289) [-1196.012] * (-1193.275) (-1195.661) (-1190.554) [-1193.180] -- 0:01:12
596000 -- (-1194.168) (-1194.237) (-1191.795) [-1197.678] * [-1190.920] (-1199.914) (-1191.624) (-1192.596) -- 0:01:11
596500 -- (-1194.712) (-1193.242) (-1202.401) [-1191.395] * (-1191.700) (-1194.665) [-1193.700] (-1195.386) -- 0:01:11
597000 -- (-1192.495) (-1195.617) [-1194.587] (-1194.393) * (-1189.943) (-1194.834) [-1190.745] (-1193.781) -- 0:01:12
597500 -- (-1192.773) (-1199.019) (-1196.734) [-1194.557] * (-1189.176) (-1191.074) [-1204.277] (-1193.230) -- 0:01:12
598000 -- (-1197.136) (-1206.341) [-1193.389] (-1193.469) * (-1196.108) (-1200.600) [-1190.483] (-1194.289) -- 0:01:11
598500 -- (-1195.940) (-1198.706) [-1190.667] (-1190.158) * [-1196.498] (-1191.472) (-1194.645) (-1199.161) -- 0:01:11
599000 -- (-1192.520) (-1192.082) [-1188.972] (-1194.346) * (-1192.581) (-1193.445) [-1190.813] (-1196.620) -- 0:01:11
599500 -- [-1192.944] (-1196.393) (-1191.467) (-1196.727) * (-1202.233) [-1198.502] (-1194.973) (-1204.195) -- 0:01:11
600000 -- (-1196.964) [-1188.519] (-1201.888) (-1195.295) * (-1200.312) (-1193.846) [-1193.755] (-1190.928) -- 0:01:11
Average standard deviation of split frequencies: 0.002511
600500 -- (-1197.480) (-1190.760) [-1191.973] (-1202.660) * (-1195.958) (-1193.354) (-1192.900) [-1191.859] -- 0:01:11
601000 -- (-1190.498) [-1190.790] (-1196.712) (-1198.433) * (-1202.401) (-1196.761) (-1194.027) [-1190.452] -- 0:01:11
601500 -- [-1201.413] (-1199.281) (-1198.963) (-1194.292) * (-1196.835) (-1194.265) (-1194.389) [-1193.237] -- 0:01:11
602000 -- [-1196.628] (-1202.509) (-1193.965) (-1195.719) * (-1193.674) (-1194.755) (-1193.773) [-1195.082] -- 0:01:11
602500 -- (-1199.460) (-1201.133) [-1196.662] (-1193.845) * (-1201.874) [-1189.481] (-1199.049) (-1189.375) -- 0:01:11
603000 -- (-1191.913) (-1195.211) (-1194.058) [-1190.444] * (-1193.390) (-1198.915) (-1190.276) [-1194.247] -- 0:01:11
603500 -- (-1192.156) [-1189.496] (-1188.464) (-1191.884) * (-1194.276) (-1194.761) [-1195.928] (-1202.596) -- 0:01:10
604000 -- [-1195.728] (-1192.011) (-1191.082) (-1188.948) * [-1197.378] (-1196.851) (-1192.063) (-1195.301) -- 0:01:10
604500 -- [-1186.277] (-1192.558) (-1197.300) (-1194.119) * [-1192.065] (-1200.067) (-1191.808) (-1192.367) -- 0:01:10
605000 -- [-1197.998] (-1194.056) (-1197.216) (-1196.076) * [-1191.670] (-1197.035) (-1194.852) (-1197.861) -- 0:01:10
Average standard deviation of split frequencies: 0.002956
605500 -- (-1194.025) [-1191.343] (-1192.422) (-1191.283) * (-1192.523) (-1200.824) [-1193.442] (-1192.446) -- 0:01:10
606000 -- (-1197.785) [-1196.348] (-1188.654) (-1190.496) * (-1199.122) (-1190.834) [-1195.882] (-1198.877) -- 0:01:10
606500 -- (-1195.522) (-1193.154) [-1189.054] (-1192.409) * (-1191.608) (-1198.294) (-1199.676) [-1188.916] -- 0:01:10
607000 -- (-1195.619) [-1188.990] (-1196.301) (-1190.798) * (-1194.514) [-1190.145] (-1197.251) (-1192.705) -- 0:01:10
607500 -- (-1201.171) [-1189.440] (-1196.363) (-1193.068) * [-1193.741] (-1193.079) (-1191.681) (-1197.515) -- 0:01:10
608000 -- (-1195.314) (-1189.587) (-1201.676) [-1199.275] * [-1192.438] (-1192.956) (-1190.698) (-1207.496) -- 0:01:10
608500 -- (-1202.088) (-1194.386) [-1192.380] (-1192.858) * (-1203.444) (-1194.107) [-1199.325] (-1203.681) -- 0:01:10
609000 -- (-1198.283) (-1195.952) (-1193.259) [-1192.568] * (-1197.679) (-1192.783) [-1187.331] (-1192.080) -- 0:01:09
609500 -- (-1198.951) (-1204.643) (-1194.291) [-1192.906] * [-1193.112] (-1197.604) (-1200.616) (-1192.921) -- 0:01:09
610000 -- (-1193.290) [-1195.741] (-1191.635) (-1195.655) * (-1198.674) [-1198.605] (-1203.463) (-1192.878) -- 0:01:09
Average standard deviation of split frequencies: 0.003705
610500 -- (-1190.459) (-1194.447) (-1194.837) [-1190.214] * (-1198.620) [-1195.430] (-1193.703) (-1192.912) -- 0:01:09
611000 -- (-1190.474) (-1198.103) [-1189.729] (-1192.693) * (-1199.069) (-1192.140) (-1193.961) [-1193.604] -- 0:01:09
611500 -- [-1191.008] (-1199.963) (-1190.128) (-1197.744) * (-1195.656) (-1201.500) (-1192.679) [-1199.088] -- 0:01:09
612000 -- (-1197.311) [-1193.532] (-1192.151) (-1194.354) * [-1190.293] (-1203.657) (-1194.099) (-1187.027) -- 0:01:09
612500 -- (-1197.277) (-1196.565) [-1189.784] (-1191.915) * [-1193.251] (-1207.203) (-1198.310) (-1193.834) -- 0:01:09
613000 -- [-1192.074] (-1194.284) (-1191.137) (-1188.653) * [-1193.484] (-1195.708) (-1196.680) (-1195.595) -- 0:01:09
613500 -- (-1194.947) [-1192.709] (-1194.435) (-1191.894) * (-1191.692) [-1197.564] (-1198.752) (-1196.317) -- 0:01:09
614000 -- (-1193.871) (-1195.953) [-1194.759] (-1194.963) * [-1189.888] (-1192.899) (-1196.084) (-1190.669) -- 0:01:09
614500 -- (-1194.996) [-1193.456] (-1200.244) (-1201.270) * (-1192.652) (-1189.593) [-1196.888] (-1195.108) -- 0:01:09
615000 -- (-1202.207) [-1193.930] (-1188.492) (-1189.835) * (-1192.974) (-1198.137) (-1192.533) [-1191.664] -- 0:01:08
Average standard deviation of split frequencies: 0.003367
615500 -- (-1190.689) (-1194.084) [-1194.259] (-1196.282) * (-1194.693) [-1197.906] (-1190.922) (-1193.424) -- 0:01:08
616000 -- (-1188.886) (-1191.593) (-1191.806) [-1192.387] * (-1192.385) [-1194.003] (-1193.737) (-1192.470) -- 0:01:08
616500 -- (-1191.975) (-1199.541) [-1191.464] (-1199.570) * (-1195.916) (-1189.848) [-1192.785] (-1196.260) -- 0:01:08
617000 -- (-1196.319) [-1190.604] (-1191.333) (-1199.201) * [-1195.932] (-1189.543) (-1197.590) (-1191.729) -- 0:01:08
617500 -- (-1191.534) (-1192.901) [-1188.744] (-1196.160) * [-1190.466] (-1196.369) (-1193.434) (-1191.997) -- 0:01:08
618000 -- (-1195.059) [-1196.502] (-1191.426) (-1202.828) * [-1188.385] (-1199.080) (-1193.661) (-1194.506) -- 0:01:08
618500 -- (-1196.982) [-1192.575] (-1194.397) (-1197.549) * (-1194.640) [-1196.053] (-1193.716) (-1194.277) -- 0:01:08
619000 -- (-1203.263) (-1197.530) (-1192.920) [-1195.705] * (-1192.502) (-1196.273) [-1191.843] (-1191.054) -- 0:01:08
619500 -- (-1189.213) (-1197.825) (-1194.636) [-1192.298] * (-1192.257) (-1193.402) [-1190.498] (-1188.517) -- 0:01:08
620000 -- [-1194.032] (-1197.192) (-1202.841) (-1194.846) * (-1190.170) (-1193.660) (-1197.177) [-1191.903] -- 0:01:08
Average standard deviation of split frequencies: 0.003190
620500 -- (-1197.879) (-1207.300) (-1194.538) [-1193.067] * (-1189.511) (-1194.386) (-1193.087) [-1190.291] -- 0:01:07
621000 -- [-1189.462] (-1192.536) (-1190.920) (-1190.975) * (-1192.864) [-1191.836] (-1204.162) (-1189.278) -- 0:01:07
621500 -- (-1191.149) (-1194.564) (-1191.110) [-1191.720] * (-1194.853) (-1200.052) [-1199.416] (-1189.096) -- 0:01:07
622000 -- (-1189.051) (-1194.711) [-1191.623] (-1195.833) * [-1192.321] (-1198.671) (-1191.026) (-1191.476) -- 0:01:08
622500 -- (-1204.357) [-1195.563] (-1194.711) (-1191.110) * [-1193.043] (-1190.797) (-1207.395) (-1195.186) -- 0:01:07
623000 -- (-1194.192) [-1188.410] (-1193.419) (-1190.948) * [-1190.833] (-1192.814) (-1192.848) (-1195.656) -- 0:01:07
623500 -- (-1193.296) (-1197.319) [-1194.102] (-1194.328) * [-1193.597] (-1193.963) (-1199.931) (-1194.438) -- 0:01:07
624000 -- (-1197.039) (-1197.477) [-1193.136] (-1190.188) * (-1192.642) (-1196.542) [-1198.058] (-1198.059) -- 0:01:07
624500 -- (-1203.720) (-1190.957) (-1205.917) [-1198.616] * (-1211.477) (-1189.390) [-1194.032] (-1192.700) -- 0:01:07
625000 -- (-1198.147) [-1189.902] (-1195.593) (-1198.291) * (-1193.614) [-1191.448] (-1200.076) (-1192.634) -- 0:01:07
Average standard deviation of split frequencies: 0.003464
625500 -- [-1194.530] (-1192.278) (-1194.835) (-1190.886) * [-1189.576] (-1190.630) (-1198.017) (-1192.262) -- 0:01:07
626000 -- (-1200.745) [-1191.911] (-1199.207) (-1193.411) * (-1188.637) [-1187.443] (-1197.312) (-1192.085) -- 0:01:06
626500 -- (-1199.618) (-1195.416) [-1191.326] (-1197.814) * (-1194.734) (-1193.117) (-1191.423) [-1191.044] -- 0:01:06
627000 -- (-1196.078) [-1194.751] (-1195.795) (-1198.257) * (-1191.212) (-1197.163) [-1189.487] (-1190.918) -- 0:01:06
627500 -- (-1191.224) [-1190.652] (-1192.184) (-1194.892) * (-1198.803) (-1202.356) [-1199.007] (-1193.625) -- 0:01:06
628000 -- (-1194.799) (-1192.942) [-1194.468] (-1201.017) * (-1189.382) (-1193.365) [-1195.588] (-1191.463) -- 0:01:06
628500 -- (-1193.915) (-1194.877) (-1192.786) [-1198.081] * [-1191.958] (-1203.382) (-1193.260) (-1192.804) -- 0:01:06
629000 -- [-1188.693] (-1194.125) (-1190.372) (-1197.970) * (-1192.782) (-1194.895) [-1190.739] (-1195.981) -- 0:01:06
629500 -- [-1191.609] (-1191.026) (-1196.447) (-1197.893) * [-1189.787] (-1191.839) (-1192.908) (-1195.788) -- 0:01:06
630000 -- [-1193.449] (-1190.663) (-1197.097) (-1196.276) * (-1194.206) (-1201.867) (-1197.962) [-1189.734] -- 0:01:06
Average standard deviation of split frequencies: 0.003139
630500 -- [-1195.107] (-1194.276) (-1196.256) (-1198.874) * [-1191.756] (-1205.772) (-1202.788) (-1197.608) -- 0:01:06
631000 -- (-1195.051) [-1193.105] (-1191.201) (-1193.147) * (-1197.116) (-1193.964) (-1202.337) [-1198.970] -- 0:01:06
631500 -- (-1198.832) [-1191.532] (-1190.843) (-1198.170) * (-1192.105) [-1193.485] (-1192.620) (-1192.344) -- 0:01:05
632000 -- (-1202.001) (-1198.812) [-1190.077] (-1193.949) * [-1188.480] (-1200.720) (-1191.969) (-1188.976) -- 0:01:05
632500 -- (-1199.035) [-1195.480] (-1197.695) (-1191.679) * (-1197.010) (-1191.661) [-1194.001] (-1198.042) -- 0:01:05
633000 -- (-1198.839) (-1194.423) [-1195.788] (-1195.704) * (-1191.306) (-1198.341) (-1196.856) [-1187.068] -- 0:01:05
633500 -- (-1203.707) (-1197.828) (-1204.895) [-1191.365] * [-1195.851] (-1202.931) (-1191.963) (-1192.331) -- 0:01:05
634000 -- (-1200.344) (-1197.500) [-1197.380] (-1193.166) * (-1197.258) (-1197.822) [-1196.311] (-1190.685) -- 0:01:05
634500 -- (-1197.795) (-1197.013) (-1210.118) [-1191.089] * (-1190.808) [-1191.379] (-1193.271) (-1195.301) -- 0:01:05
635000 -- (-1198.956) [-1200.387] (-1200.389) (-1195.293) * [-1194.502] (-1199.787) (-1193.176) (-1189.251) -- 0:01:05
Average standard deviation of split frequencies: 0.002520
635500 -- [-1192.171] (-1196.090) (-1198.987) (-1194.207) * [-1186.847] (-1197.426) (-1189.730) (-1192.053) -- 0:01:05
636000 -- [-1191.411] (-1196.190) (-1194.845) (-1195.276) * (-1190.460) (-1197.139) (-1190.894) [-1190.332] -- 0:01:05
636500 -- [-1195.253] (-1199.889) (-1200.466) (-1194.739) * (-1194.927) [-1199.882] (-1195.422) (-1191.604) -- 0:01:05
637000 -- (-1202.267) [-1189.278] (-1199.494) (-1194.199) * (-1193.106) [-1188.568] (-1189.749) (-1199.565) -- 0:01:04
637500 -- (-1198.408) [-1190.929] (-1197.896) (-1189.868) * (-1189.874) (-1197.006) [-1193.806] (-1195.321) -- 0:01:04
638000 -- (-1193.824) (-1192.843) [-1192.831] (-1190.807) * (-1197.640) (-1195.932) (-1192.242) [-1194.171] -- 0:01:04
638500 -- (-1201.372) [-1194.398] (-1193.107) (-1193.978) * [-1192.612] (-1193.315) (-1195.069) (-1196.345) -- 0:01:04
639000 -- (-1199.525) [-1194.963] (-1198.221) (-1198.085) * (-1198.279) (-1193.200) (-1199.232) [-1196.170] -- 0:01:04
639500 -- [-1194.040] (-1190.879) (-1197.433) (-1192.062) * (-1200.462) (-1191.499) (-1193.753) [-1196.920] -- 0:01:04
640000 -- (-1193.701) (-1194.447) (-1193.208) [-1188.511] * (-1200.285) (-1197.974) [-1194.796] (-1191.204) -- 0:01:04
Average standard deviation of split frequencies: 0.001913
640500 -- [-1194.899] (-1192.458) (-1192.388) (-1200.478) * (-1194.760) [-1190.788] (-1189.819) (-1194.862) -- 0:01:04
641000 -- (-1201.685) [-1194.683] (-1197.027) (-1192.179) * (-1195.997) (-1192.355) (-1194.011) [-1193.960] -- 0:01:04
641500 -- (-1201.287) (-1193.582) [-1198.876] (-1199.632) * (-1192.436) (-1193.394) (-1199.065) [-1194.419] -- 0:01:04
642000 -- (-1192.569) (-1190.981) (-1191.229) [-1196.339] * (-1194.294) [-1189.725] (-1201.414) (-1205.106) -- 0:01:04
642500 -- [-1198.924] (-1194.962) (-1189.902) (-1194.266) * [-1194.161] (-1191.718) (-1195.459) (-1193.258) -- 0:01:03
643000 -- [-1194.639] (-1200.757) (-1194.571) (-1191.701) * (-1199.939) (-1190.889) [-1192.443] (-1199.174) -- 0:01:03
643500 -- (-1197.206) [-1194.857] (-1191.550) (-1192.443) * [-1195.069] (-1193.486) (-1196.586) (-1192.294) -- 0:01:03
644000 -- (-1195.550) (-1193.594) [-1194.157] (-1192.633) * (-1190.345) [-1196.013] (-1198.126) (-1194.374) -- 0:01:03
644500 -- (-1196.113) (-1194.728) [-1188.626] (-1194.381) * (-1194.231) [-1192.689] (-1196.686) (-1199.347) -- 0:01:03
645000 -- (-1202.282) (-1199.362) (-1198.090) [-1189.448] * (-1190.770) [-1195.696] (-1198.048) (-1195.499) -- 0:01:03
Average standard deviation of split frequencies: 0.002773
645500 -- [-1198.371] (-1200.455) (-1198.037) (-1193.313) * [-1191.415] (-1193.826) (-1203.863) (-1200.605) -- 0:01:03
646000 -- (-1191.667) [-1194.377] (-1197.204) (-1193.460) * (-1191.545) [-1190.530] (-1205.214) (-1198.191) -- 0:01:03
646500 -- (-1196.708) [-1193.369] (-1202.745) (-1195.306) * (-1199.756) [-1192.721] (-1197.220) (-1195.528) -- 0:01:03
647000 -- (-1190.418) [-1194.386] (-1197.278) (-1193.059) * (-1200.116) (-1198.702) [-1200.757] (-1196.238) -- 0:01:03
647500 -- (-1194.686) (-1194.325) (-1187.975) [-1191.115] * (-1199.024) (-1198.165) [-1192.895] (-1197.906) -- 0:01:03
648000 -- (-1192.387) (-1196.142) [-1194.797] (-1195.503) * (-1199.861) (-1192.268) [-1191.800] (-1192.939) -- 0:01:03
648500 -- [-1188.512] (-1197.408) (-1196.032) (-1191.792) * [-1192.354] (-1197.299) (-1193.905) (-1197.561) -- 0:01:02
649000 -- (-1196.115) [-1192.924] (-1199.619) (-1198.389) * [-1194.578] (-1205.751) (-1190.152) (-1210.425) -- 0:01:02
649500 -- [-1187.613] (-1192.804) (-1198.501) (-1204.079) * [-1193.926] (-1196.679) (-1187.328) (-1194.724) -- 0:01:02
650000 -- [-1191.293] (-1193.818) (-1192.870) (-1201.972) * (-1193.351) (-1196.053) (-1197.568) [-1192.961] -- 0:01:02
Average standard deviation of split frequencies: 0.002608
650500 -- [-1193.318] (-1194.475) (-1195.754) (-1195.623) * (-1198.279) (-1191.380) (-1194.457) [-1189.080] -- 0:01:02
651000 -- (-1195.498) [-1191.535] (-1193.478) (-1201.986) * (-1211.142) [-1194.933] (-1193.897) (-1190.388) -- 0:01:02
651500 -- [-1199.663] (-1189.450) (-1197.444) (-1195.462) * (-1201.253) (-1200.789) (-1193.249) [-1191.655] -- 0:01:02
652000 -- [-1195.121] (-1192.453) (-1190.545) (-1195.223) * (-1196.014) (-1194.472) (-1199.949) [-1191.117] -- 0:01:02
652500 -- (-1199.913) (-1191.052) (-1193.745) [-1192.637] * [-1193.217] (-1203.293) (-1193.937) (-1187.997) -- 0:01:02
653000 -- (-1194.792) (-1196.430) [-1194.465] (-1194.115) * (-1198.941) (-1195.023) [-1195.989] (-1192.381) -- 0:01:02
653500 -- (-1195.210) (-1196.955) [-1191.428] (-1194.056) * (-1200.769) (-1194.932) (-1191.091) [-1193.780] -- 0:01:02
654000 -- (-1196.394) [-1193.885] (-1188.593) (-1200.113) * [-1196.670] (-1188.671) (-1192.098) (-1194.485) -- 0:01:01
654500 -- [-1197.380] (-1198.301) (-1190.394) (-1197.884) * (-1194.392) (-1197.191) (-1191.176) [-1192.466] -- 0:01:01
655000 -- (-1190.345) (-1197.445) (-1188.574) [-1198.179] * (-1195.611) (-1193.226) (-1195.892) [-1189.036] -- 0:01:01
Average standard deviation of split frequencies: 0.002874
655500 -- (-1199.329) (-1199.418) (-1195.864) [-1196.545] * (-1193.418) (-1190.198) (-1200.470) [-1193.360] -- 0:01:01
656000 -- (-1196.478) (-1197.075) [-1193.772] (-1203.277) * [-1190.227] (-1190.186) (-1194.054) (-1194.987) -- 0:01:01
656500 -- (-1194.055) (-1194.839) [-1189.521] (-1192.582) * (-1192.072) [-1190.814] (-1198.014) (-1196.816) -- 0:01:01
657000 -- (-1196.865) [-1191.454] (-1197.252) (-1196.661) * (-1202.439) (-1190.933) (-1207.941) [-1187.566] -- 0:01:01
657500 -- [-1191.984] (-1193.718) (-1206.354) (-1195.224) * (-1194.067) [-1188.903] (-1195.507) (-1195.572) -- 0:01:01
658000 -- (-1190.245) (-1192.963) (-1196.386) [-1195.098] * (-1191.392) (-1188.139) (-1197.231) [-1194.928] -- 0:01:01
658500 -- (-1189.689) (-1194.525) [-1191.206] (-1197.680) * (-1197.371) (-1199.298) [-1190.090] (-1195.921) -- 0:01:01
659000 -- (-1187.368) (-1196.819) (-1199.018) [-1197.350] * (-1196.215) (-1196.523) [-1194.268] (-1192.662) -- 0:01:01
659500 -- [-1191.321] (-1199.824) (-1198.795) (-1193.271) * (-1192.585) (-1201.497) [-1193.062] (-1195.797) -- 0:01:00
660000 -- (-1195.394) (-1194.865) (-1205.284) [-1191.973] * (-1196.142) [-1188.585] (-1188.408) (-1196.240) -- 0:01:00
Average standard deviation of split frequencies: 0.002283
660500 -- (-1189.809) (-1195.893) (-1195.523) [-1201.193] * (-1198.469) (-1192.880) (-1190.722) [-1197.472] -- 0:01:00
661000 -- (-1191.187) (-1191.421) (-1193.920) [-1193.478] * (-1206.385) (-1195.807) [-1192.589] (-1195.282) -- 0:01:00
661500 -- [-1189.515] (-1195.655) (-1188.284) (-1198.120) * (-1195.829) [-1189.603] (-1190.973) (-1199.606) -- 0:01:00
662000 -- (-1189.419) [-1188.842] (-1191.074) (-1200.823) * (-1204.526) [-1192.754] (-1197.299) (-1202.323) -- 0:01:00
662500 -- (-1193.343) (-1198.493) (-1194.482) [-1192.649] * [-1194.283] (-1193.634) (-1194.287) (-1195.117) -- 0:01:00
663000 -- (-1194.547) (-1192.975) [-1191.999] (-1196.239) * (-1195.906) (-1196.713) (-1194.034) [-1195.032] -- 0:01:00
663500 -- (-1196.835) [-1197.919] (-1199.708) (-1194.801) * (-1193.233) [-1193.406] (-1193.284) (-1192.247) -- 0:01:00
664000 -- (-1190.503) (-1201.881) (-1192.906) [-1192.292] * [-1193.082] (-1202.190) (-1194.042) (-1197.256) -- 0:01:00
664500 -- (-1197.206) (-1195.263) [-1191.338] (-1197.829) * (-1192.718) [-1195.599] (-1195.914) (-1193.651) -- 0:01:00
665000 -- (-1206.262) (-1202.298) [-1194.075] (-1200.099) * (-1197.360) (-1192.939) (-1190.562) [-1197.868] -- 0:00:59
Average standard deviation of split frequencies: 0.002690
665500 -- (-1191.643) (-1196.936) (-1192.623) [-1198.002] * (-1191.921) (-1196.775) [-1189.763] (-1197.802) -- 0:00:59
666000 -- [-1201.016] (-1201.187) (-1194.767) (-1195.716) * (-1193.780) [-1194.213] (-1202.113) (-1199.847) -- 0:00:59
666500 -- (-1196.155) (-1189.965) [-1197.154] (-1188.104) * (-1196.498) [-1192.833] (-1194.699) (-1192.972) -- 0:00:59
667000 -- (-1196.906) (-1193.738) [-1195.798] (-1199.626) * [-1197.585] (-1198.544) (-1194.782) (-1195.606) -- 0:00:59
667500 -- [-1194.796] (-1195.314) (-1195.069) (-1198.823) * (-1196.504) (-1198.919) [-1193.780] (-1192.916) -- 0:00:59
668000 -- (-1192.996) (-1204.002) [-1195.265] (-1195.675) * (-1200.678) (-1192.944) (-1191.253) [-1199.764] -- 0:00:59
668500 -- [-1194.574] (-1191.887) (-1198.171) (-1192.958) * [-1189.626] (-1189.115) (-1198.139) (-1199.079) -- 0:00:59
669000 -- (-1191.840) (-1195.352) [-1190.199] (-1188.830) * [-1191.166] (-1193.364) (-1195.767) (-1194.335) -- 0:00:59
669500 -- [-1198.700] (-1194.531) (-1192.599) (-1196.013) * (-1190.886) [-1189.484] (-1194.162) (-1194.686) -- 0:00:59
670000 -- [-1189.271] (-1195.697) (-1194.167) (-1198.143) * (-1202.263) [-1189.377] (-1203.197) (-1197.767) -- 0:00:59
Average standard deviation of split frequencies: 0.003796
670500 -- (-1187.668) [-1193.109] (-1205.334) (-1192.828) * (-1192.868) [-1189.812] (-1202.352) (-1188.161) -- 0:00:58
671000 -- (-1200.454) [-1192.311] (-1197.667) (-1189.474) * (-1190.797) [-1191.651] (-1197.305) (-1200.468) -- 0:00:58
671500 -- (-1191.455) (-1195.393) (-1192.592) [-1195.552] * (-1190.764) [-1189.063] (-1195.712) (-1194.481) -- 0:00:58
672000 -- (-1194.390) [-1192.797] (-1193.582) (-1192.218) * [-1196.610] (-1194.243) (-1196.034) (-1194.029) -- 0:00:58
672500 -- [-1192.092] (-1192.531) (-1195.013) (-1196.317) * (-1192.929) [-1191.930] (-1192.809) (-1195.566) -- 0:00:58
673000 -- [-1191.688] (-1195.699) (-1201.073) (-1191.831) * (-1189.231) (-1193.086) (-1191.190) [-1191.240] -- 0:00:58
673500 -- (-1194.787) (-1188.038) [-1191.055] (-1190.938) * (-1191.765) [-1195.523] (-1198.688) (-1194.530) -- 0:00:58
674000 -- [-1191.344] (-1189.969) (-1191.465) (-1197.786) * [-1191.960] (-1194.242) (-1188.551) (-1194.983) -- 0:00:58
674500 -- (-1189.638) (-1188.727) [-1193.270] (-1201.824) * [-1192.400] (-1191.059) (-1192.335) (-1198.624) -- 0:00:58
675000 -- (-1193.844) [-1191.455] (-1198.683) (-1200.775) * (-1191.121) [-1189.847] (-1197.376) (-1191.566) -- 0:00:58
Average standard deviation of split frequencies: 0.003347
675500 -- [-1194.896] (-1197.759) (-1194.761) (-1201.982) * [-1192.335] (-1193.333) (-1192.656) (-1195.954) -- 0:00:58
676000 -- [-1192.467] (-1195.124) (-1192.115) (-1191.521) * [-1192.129] (-1201.577) (-1192.927) (-1198.816) -- 0:00:57
676500 -- (-1193.818) (-1194.264) [-1192.492] (-1198.792) * (-1192.005) (-1196.115) (-1192.186) [-1190.750] -- 0:00:57
677000 -- (-1189.015) (-1195.898) (-1200.574) [-1200.403] * (-1194.354) (-1197.098) [-1195.659] (-1191.468) -- 0:00:57
677500 -- [-1194.566] (-1194.255) (-1202.622) (-1190.591) * (-1195.243) [-1194.881] (-1197.055) (-1198.437) -- 0:00:57
678000 -- (-1190.475) [-1197.876] (-1192.666) (-1195.544) * [-1191.297] (-1201.310) (-1191.771) (-1193.156) -- 0:00:57
678500 -- (-1191.370) [-1191.622] (-1190.219) (-1206.137) * (-1197.321) (-1195.090) (-1195.838) [-1191.272] -- 0:00:57
679000 -- [-1193.090] (-1200.042) (-1194.337) (-1197.507) * [-1193.898] (-1193.714) (-1197.185) (-1196.869) -- 0:00:57
679500 -- (-1198.948) [-1192.615] (-1194.183) (-1191.265) * (-1188.493) [-1188.612] (-1191.198) (-1193.497) -- 0:00:57
680000 -- [-1192.745] (-1201.769) (-1193.408) (-1198.974) * (-1198.288) (-1192.567) (-1194.527) [-1195.998] -- 0:00:57
Average standard deviation of split frequencies: 0.003601
680500 -- [-1192.852] (-1194.098) (-1198.267) (-1202.498) * (-1194.488) [-1193.601] (-1190.948) (-1196.163) -- 0:00:57
681000 -- (-1196.016) (-1197.907) [-1197.084] (-1203.959) * (-1196.977) [-1189.177] (-1194.318) (-1201.374) -- 0:00:57
681500 -- (-1195.881) (-1194.109) (-1190.215) [-1197.358] * [-1194.451] (-1191.739) (-1191.482) (-1204.942) -- 0:00:57
682000 -- (-1212.249) (-1201.588) [-1194.188] (-1195.663) * (-1192.475) (-1192.106) [-1188.138] (-1197.391) -- 0:00:56
682500 -- (-1201.445) (-1203.141) (-1193.988) [-1191.208] * (-1203.893) [-1195.314] (-1192.884) (-1197.301) -- 0:00:56
683000 -- (-1196.731) (-1198.066) (-1193.564) [-1193.211] * (-1195.277) [-1197.358] (-1192.742) (-1190.625) -- 0:00:56
683500 -- (-1194.418) [-1200.589] (-1199.777) (-1192.181) * [-1197.743] (-1187.912) (-1194.313) (-1192.506) -- 0:00:56
684000 -- (-1196.266) (-1198.427) (-1200.583) [-1192.301] * [-1193.341] (-1200.678) (-1190.851) (-1200.657) -- 0:00:56
684500 -- (-1195.888) [-1195.148] (-1194.873) (-1191.549) * (-1196.549) [-1186.566] (-1195.082) (-1201.813) -- 0:00:56
685000 -- (-1187.008) (-1194.210) [-1188.284] (-1192.013) * (-1196.970) [-1189.078] (-1192.116) (-1196.573) -- 0:00:56
Average standard deviation of split frequencies: 0.003848
685500 -- (-1190.491) [-1196.294] (-1200.968) (-1196.856) * (-1199.861) [-1196.167] (-1195.370) (-1196.028) -- 0:00:56
686000 -- (-1202.579) (-1193.970) (-1200.414) [-1198.301] * (-1195.674) (-1193.633) (-1192.249) [-1197.882] -- 0:00:56
686500 -- (-1200.346) (-1197.405) [-1198.491] (-1194.686) * [-1199.503] (-1195.010) (-1197.840) (-1197.670) -- 0:00:56
687000 -- (-1201.919) (-1200.813) (-1201.093) [-1195.360] * (-1192.726) (-1190.236) (-1196.372) [-1196.381] -- 0:00:56
687500 -- [-1192.255] (-1198.343) (-1191.269) (-1199.136) * (-1201.538) [-1196.814] (-1192.127) (-1201.050) -- 0:00:55
688000 -- [-1194.207] (-1196.178) (-1196.818) (-1200.535) * (-1199.766) (-1193.438) [-1189.736] (-1200.027) -- 0:00:55
688500 -- [-1199.518] (-1200.878) (-1199.534) (-1194.890) * (-1194.249) (-1204.545) (-1194.973) [-1195.550] -- 0:00:55
689000 -- [-1194.561] (-1193.525) (-1194.111) (-1196.502) * (-1198.010) (-1207.752) (-1189.878) [-1193.772] -- 0:00:55
689500 -- (-1193.397) [-1193.290] (-1192.127) (-1193.341) * (-1201.521) (-1200.163) (-1195.306) [-1193.177] -- 0:00:55
690000 -- (-1197.612) [-1192.120] (-1193.942) (-1199.597) * (-1194.090) [-1190.287] (-1199.832) (-1200.399) -- 0:00:55
Average standard deviation of split frequencies: 0.004368
690500 -- (-1194.041) [-1193.305] (-1196.480) (-1193.426) * [-1192.373] (-1189.424) (-1192.324) (-1201.974) -- 0:00:55
691000 -- (-1188.251) (-1196.906) [-1191.500] (-1209.065) * (-1197.355) (-1191.947) [-1193.621] (-1196.879) -- 0:00:55
691500 -- (-1196.720) (-1196.809) (-1198.744) [-1199.067] * (-1190.596) [-1191.388] (-1200.759) (-1192.904) -- 0:00:55
692000 -- (-1190.631) (-1190.422) [-1188.973] (-1195.115) * [-1193.605] (-1194.769) (-1199.829) (-1194.455) -- 0:00:55
692500 -- [-1192.091] (-1192.697) (-1196.793) (-1195.348) * (-1191.424) [-1188.959] (-1197.881) (-1200.759) -- 0:00:55
693000 -- (-1188.764) [-1190.759] (-1195.249) (-1201.672) * [-1192.577] (-1193.848) (-1192.190) (-1197.587) -- 0:00:54
693500 -- [-1194.645] (-1194.964) (-1195.625) (-1197.973) * (-1194.635) (-1195.414) [-1194.144] (-1198.749) -- 0:00:54
694000 -- (-1198.207) (-1198.728) (-1202.156) [-1195.131] * (-1200.576) [-1188.469] (-1204.943) (-1196.131) -- 0:00:54
694500 -- [-1191.250] (-1189.762) (-1199.751) (-1191.793) * [-1193.955] (-1198.737) (-1202.702) (-1197.930) -- 0:00:54
695000 -- (-1193.809) (-1203.228) [-1196.438] (-1190.690) * [-1194.957] (-1199.704) (-1199.223) (-1194.121) -- 0:00:54
Average standard deviation of split frequencies: 0.004064
695500 -- (-1192.214) [-1195.533] (-1198.334) (-1190.748) * (-1195.561) [-1193.996] (-1202.220) (-1191.338) -- 0:00:54
696000 -- (-1196.602) (-1188.861) (-1191.722) [-1188.071] * (-1198.365) (-1197.486) (-1189.182) [-1202.655] -- 0:00:54
696500 -- [-1188.396] (-1193.322) (-1190.709) (-1192.261) * (-1201.229) (-1201.636) [-1194.609] (-1189.135) -- 0:00:54
697000 -- (-1194.560) (-1196.667) [-1192.200] (-1193.116) * (-1191.338) [-1191.895] (-1201.587) (-1199.591) -- 0:00:54
697500 -- (-1203.523) (-1188.355) [-1188.330] (-1197.312) * (-1197.720) [-1192.455] (-1197.833) (-1192.983) -- 0:00:54
698000 -- (-1191.227) [-1189.521] (-1192.467) (-1199.277) * (-1194.091) (-1191.531) (-1196.546) [-1196.467] -- 0:00:54
698500 -- (-1191.528) (-1192.954) [-1194.514] (-1194.886) * (-1198.207) [-1190.716] (-1189.713) (-1195.930) -- 0:00:53
699000 -- (-1202.208) (-1190.936) (-1196.346) [-1198.853] * (-1202.638) (-1194.554) (-1193.614) [-1194.010] -- 0:00:53
699500 -- (-1194.305) [-1194.031] (-1196.629) (-1204.432) * (-1200.875) [-1191.377] (-1194.219) (-1195.846) -- 0:00:53
700000 -- (-1195.665) (-1193.888) [-1193.372] (-1200.492) * (-1194.794) (-1187.863) [-1191.092] (-1197.277) -- 0:00:53
Average standard deviation of split frequencies: 0.004171
700500 -- (-1203.883) (-1193.743) [-1191.702] (-1199.040) * [-1199.091] (-1192.457) (-1194.738) (-1196.029) -- 0:00:53
701000 -- (-1196.761) (-1199.230) (-1191.325) [-1194.235] * [-1195.496] (-1196.737) (-1192.328) (-1188.441) -- 0:00:53
701500 -- [-1196.748] (-1195.900) (-1197.978) (-1195.447) * [-1195.692] (-1195.037) (-1192.614) (-1197.446) -- 0:00:53
702000 -- (-1197.894) (-1195.057) [-1189.708] (-1191.251) * (-1198.607) (-1199.880) (-1193.932) [-1195.323] -- 0:00:53
702500 -- (-1198.989) [-1194.708] (-1195.819) (-1191.022) * [-1192.575] (-1200.198) (-1198.976) (-1191.291) -- 0:00:53
703000 -- (-1196.630) (-1189.530) (-1191.477) [-1193.561] * (-1194.559) (-1204.659) [-1193.978] (-1195.897) -- 0:00:53
703500 -- (-1200.092) (-1191.402) [-1199.341] (-1196.381) * (-1199.153) [-1189.946] (-1189.936) (-1191.337) -- 0:00:53
704000 -- (-1194.990) (-1194.427) [-1189.694] (-1193.466) * [-1191.217] (-1196.580) (-1195.052) (-1193.386) -- 0:00:52
704500 -- (-1201.681) [-1191.633] (-1195.188) (-1202.439) * (-1191.371) (-1196.037) [-1199.638] (-1197.605) -- 0:00:52
705000 -- [-1186.983] (-1190.111) (-1194.060) (-1198.605) * (-1199.377) (-1189.279) (-1197.309) [-1192.186] -- 0:00:52
Average standard deviation of split frequencies: 0.004407
705500 -- [-1192.288] (-1194.944) (-1187.579) (-1195.685) * [-1192.133] (-1194.170) (-1202.989) (-1204.317) -- 0:00:52
706000 -- (-1193.988) (-1194.502) (-1191.299) [-1190.298] * (-1189.829) [-1195.962] (-1190.986) (-1192.354) -- 0:00:52
706500 -- [-1191.873] (-1196.696) (-1192.514) (-1197.676) * [-1194.562] (-1199.614) (-1199.326) (-1195.075) -- 0:00:52
707000 -- [-1195.953] (-1196.812) (-1193.363) (-1191.587) * [-1194.597] (-1195.446) (-1193.495) (-1196.306) -- 0:00:52
707500 -- (-1194.642) (-1195.576) [-1190.033] (-1191.747) * (-1193.791) [-1190.759] (-1191.483) (-1196.593) -- 0:00:52
708000 -- (-1190.596) [-1188.439] (-1191.464) (-1195.122) * [-1192.385] (-1195.267) (-1194.000) (-1197.130) -- 0:00:52
708500 -- [-1200.537] (-1191.963) (-1200.925) (-1194.218) * (-1193.886) [-1207.561] (-1191.929) (-1192.068) -- 0:00:52
709000 -- (-1196.320) (-1195.492) [-1199.923] (-1197.381) * [-1194.428] (-1196.553) (-1207.537) (-1188.224) -- 0:00:52
709500 -- [-1191.210] (-1196.921) (-1194.912) (-1195.275) * (-1196.285) (-1193.660) (-1191.561) [-1194.025] -- 0:00:51
710000 -- [-1188.299] (-1198.511) (-1201.042) (-1192.798) * (-1199.526) (-1193.439) (-1198.998) [-1192.147] -- 0:00:51
Average standard deviation of split frequencies: 0.005705
710500 -- (-1198.308) (-1199.231) [-1201.178] (-1190.557) * [-1195.009] (-1199.407) (-1197.009) (-1193.253) -- 0:00:51
711000 -- (-1191.321) (-1198.574) (-1198.245) [-1195.713] * (-1197.053) (-1190.212) (-1196.356) [-1193.238] -- 0:00:51
711500 -- [-1196.014] (-1193.525) (-1192.336) (-1191.967) * (-1196.360) [-1191.731] (-1193.223) (-1189.135) -- 0:00:51
712000 -- (-1188.716) (-1199.822) (-1191.392) [-1197.657] * (-1193.713) (-1197.294) [-1197.837] (-1195.403) -- 0:00:51
712500 -- (-1197.431) (-1200.196) (-1194.362) [-1191.163] * (-1196.226) (-1190.701) [-1197.716] (-1203.551) -- 0:00:51
713000 -- [-1191.029] (-1196.045) (-1194.000) (-1195.121) * (-1188.345) (-1190.181) (-1191.530) [-1193.608] -- 0:00:51
713500 -- [-1189.955] (-1194.420) (-1198.241) (-1192.143) * (-1190.588) (-1193.007) (-1198.758) [-1193.534] -- 0:00:51
714000 -- [-1188.852] (-1190.636) (-1193.748) (-1195.420) * (-1195.860) [-1190.786] (-1195.681) (-1196.160) -- 0:00:51
714500 -- [-1199.349] (-1191.752) (-1193.409) (-1192.398) * (-1193.753) [-1192.755] (-1196.945) (-1196.089) -- 0:00:51
715000 -- (-1197.217) [-1191.789] (-1193.807) (-1190.595) * (-1189.831) (-1199.111) [-1190.749] (-1189.366) -- 0:00:51
Average standard deviation of split frequencies: 0.006584
715500 -- (-1191.495) (-1202.458) [-1196.307] (-1192.669) * (-1198.795) (-1192.387) [-1195.925] (-1188.955) -- 0:00:50
716000 -- [-1191.374] (-1192.886) (-1203.316) (-1194.166) * (-1190.567) (-1191.054) (-1194.915) [-1192.114] -- 0:00:50
716500 -- (-1195.997) (-1189.301) (-1198.523) [-1192.521] * (-1197.333) (-1195.960) (-1195.574) [-1189.459] -- 0:00:50
717000 -- (-1192.509) (-1197.870) (-1197.835) [-1190.186] * (-1194.093) (-1192.526) [-1196.532] (-1190.948) -- 0:00:50
717500 -- [-1194.946] (-1206.837) (-1202.697) (-1187.521) * (-1203.963) (-1196.706) [-1191.829] (-1196.424) -- 0:00:50
718000 -- (-1195.316) [-1193.134] (-1195.235) (-1193.268) * (-1204.214) (-1194.325) [-1193.738] (-1188.103) -- 0:00:50
718500 -- [-1201.341] (-1194.872) (-1201.511) (-1198.274) * (-1196.948) (-1193.543) [-1196.391] (-1193.455) -- 0:00:50
719000 -- (-1194.603) (-1190.420) (-1198.011) [-1195.047] * [-1194.134] (-1201.784) (-1193.175) (-1193.544) -- 0:00:50
719500 -- (-1191.534) (-1192.022) (-1195.754) [-1195.003] * (-1198.125) (-1189.414) (-1201.143) [-1191.839] -- 0:00:50
720000 -- (-1197.499) (-1192.398) (-1194.556) [-1196.826] * (-1198.049) (-1194.597) (-1195.172) [-1189.167] -- 0:00:50
Average standard deviation of split frequencies: 0.006803
720500 -- [-1195.253] (-1200.069) (-1199.084) (-1197.539) * [-1191.356] (-1193.192) (-1196.346) (-1191.227) -- 0:00:50
721000 -- (-1192.823) (-1192.241) (-1197.381) [-1194.941] * (-1191.641) [-1195.891] (-1194.921) (-1197.763) -- 0:00:49
721500 -- (-1191.708) (-1196.508) [-1201.565] (-1198.764) * (-1190.295) [-1199.129] (-1195.247) (-1196.613) -- 0:00:49
722000 -- [-1197.440] (-1194.441) (-1195.765) (-1194.599) * [-1196.376] (-1193.897) (-1192.179) (-1199.273) -- 0:00:49
722500 -- [-1195.084] (-1195.055) (-1192.569) (-1192.464) * (-1194.730) [-1192.181] (-1195.051) (-1198.080) -- 0:00:49
723000 -- (-1193.813) (-1190.868) [-1191.610] (-1201.541) * [-1192.442] (-1194.814) (-1196.339) (-1203.344) -- 0:00:49
723500 -- (-1197.741) (-1199.350) (-1191.276) [-1192.833] * (-1194.299) [-1190.801] (-1197.686) (-1194.143) -- 0:00:49
724000 -- (-1194.494) (-1194.020) [-1188.857] (-1200.179) * (-1195.751) (-1196.382) (-1197.698) [-1196.069] -- 0:00:49
724500 -- (-1193.110) (-1201.827) [-1190.370] (-1188.583) * (-1194.766) (-1191.710) [-1197.305] (-1190.913) -- 0:00:49
725000 -- [-1193.345] (-1197.157) (-1193.716) (-1191.477) * (-1191.550) (-1190.715) [-1198.289] (-1190.722) -- 0:00:49
Average standard deviation of split frequencies: 0.006233
725500 -- (-1198.035) (-1191.302) [-1191.193] (-1195.304) * (-1200.014) (-1193.260) [-1194.648] (-1194.942) -- 0:00:49
726000 -- (-1208.880) (-1194.035) [-1191.705] (-1192.920) * (-1192.790) (-1194.923) [-1196.368] (-1200.654) -- 0:00:49
726500 -- (-1194.059) [-1192.785] (-1194.977) (-1189.711) * (-1192.929) (-1194.355) (-1193.993) [-1194.751] -- 0:00:48
727000 -- (-1204.118) (-1196.659) [-1191.100] (-1192.369) * (-1189.735) [-1191.025] (-1195.629) (-1198.780) -- 0:00:48
727500 -- (-1192.117) [-1193.496] (-1199.456) (-1193.714) * [-1191.452] (-1193.838) (-1192.683) (-1192.161) -- 0:00:48
728000 -- (-1200.567) (-1192.295) (-1197.461) [-1198.432] * (-1197.223) (-1189.656) (-1196.571) [-1196.091] -- 0:00:48
728500 -- (-1190.495) (-1196.618) (-1193.664) [-1205.196] * (-1198.061) [-1192.303] (-1197.734) (-1193.312) -- 0:00:48
729000 -- (-1187.079) [-1196.055] (-1190.939) (-1199.904) * (-1200.630) [-1192.982] (-1194.006) (-1188.079) -- 0:00:48
729500 -- (-1193.712) (-1192.148) [-1199.092] (-1204.492) * [-1197.449] (-1199.255) (-1197.792) (-1193.214) -- 0:00:48
730000 -- [-1196.302] (-1193.189) (-1194.185) (-1198.933) * (-1201.119) (-1192.889) (-1188.834) [-1190.063] -- 0:00:48
Average standard deviation of split frequencies: 0.005936
730500 -- (-1198.697) (-1194.670) [-1192.549] (-1199.618) * (-1195.829) (-1200.157) [-1192.176] (-1194.442) -- 0:00:48
731000 -- (-1196.972) [-1188.209] (-1200.450) (-1199.975) * (-1191.760) [-1191.481] (-1193.334) (-1189.451) -- 0:00:48
731500 -- (-1191.702) [-1190.538] (-1191.910) (-1194.841) * (-1194.333) (-1198.287) (-1191.496) [-1191.657] -- 0:00:48
732000 -- (-1193.283) [-1196.715] (-1198.140) (-1196.086) * (-1197.285) (-1202.907) (-1192.020) [-1196.962] -- 0:00:47
732500 -- (-1198.428) (-1195.531) [-1191.371] (-1198.880) * [-1194.415] (-1203.119) (-1194.963) (-1193.522) -- 0:00:47
733000 -- [-1193.771] (-1192.196) (-1195.474) (-1200.318) * (-1196.327) [-1198.734] (-1201.514) (-1192.210) -- 0:00:47
733500 -- (-1197.336) (-1197.206) (-1187.736) [-1195.395] * (-1198.507) (-1192.537) (-1193.795) [-1192.542] -- 0:00:47
734000 -- (-1201.659) [-1192.786] (-1195.711) (-1195.070) * (-1196.535) [-1192.790] (-1196.615) (-1190.160) -- 0:00:47
734500 -- (-1198.105) [-1194.350] (-1197.567) (-1191.454) * (-1196.368) (-1199.141) (-1197.051) [-1193.626] -- 0:00:47
735000 -- (-1205.321) (-1194.294) [-1194.194] (-1193.476) * [-1191.301] (-1200.424) (-1193.731) (-1194.426) -- 0:00:47
Average standard deviation of split frequencies: 0.006277
735500 -- (-1195.621) [-1190.756] (-1194.842) (-1190.735) * [-1191.327] (-1196.919) (-1194.499) (-1201.860) -- 0:00:47
736000 -- [-1194.660] (-1198.573) (-1192.466) (-1192.911) * (-1192.652) [-1190.605] (-1190.632) (-1193.446) -- 0:00:47
736500 -- (-1195.388) [-1189.623] (-1192.538) (-1195.527) * (-1197.542) (-1191.219) [-1196.352] (-1202.096) -- 0:00:47
737000 -- [-1196.540] (-1192.572) (-1201.955) (-1192.671) * [-1196.375] (-1197.792) (-1198.744) (-1199.059) -- 0:00:47
737500 -- (-1198.766) (-1193.752) [-1191.894] (-1188.762) * [-1192.061] (-1192.156) (-1194.946) (-1193.560) -- 0:00:46
738000 -- (-1191.601) [-1191.860] (-1191.870) (-1191.334) * (-1193.856) [-1190.631] (-1200.058) (-1192.243) -- 0:00:46
738500 -- (-1191.351) (-1192.258) [-1191.459] (-1192.392) * [-1192.610] (-1192.565) (-1190.548) (-1200.794) -- 0:00:46
739000 -- (-1192.253) (-1197.810) [-1191.172] (-1198.024) * (-1197.251) [-1193.778] (-1192.143) (-1198.965) -- 0:00:46
739500 -- (-1198.391) (-1192.972) [-1191.679] (-1192.665) * (-1187.817) [-1196.133] (-1201.857) (-1192.942) -- 0:00:46
740000 -- (-1192.209) (-1200.811) [-1190.285] (-1188.858) * [-1188.727] (-1201.002) (-1197.612) (-1196.138) -- 0:00:46
Average standard deviation of split frequencies: 0.007001
740500 -- (-1189.491) (-1190.422) [-1188.488] (-1200.072) * [-1193.871] (-1205.769) (-1200.711) (-1191.279) -- 0:00:46
741000 -- [-1190.388] (-1194.170) (-1191.882) (-1196.743) * [-1188.883] (-1202.770) (-1191.451) (-1187.603) -- 0:00:46
741500 -- (-1196.238) [-1191.332] (-1201.437) (-1194.177) * (-1193.418) (-1197.608) (-1198.038) [-1187.046] -- 0:00:46
742000 -- (-1193.139) [-1195.241] (-1197.102) (-1196.461) * (-1194.535) [-1195.256] (-1190.160) (-1193.179) -- 0:00:46
742500 -- (-1191.404) (-1192.880) (-1194.114) [-1193.243] * (-1190.459) (-1188.066) [-1191.098] (-1194.976) -- 0:00:46
743000 -- (-1193.919) [-1193.783] (-1193.469) (-1195.127) * (-1194.026) (-1193.134) [-1191.527] (-1191.123) -- 0:00:46
743500 -- (-1193.638) [-1195.122] (-1193.119) (-1196.976) * (-1197.401) [-1195.159] (-1192.218) (-1190.525) -- 0:00:45
744000 -- (-1196.132) [-1192.440] (-1190.721) (-1193.946) * (-1201.956) [-1192.651] (-1195.280) (-1194.640) -- 0:00:45
744500 -- (-1195.894) (-1194.804) [-1194.834] (-1197.177) * (-1193.162) (-1194.743) (-1203.063) [-1193.593] -- 0:00:45
745000 -- [-1193.475] (-1195.232) (-1203.477) (-1193.138) * (-1194.917) (-1193.689) (-1199.701) [-1186.798] -- 0:00:45
Average standard deviation of split frequencies: 0.007457
745500 -- [-1193.874] (-1193.354) (-1189.655) (-1189.425) * (-1189.185) [-1192.494] (-1196.110) (-1203.962) -- 0:00:45
746000 -- (-1197.353) (-1191.229) [-1197.422] (-1187.567) * [-1191.385] (-1194.682) (-1192.867) (-1197.725) -- 0:00:45
746500 -- [-1194.289] (-1194.563) (-1196.837) (-1192.693) * (-1196.708) (-1192.562) (-1195.889) [-1190.895] -- 0:00:45
747000 -- (-1201.691) [-1201.049] (-1189.562) (-1192.434) * (-1202.328) (-1191.105) [-1191.713] (-1190.701) -- 0:00:45
747500 -- (-1194.094) [-1192.381] (-1191.268) (-1190.648) * (-1197.212) (-1195.652) [-1193.218] (-1195.492) -- 0:00:45
748000 -- [-1192.113] (-1203.304) (-1195.620) (-1190.219) * (-1196.047) (-1196.359) [-1191.545] (-1195.538) -- 0:00:45
748500 -- [-1198.775] (-1196.928) (-1192.936) (-1195.211) * (-1196.516) (-1193.279) (-1190.380) [-1190.168] -- 0:00:45
749000 -- (-1194.848) (-1199.878) (-1190.650) [-1192.234] * (-1194.239) (-1203.236) [-1188.159] (-1195.766) -- 0:00:44
749500 -- (-1194.373) (-1202.753) (-1199.896) [-1192.303] * (-1193.506) [-1193.797] (-1200.754) (-1190.309) -- 0:00:44
750000 -- (-1189.660) (-1203.001) [-1189.444] (-1194.122) * (-1199.264) (-1198.336) [-1190.664] (-1190.803) -- 0:00:44
Average standard deviation of split frequencies: 0.006908
750500 -- (-1191.078) (-1195.748) (-1194.386) [-1190.420] * (-1197.313) [-1197.600] (-1199.185) (-1191.311) -- 0:00:44
751000 -- (-1193.111) (-1194.304) [-1194.111] (-1197.792) * (-1199.193) [-1199.470] (-1198.657) (-1199.662) -- 0:00:44
751500 -- (-1191.045) (-1197.625) [-1192.777] (-1190.816) * (-1189.725) (-1196.055) (-1192.909) [-1188.246] -- 0:00:44
752000 -- (-1191.919) [-1192.164] (-1196.299) (-1198.906) * (-1191.896) (-1197.896) [-1196.352] (-1194.681) -- 0:00:44
752500 -- (-1192.938) [-1202.575] (-1193.546) (-1195.605) * [-1195.508] (-1201.174) (-1192.140) (-1196.491) -- 0:00:44
753000 -- (-1197.161) (-1202.050) (-1193.759) [-1191.361] * (-1192.904) (-1195.573) (-1192.785) [-1193.826] -- 0:00:44
753500 -- (-1200.699) (-1200.711) (-1191.148) [-1194.749] * (-1200.896) [-1193.588] (-1194.123) (-1195.948) -- 0:00:44
754000 -- (-1208.696) (-1196.720) [-1188.162] (-1196.259) * (-1197.507) (-1201.497) (-1194.250) [-1194.245] -- 0:00:44
754500 -- (-1199.788) [-1189.466] (-1192.866) (-1193.642) * [-1191.882] (-1192.095) (-1203.003) (-1196.385) -- 0:00:43
755000 -- (-1199.272) (-1195.928) (-1193.711) [-1192.233] * (-1191.582) (-1193.097) (-1196.881) [-1194.591] -- 0:00:43
Average standard deviation of split frequencies: 0.006734
755500 -- (-1199.160) (-1192.622) (-1191.177) [-1191.574] * (-1192.496) (-1193.894) [-1200.300] (-1191.358) -- 0:00:43
756000 -- [-1193.331] (-1193.554) (-1189.131) (-1195.828) * [-1194.536] (-1202.631) (-1193.995) (-1193.108) -- 0:00:43
756500 -- (-1195.721) (-1194.745) [-1189.884] (-1196.743) * (-1197.589) (-1196.524) [-1193.743] (-1192.985) -- 0:00:43
757000 -- (-1206.651) (-1188.951) [-1191.199] (-1200.826) * [-1197.172] (-1191.336) (-1195.098) (-1194.817) -- 0:00:43
757500 -- [-1196.793] (-1192.949) (-1192.912) (-1198.756) * (-1195.575) (-1197.559) (-1194.382) [-1198.593] -- 0:00:43
758000 -- (-1200.433) [-1195.529] (-1192.417) (-1197.165) * (-1191.348) (-1197.749) [-1195.220] (-1203.389) -- 0:00:43
758500 -- (-1193.659) (-1196.572) (-1196.994) [-1191.382] * (-1195.422) [-1199.793] (-1192.940) (-1203.379) -- 0:00:43
759000 -- (-1201.438) (-1196.576) [-1195.130] (-1193.940) * (-1202.423) (-1194.986) (-1194.556) [-1194.687] -- 0:00:43
759500 -- (-1193.776) (-1198.401) (-1197.778) [-1197.129] * (-1194.800) (-1196.792) [-1198.007] (-1204.876) -- 0:00:43
760000 -- [-1192.332] (-1194.052) (-1192.890) (-1196.044) * (-1191.421) (-1195.077) [-1200.295] (-1193.955) -- 0:00:42
Average standard deviation of split frequencies: 0.006445
760500 -- (-1191.929) [-1190.753] (-1202.587) (-1206.048) * (-1194.911) (-1194.709) (-1194.863) [-1194.307] -- 0:00:42
761000 -- (-1189.091) (-1202.507) [-1193.473] (-1194.754) * (-1195.309) (-1197.850) (-1197.955) [-1200.971] -- 0:00:42
761500 -- [-1193.983] (-1192.658) (-1194.250) (-1201.018) * (-1194.881) [-1191.923] (-1192.531) (-1194.897) -- 0:00:42
762000 -- [-1194.539] (-1193.135) (-1195.254) (-1202.127) * [-1191.643] (-1195.633) (-1198.942) (-1190.715) -- 0:00:42
762500 -- (-1200.470) (-1193.402) [-1199.095] (-1199.685) * (-1194.308) (-1188.938) (-1201.930) [-1202.828] -- 0:00:42
763000 -- (-1188.856) [-1192.419] (-1200.437) (-1201.241) * (-1203.470) (-1194.119) [-1191.008] (-1196.753) -- 0:00:42
763500 -- (-1188.304) [-1195.563] (-1199.541) (-1196.480) * [-1200.736] (-1194.556) (-1194.388) (-1196.772) -- 0:00:42
764000 -- (-1197.731) [-1192.130] (-1189.890) (-1197.384) * (-1201.089) (-1193.019) [-1192.565] (-1191.830) -- 0:00:42
764500 -- (-1192.210) (-1191.171) [-1190.072] (-1197.198) * [-1193.705] (-1191.589) (-1201.377) (-1192.485) -- 0:00:42
765000 -- (-1199.301) [-1194.549] (-1195.208) (-1198.129) * (-1192.392) (-1196.559) (-1189.152) [-1193.319] -- 0:00:42
Average standard deviation of split frequencies: 0.005662
765500 -- [-1191.048] (-1197.304) (-1190.453) (-1195.055) * (-1201.211) [-1191.092] (-1193.742) (-1192.563) -- 0:00:41
766000 -- (-1189.041) (-1199.705) [-1192.169] (-1202.300) * (-1191.227) [-1189.143] (-1200.605) (-1194.060) -- 0:00:41
766500 -- (-1195.356) (-1200.580) (-1193.894) [-1190.320] * (-1192.380) (-1200.274) [-1192.266] (-1195.194) -- 0:00:41
767000 -- (-1196.861) [-1193.176] (-1203.621) (-1189.810) * (-1190.090) (-1196.049) (-1202.847) [-1197.785] -- 0:00:41
767500 -- (-1196.004) (-1194.413) [-1195.369] (-1194.472) * [-1190.151] (-1200.269) (-1199.440) (-1194.010) -- 0:00:41
768000 -- (-1197.796) [-1194.366] (-1192.734) (-1189.796) * (-1199.881) (-1192.345) (-1192.846) [-1194.678] -- 0:00:41
768500 -- (-1194.904) (-1195.363) [-1189.448] (-1193.251) * [-1194.176] (-1190.870) (-1194.819) (-1194.714) -- 0:00:41
769000 -- (-1197.201) [-1194.848] (-1198.295) (-1200.608) * [-1194.889] (-1196.532) (-1190.596) (-1193.785) -- 0:00:41
769500 -- (-1195.552) (-1201.045) (-1200.163) [-1195.821] * (-1196.323) (-1199.228) (-1195.739) [-1192.915] -- 0:00:41
770000 -- (-1193.494) (-1194.331) (-1196.098) [-1195.983] * (-1192.439) [-1197.863] (-1196.460) (-1189.734) -- 0:00:41
Average standard deviation of split frequencies: 0.005383
770500 -- (-1196.313) (-1196.090) (-1193.915) [-1192.039] * (-1195.672) (-1202.904) (-1201.777) [-1191.308] -- 0:00:41
771000 -- (-1194.860) (-1204.172) (-1197.080) [-1197.598] * [-1189.840] (-1194.339) (-1200.846) (-1194.464) -- 0:00:40
771500 -- (-1198.903) [-1192.991] (-1197.991) (-1191.409) * [-1199.869] (-1194.949) (-1191.593) (-1197.811) -- 0:00:40
772000 -- (-1191.935) (-1190.005) [-1197.026] (-1191.959) * [-1192.861] (-1196.758) (-1194.483) (-1197.701) -- 0:00:40
772500 -- (-1196.707) (-1190.977) [-1190.856] (-1198.556) * (-1190.679) (-1197.426) [-1189.135] (-1194.431) -- 0:00:40
773000 -- (-1190.152) [-1190.102] (-1204.568) (-1199.447) * (-1201.687) (-1201.657) (-1193.772) [-1190.776] -- 0:00:40
773500 -- [-1192.163] (-1194.023) (-1193.908) (-1195.648) * (-1195.515) (-1195.765) [-1194.117] (-1192.702) -- 0:00:40
774000 -- (-1193.376) [-1191.514] (-1192.907) (-1193.529) * [-1194.512] (-1195.972) (-1193.602) (-1198.294) -- 0:00:40
774500 -- (-1192.911) [-1191.499] (-1193.063) (-1196.487) * (-1197.726) (-1194.463) (-1188.042) [-1196.719] -- 0:00:40
775000 -- [-1190.982] (-1196.757) (-1196.208) (-1197.198) * (-1195.711) [-1191.740] (-1192.546) (-1196.900) -- 0:00:40
Average standard deviation of split frequencies: 0.005346
775500 -- (-1195.860) (-1188.073) [-1189.402] (-1194.773) * [-1195.153] (-1196.606) (-1198.564) (-1193.051) -- 0:00:40
776000 -- (-1195.423) (-1199.079) (-1191.538) [-1191.290] * (-1192.608) [-1192.088] (-1199.283) (-1200.260) -- 0:00:40
776500 -- (-1192.132) (-1194.133) [-1195.405] (-1195.176) * (-1192.104) (-1199.017) (-1188.613) [-1194.024] -- 0:00:40
777000 -- (-1190.835) (-1193.481) (-1198.903) [-1194.088] * [-1197.350] (-1198.797) (-1189.691) (-1193.837) -- 0:00:39
777500 -- (-1196.655) (-1197.917) (-1198.604) [-1193.719] * (-1196.075) (-1199.601) (-1200.599) [-1197.388] -- 0:00:39
778000 -- (-1199.741) [-1191.552] (-1195.423) (-1191.420) * (-1192.321) (-1204.328) [-1196.295] (-1191.678) -- 0:00:39
778500 -- [-1192.777] (-1198.454) (-1189.056) (-1192.762) * (-1197.283) [-1201.510] (-1193.426) (-1190.352) -- 0:00:39
779000 -- [-1193.369] (-1190.544) (-1198.483) (-1203.980) * (-1194.554) (-1197.402) (-1192.604) [-1195.392] -- 0:00:39
779500 -- (-1192.560) (-1200.299) (-1190.310) [-1192.782] * [-1191.568] (-1197.202) (-1190.802) (-1198.017) -- 0:00:39
780000 -- (-1194.076) [-1189.108] (-1199.970) (-1195.066) * (-1191.510) (-1198.618) [-1193.264] (-1190.027) -- 0:00:39
Average standard deviation of split frequencies: 0.005314
780500 -- (-1198.692) (-1194.739) (-1194.331) [-1190.912] * (-1193.727) (-1194.300) (-1196.397) [-1191.923] -- 0:00:39
781000 -- (-1193.627) (-1199.859) [-1193.913] (-1200.734) * (-1197.800) (-1195.399) (-1194.880) [-1189.907] -- 0:00:39
781500 -- (-1195.783) (-1197.401) [-1194.330] (-1199.384) * (-1200.124) [-1189.543] (-1192.249) (-1190.584) -- 0:00:39
782000 -- (-1192.603) (-1210.633) (-1194.049) [-1192.076] * (-1191.435) (-1196.919) (-1196.457) [-1198.956] -- 0:00:39
782500 -- (-1196.581) (-1200.797) (-1199.107) [-1189.043] * (-1200.476) (-1191.171) (-1194.679) [-1193.960] -- 0:00:38
783000 -- (-1194.850) [-1192.390] (-1202.064) (-1191.352) * (-1188.525) [-1189.948] (-1200.534) (-1196.326) -- 0:00:38
783500 -- [-1195.284] (-1204.908) (-1201.327) (-1196.564) * [-1191.097] (-1196.210) (-1197.131) (-1204.772) -- 0:00:38
784000 -- (-1194.197) (-1198.343) [-1198.655] (-1191.673) * (-1191.386) [-1193.188] (-1200.895) (-1195.873) -- 0:00:38
784500 -- (-1197.783) (-1191.783) [-1188.519] (-1195.891) * (-1195.355) (-1193.576) (-1197.615) [-1193.756] -- 0:00:38
785000 -- [-1194.087] (-1196.939) (-1196.415) (-1197.182) * (-1194.900) (-1191.651) [-1190.818] (-1192.853) -- 0:00:38
Average standard deviation of split frequencies: 0.004798
785500 -- (-1192.096) [-1193.822] (-1198.189) (-1194.312) * (-1194.612) [-1198.224] (-1193.221) (-1194.649) -- 0:00:38
786000 -- [-1191.692] (-1192.442) (-1197.904) (-1195.359) * [-1187.862] (-1200.638) (-1192.705) (-1188.917) -- 0:00:38
786500 -- (-1189.900) [-1195.171] (-1200.097) (-1197.053) * [-1187.363] (-1195.922) (-1198.489) (-1194.418) -- 0:00:38
787000 -- [-1192.511] (-1203.610) (-1196.204) (-1202.927) * [-1187.785] (-1195.790) (-1193.426) (-1197.701) -- 0:00:38
787500 -- [-1190.827] (-1196.106) (-1194.381) (-1196.949) * (-1205.542) (-1191.499) [-1186.883] (-1197.018) -- 0:00:38
788000 -- (-1200.711) [-1189.960] (-1190.427) (-1196.449) * (-1195.821) (-1195.836) [-1190.959] (-1197.461) -- 0:00:37
788500 -- (-1198.176) (-1188.295) (-1197.406) [-1194.764] * (-1191.232) (-1191.035) [-1194.232] (-1198.792) -- 0:00:37
789000 -- (-1198.806) (-1190.242) [-1197.176] (-1195.454) * [-1188.826] (-1196.547) (-1194.857) (-1191.076) -- 0:00:37
789500 -- [-1188.409] (-1198.693) (-1191.835) (-1189.163) * (-1197.638) (-1196.995) (-1191.680) [-1195.115] -- 0:00:37
790000 -- (-1193.041) (-1193.849) [-1190.560] (-1190.945) * (-1192.511) (-1190.234) (-1197.932) [-1189.448] -- 0:00:37
Average standard deviation of split frequencies: 0.004531
790500 -- [-1189.582] (-1199.167) (-1192.032) (-1189.755) * [-1189.784] (-1200.480) (-1194.467) (-1195.987) -- 0:00:37
791000 -- (-1194.751) [-1193.466] (-1202.444) (-1201.513) * (-1192.892) [-1195.403] (-1200.584) (-1194.868) -- 0:00:37
791500 -- [-1188.545] (-1193.405) (-1196.738) (-1192.575) * [-1194.188] (-1193.740) (-1200.101) (-1191.109) -- 0:00:37
792000 -- (-1191.578) (-1197.859) (-1193.868) [-1194.721] * (-1192.005) [-1193.184] (-1198.332) (-1188.710) -- 0:00:37
792500 -- [-1193.958] (-1197.497) (-1204.945) (-1203.279) * (-1191.984) (-1196.677) [-1193.863] (-1193.528) -- 0:00:37
793000 -- [-1193.778] (-1193.368) (-1201.568) (-1194.962) * [-1190.467] (-1200.249) (-1192.713) (-1193.819) -- 0:00:37
793500 -- (-1199.486) (-1188.841) (-1193.205) [-1195.043] * (-1188.946) (-1199.006) [-1194.761] (-1199.236) -- 0:00:36
794000 -- [-1195.328] (-1190.820) (-1192.522) (-1195.317) * [-1192.146] (-1196.144) (-1198.879) (-1195.825) -- 0:00:36
794500 -- (-1202.102) (-1192.999) (-1197.530) [-1196.235] * (-1195.387) (-1192.588) [-1188.690] (-1192.784) -- 0:00:36
795000 -- (-1198.776) (-1194.159) (-1193.833) [-1192.077] * [-1191.555] (-1193.980) (-1192.616) (-1204.369) -- 0:00:36
Average standard deviation of split frequencies: 0.004856
795500 -- (-1191.366) (-1190.747) (-1198.011) [-1190.959] * [-1199.766] (-1195.493) (-1196.801) (-1203.881) -- 0:00:36
796000 -- (-1198.681) [-1193.917] (-1197.749) (-1191.981) * (-1195.482) [-1195.746] (-1192.416) (-1189.549) -- 0:00:36
796500 -- [-1191.009] (-1202.484) (-1193.072) (-1190.547) * (-1199.468) [-1193.286] (-1193.325) (-1192.695) -- 0:00:36
797000 -- (-1199.663) (-1206.581) [-1194.669] (-1202.008) * (-1202.535) [-1198.208] (-1192.520) (-1193.248) -- 0:00:36
797500 -- (-1194.839) (-1195.637) [-1194.684] (-1198.566) * (-1201.127) (-1189.564) [-1192.302] (-1197.701) -- 0:00:36
798000 -- [-1195.813] (-1191.349) (-1192.834) (-1193.955) * (-1201.476) (-1195.497) [-1192.089] (-1195.454) -- 0:00:36
798500 -- [-1196.295] (-1197.747) (-1198.943) (-1196.056) * (-1193.980) (-1185.437) (-1194.734) [-1195.095] -- 0:00:36
799000 -- [-1198.449] (-1202.172) (-1192.185) (-1194.795) * (-1189.100) [-1189.265] (-1192.056) (-1190.836) -- 0:00:35
799500 -- [-1197.774] (-1191.283) (-1193.299) (-1200.375) * (-1191.157) (-1193.969) (-1195.562) [-1198.539] -- 0:00:35
800000 -- [-1196.352] (-1193.394) (-1191.452) (-1201.199) * (-1193.268) [-1194.512] (-1191.782) (-1200.691) -- 0:00:35
Average standard deviation of split frequencies: 0.004946
800500 -- [-1193.451] (-1197.518) (-1192.664) (-1193.931) * [-1189.894] (-1197.921) (-1199.503) (-1189.422) -- 0:00:35
801000 -- (-1206.379) (-1190.338) [-1193.208] (-1193.027) * (-1191.334) (-1201.205) [-1202.275] (-1194.118) -- 0:00:35
801500 -- (-1194.949) [-1192.175] (-1192.318) (-1190.847) * (-1193.948) (-1195.647) [-1196.436] (-1194.833) -- 0:00:35
802000 -- (-1196.714) [-1191.994] (-1191.486) (-1202.875) * (-1198.530) (-1196.001) (-1190.954) [-1188.475] -- 0:00:35
802500 -- (-1196.371) (-1199.054) [-1194.620] (-1201.397) * (-1207.792) [-1189.688] (-1194.563) (-1192.477) -- 0:00:35
803000 -- (-1194.893) [-1190.699] (-1198.526) (-1200.388) * (-1196.049) [-1194.112] (-1202.309) (-1199.618) -- 0:00:35
803500 -- (-1193.602) [-1189.646] (-1196.951) (-1202.449) * (-1202.413) (-1190.425) (-1199.299) [-1192.104] -- 0:00:35
804000 -- (-1199.559) [-1191.129] (-1198.014) (-1197.013) * (-1193.772) (-1195.358) [-1203.709] (-1200.170) -- 0:00:35
804500 -- (-1194.883) [-1190.194] (-1203.769) (-1202.341) * (-1197.141) (-1195.731) [-1199.133] (-1201.689) -- 0:00:34
805000 -- (-1199.969) [-1190.218] (-1206.251) (-1196.904) * (-1198.561) (-1193.353) (-1196.137) [-1194.675] -- 0:00:34
Average standard deviation of split frequencies: 0.004679
805500 -- (-1194.313) [-1193.038] (-1201.640) (-1197.232) * (-1207.208) (-1195.019) (-1198.817) [-1194.458] -- 0:00:34
806000 -- [-1190.863] (-1195.704) (-1198.751) (-1199.092) * (-1195.049) (-1189.469) (-1198.716) [-1195.399] -- 0:00:34
806500 -- (-1197.911) (-1195.857) (-1192.189) [-1195.908] * (-1197.912) [-1195.502] (-1197.166) (-1194.395) -- 0:00:34
807000 -- (-1193.324) [-1192.478] (-1194.736) (-1192.506) * (-1192.320) [-1192.736] (-1188.482) (-1196.453) -- 0:00:34
807500 -- (-1193.099) (-1194.791) (-1199.710) [-1198.394] * (-1193.391) (-1193.269) (-1197.152) [-1194.410] -- 0:00:34
808000 -- (-1194.321) [-1198.945] (-1196.170) (-1192.922) * (-1200.345) (-1191.341) [-1193.569] (-1197.301) -- 0:00:34
808500 -- (-1193.227) [-1191.632] (-1191.610) (-1195.367) * (-1202.142) (-1192.654) [-1190.925] (-1196.495) -- 0:00:34
809000 -- (-1195.071) [-1189.282] (-1193.365) (-1193.637) * (-1199.278) [-1195.630] (-1194.506) (-1194.360) -- 0:00:34
809500 -- (-1202.040) (-1190.295) [-1185.617] (-1192.759) * [-1202.320] (-1202.253) (-1198.687) (-1192.028) -- 0:00:34
810000 -- [-1192.044] (-1204.170) (-1193.291) (-1196.475) * (-1200.935) [-1210.797] (-1196.070) (-1204.280) -- 0:00:34
Average standard deviation of split frequencies: 0.005466
810500 -- (-1195.450) (-1200.340) (-1190.831) [-1194.709] * [-1190.775] (-1191.912) (-1193.854) (-1198.595) -- 0:00:33
811000 -- [-1197.454] (-1192.866) (-1191.943) (-1193.169) * (-1192.506) [-1192.897] (-1197.153) (-1194.569) -- 0:00:33
811500 -- (-1206.224) (-1194.710) (-1191.722) [-1191.161] * (-1191.785) (-1190.811) (-1195.115) [-1195.726] -- 0:00:33
812000 -- (-1209.245) [-1193.855] (-1190.849) (-1191.760) * (-1196.180) (-1198.606) (-1201.418) [-1192.552] -- 0:00:33
812500 -- (-1202.535) (-1193.738) [-1190.819] (-1192.623) * (-1195.156) (-1194.325) [-1195.861] (-1200.575) -- 0:00:33
813000 -- (-1209.112) (-1200.979) (-1191.069) [-1191.145] * (-1198.601) [-1191.288] (-1190.656) (-1193.586) -- 0:00:33
813500 -- (-1203.828) (-1205.006) (-1197.094) [-1201.282] * (-1201.366) (-1194.611) (-1192.687) [-1195.310] -- 0:00:33
814000 -- (-1196.311) (-1195.183) (-1187.939) [-1197.363] * (-1190.354) [-1194.107] (-1190.147) (-1194.797) -- 0:00:33
814500 -- (-1195.753) (-1190.684) (-1209.065) [-1195.534] * (-1194.160) [-1191.138] (-1201.091) (-1188.308) -- 0:00:33
815000 -- [-1190.423] (-1203.703) (-1188.907) (-1196.642) * (-1197.401) (-1192.231) (-1191.050) [-1192.307] -- 0:00:33
Average standard deviation of split frequencies: 0.006124
815500 -- (-1188.938) (-1192.925) (-1192.291) [-1191.355] * (-1194.172) (-1190.247) (-1200.316) [-1192.659] -- 0:00:33
816000 -- (-1194.161) (-1191.412) [-1192.887] (-1197.241) * (-1199.225) (-1193.522) (-1195.862) [-1193.186] -- 0:00:32
816500 -- (-1194.301) (-1196.540) [-1195.432] (-1194.801) * (-1194.545) (-1189.994) [-1197.398] (-1189.897) -- 0:00:32
817000 -- (-1188.128) [-1194.196] (-1191.012) (-1201.107) * (-1195.266) (-1192.231) [-1188.272] (-1201.070) -- 0:00:32
817500 -- [-1190.380] (-1196.981) (-1192.876) (-1192.043) * (-1194.995) [-1195.252] (-1197.763) (-1198.063) -- 0:00:32
818000 -- (-1194.342) (-1207.165) (-1193.538) [-1186.776] * [-1196.162] (-1202.311) (-1192.456) (-1195.146) -- 0:00:32
818500 -- (-1196.987) (-1195.793) [-1198.062] (-1193.368) * (-1192.443) (-1193.288) [-1192.988] (-1194.166) -- 0:00:32
819000 -- (-1199.165) [-1188.897] (-1191.598) (-1190.464) * (-1197.861) (-1205.756) (-1192.595) [-1191.468] -- 0:00:32
819500 -- (-1194.644) (-1193.470) [-1188.230] (-1199.372) * (-1194.376) (-1194.711) (-1191.436) [-1190.108] -- 0:00:32
820000 -- (-1199.614) (-1200.460) (-1190.450) [-1199.006] * [-1190.237] (-1197.455) (-1191.912) (-1202.126) -- 0:00:32
Average standard deviation of split frequencies: 0.006089
820500 -- [-1196.786] (-1192.706) (-1195.057) (-1192.014) * [-1192.998] (-1194.491) (-1190.999) (-1193.720) -- 0:00:32
821000 -- (-1197.398) (-1193.076) [-1191.506] (-1197.378) * (-1190.481) [-1188.633] (-1195.377) (-1188.190) -- 0:00:32
821500 -- (-1190.533) [-1193.496] (-1191.034) (-1195.677) * (-1195.517) [-1193.217] (-1198.678) (-1198.178) -- 0:00:31
822000 -- (-1194.333) (-1194.428) (-1191.429) [-1193.013] * (-1198.079) [-1193.985] (-1195.821) (-1199.492) -- 0:00:31
822500 -- (-1195.349) (-1190.931) (-1198.418) [-1191.320] * [-1191.191] (-1190.510) (-1195.964) (-1197.472) -- 0:00:31
823000 -- (-1197.170) (-1191.138) (-1191.952) [-1190.356] * (-1197.953) (-1201.626) (-1197.025) [-1198.161] -- 0:00:31
823500 -- (-1192.333) (-1193.705) [-1194.456] (-1201.128) * (-1192.761) [-1192.229] (-1192.622) (-1202.175) -- 0:00:31
824000 -- (-1199.989) (-1198.899) [-1193.677] (-1197.834) * (-1192.668) (-1201.291) (-1201.200) [-1196.411] -- 0:00:31
824500 -- (-1195.368) (-1192.743) [-1196.950] (-1201.262) * [-1191.621] (-1203.343) (-1198.737) (-1202.630) -- 0:00:31
825000 -- (-1202.472) (-1196.934) (-1197.978) [-1191.147] * (-1198.792) (-1196.319) [-1197.139] (-1196.353) -- 0:00:31
Average standard deviation of split frequencies: 0.006050
825500 -- (-1193.555) (-1193.275) [-1192.969] (-1195.515) * (-1193.589) (-1198.799) [-1195.504] (-1203.261) -- 0:00:31
826000 -- [-1191.792] (-1192.767) (-1201.562) (-1198.878) * [-1192.417] (-1198.529) (-1195.230) (-1197.278) -- 0:00:31
826500 -- (-1191.020) [-1197.798] (-1193.956) (-1195.800) * (-1193.464) [-1199.716] (-1196.409) (-1195.914) -- 0:00:31
827000 -- (-1191.237) [-1192.220] (-1199.205) (-1198.755) * (-1191.836) (-1196.318) [-1195.122] (-1191.122) -- 0:00:30
827500 -- (-1192.068) (-1190.522) [-1195.798] (-1195.081) * (-1194.582) [-1191.299] (-1187.619) (-1191.169) -- 0:00:30
828000 -- (-1190.781) [-1189.777] (-1197.265) (-1191.574) * (-1198.675) (-1194.212) [-1190.788] (-1190.461) -- 0:00:30
828500 -- [-1194.969] (-1190.533) (-1201.710) (-1200.028) * (-1202.429) (-1192.812) (-1193.050) [-1195.028] -- 0:00:30
829000 -- (-1193.221) (-1191.254) (-1197.368) [-1199.547] * (-1193.794) [-1194.606] (-1193.975) (-1196.049) -- 0:00:30
829500 -- (-1190.867) [-1192.119] (-1193.693) (-1192.187) * (-1195.914) (-1196.990) [-1194.806] (-1188.819) -- 0:00:30
830000 -- (-1191.169) [-1189.819] (-1200.791) (-1195.011) * (-1195.727) (-1192.583) (-1191.379) [-1195.586] -- 0:00:30
Average standard deviation of split frequencies: 0.006697
830500 -- (-1196.550) [-1199.208] (-1193.407) (-1196.097) * (-1197.702) [-1193.750] (-1192.238) (-1195.358) -- 0:00:30
831000 -- (-1201.897) (-1197.756) (-1189.160) [-1195.524] * (-1192.674) [-1190.649] (-1188.980) (-1207.419) -- 0:00:30
831500 -- (-1203.697) [-1194.500] (-1195.579) (-1197.935) * (-1192.759) (-1191.911) (-1197.069) [-1195.368] -- 0:00:30
832000 -- (-1202.896) (-1202.366) [-1190.873] (-1196.016) * (-1196.337) (-1197.087) (-1200.149) [-1191.359] -- 0:00:30
832500 -- (-1207.313) [-1192.115] (-1191.060) (-1198.006) * (-1198.547) (-1193.365) [-1191.151] (-1194.601) -- 0:00:29
833000 -- (-1199.573) (-1195.280) (-1193.466) [-1195.973] * (-1199.444) (-1198.362) (-1192.432) [-1194.496] -- 0:00:29
833500 -- (-1189.158) (-1195.276) [-1193.946] (-1194.428) * [-1188.185] (-1190.400) (-1194.080) (-1196.994) -- 0:00:29
834000 -- (-1190.378) (-1191.101) (-1203.780) [-1191.160] * [-1193.516] (-1189.661) (-1202.489) (-1193.581) -- 0:00:29
834500 -- (-1194.328) [-1196.415] (-1191.325) (-1194.526) * [-1191.336] (-1191.794) (-1192.212) (-1194.933) -- 0:00:29
835000 -- [-1192.813] (-1189.768) (-1191.815) (-1196.021) * [-1195.263] (-1188.670) (-1204.076) (-1192.347) -- 0:00:29
Average standard deviation of split frequencies: 0.006541
835500 -- (-1193.850) (-1187.262) (-1197.395) [-1190.639] * [-1192.486] (-1191.146) (-1196.527) (-1199.070) -- 0:00:29
836000 -- (-1190.349) (-1201.223) [-1190.426] (-1198.546) * (-1191.711) (-1193.303) [-1192.031] (-1193.244) -- 0:00:29
836500 -- (-1193.525) [-1192.557] (-1188.357) (-1197.404) * (-1201.319) [-1195.915] (-1194.360) (-1191.143) -- 0:00:29
837000 -- (-1206.266) (-1189.144) (-1191.482) [-1200.988] * (-1196.748) (-1190.998) (-1211.496) [-1193.503] -- 0:00:29
837500 -- (-1197.654) (-1193.529) [-1190.924] (-1195.382) * (-1195.314) (-1192.017) (-1208.259) [-1194.417] -- 0:00:29
838000 -- (-1201.601) (-1196.445) (-1192.131) [-1193.243] * (-1194.600) (-1205.626) [-1195.835] (-1191.560) -- 0:00:28
838500 -- (-1200.924) (-1196.576) (-1191.130) [-1195.942] * (-1191.912) (-1188.313) [-1189.261] (-1193.833) -- 0:00:28
839000 -- (-1208.778) (-1193.816) [-1193.143] (-1203.804) * (-1192.464) [-1191.260] (-1195.350) (-1194.325) -- 0:00:28
839500 -- (-1203.455) (-1194.913) [-1190.294] (-1189.832) * (-1192.136) (-1197.578) (-1189.868) [-1191.509] -- 0:00:28
840000 -- [-1198.432] (-1192.705) (-1200.650) (-1200.936) * (-1194.001) (-1195.863) [-1189.981] (-1196.422) -- 0:00:28
Average standard deviation of split frequencies: 0.006953
840500 -- [-1192.924] (-1189.917) (-1191.472) (-1197.554) * (-1197.166) (-1197.752) [-1194.761] (-1200.614) -- 0:00:28
841000 -- [-1190.549] (-1191.599) (-1197.322) (-1190.520) * (-1190.894) (-1196.766) [-1194.085] (-1193.156) -- 0:00:28
841500 -- (-1195.976) (-1194.959) [-1191.140] (-1189.396) * [-1195.970] (-1196.067) (-1191.838) (-1197.412) -- 0:00:28
842000 -- (-1193.004) [-1191.316] (-1196.804) (-1200.196) * (-1191.726) (-1202.196) (-1191.490) [-1188.236] -- 0:00:28
842500 -- (-1191.377) [-1196.171] (-1190.779) (-1194.122) * (-1194.498) (-1203.123) [-1192.353] (-1189.450) -- 0:00:28
843000 -- (-1201.124) (-1194.177) (-1196.143) [-1192.680] * (-1193.089) [-1193.651] (-1194.808) (-1189.755) -- 0:00:28
843500 -- (-1197.439) (-1197.887) (-1193.612) [-1197.225] * (-1192.599) (-1190.102) [-1196.764] (-1192.740) -- 0:00:28
844000 -- (-1200.518) (-1196.752) [-1190.274] (-1198.564) * (-1193.064) (-1193.439) [-1193.618] (-1192.667) -- 0:00:27
844500 -- (-1194.948) (-1195.284) [-1190.194] (-1198.084) * (-1199.502) [-1192.813] (-1193.630) (-1194.724) -- 0:00:27
845000 -- (-1201.981) (-1196.111) [-1194.844] (-1194.042) * (-1193.872) (-1196.227) [-1194.032] (-1194.253) -- 0:00:27
Average standard deviation of split frequencies: 0.006909
845500 -- (-1193.974) (-1195.919) (-1198.112) [-1194.935] * (-1214.745) (-1199.215) [-1189.920] (-1191.792) -- 0:00:27
846000 -- (-1198.733) (-1192.546) (-1191.414) [-1199.810] * (-1200.648) (-1200.497) [-1190.639] (-1193.164) -- 0:00:27
846500 -- (-1191.729) (-1196.833) [-1190.209] (-1200.771) * [-1198.897] (-1197.294) (-1190.133) (-1192.176) -- 0:00:27
847000 -- (-1204.354) (-1196.659) (-1196.142) [-1198.394] * (-1194.149) (-1195.964) (-1189.922) [-1192.067] -- 0:00:27
847500 -- (-1196.434) (-1202.924) [-1193.656] (-1198.973) * (-1200.766) (-1200.999) [-1195.032] (-1194.655) -- 0:00:27
848000 -- (-1202.089) (-1190.181) [-1196.455] (-1195.985) * (-1192.795) (-1209.057) [-1193.987] (-1200.540) -- 0:00:27
848500 -- (-1193.789) (-1195.672) (-1193.560) [-1195.889] * (-1200.268) (-1207.687) [-1191.381] (-1202.726) -- 0:00:27
849000 -- (-1190.995) [-1192.121] (-1195.595) (-1202.261) * (-1193.349) (-1196.567) (-1189.560) [-1187.813] -- 0:00:27
849500 -- (-1198.857) (-1195.334) [-1191.212] (-1199.821) * [-1196.860] (-1197.598) (-1186.161) (-1194.904) -- 0:00:26
850000 -- [-1194.154] (-1188.216) (-1197.560) (-1194.713) * [-1200.297] (-1204.520) (-1188.043) (-1194.825) -- 0:00:26
Average standard deviation of split frequencies: 0.007204
850500 -- [-1191.902] (-1200.078) (-1195.046) (-1195.551) * (-1190.844) (-1193.910) (-1203.414) [-1193.525] -- 0:00:26
851000 -- (-1203.015) (-1190.333) (-1195.174) [-1194.849] * (-1201.558) (-1192.394) [-1189.956] (-1192.402) -- 0:00:26
851500 -- (-1198.347) (-1197.330) [-1192.854] (-1188.654) * (-1210.269) (-1197.303) [-1189.565] (-1194.505) -- 0:00:26
852000 -- [-1195.499] (-1192.249) (-1191.434) (-1193.726) * (-1195.200) (-1201.755) (-1190.485) [-1192.520] -- 0:00:26
852500 -- (-1197.724) (-1198.038) (-1190.725) [-1191.048] * (-1192.993) (-1193.502) (-1191.405) [-1190.591] -- 0:00:26
853000 -- (-1190.717) (-1195.499) (-1200.005) [-1197.212] * (-1201.795) [-1190.378] (-1192.438) (-1189.137) -- 0:00:26
853500 -- [-1200.234] (-1198.444) (-1191.621) (-1198.898) * (-1198.249) [-1192.847] (-1191.059) (-1194.165) -- 0:00:26
854000 -- (-1197.132) (-1198.959) (-1194.604) [-1195.321] * (-1194.153) [-1196.807] (-1191.914) (-1199.689) -- 0:00:26
854500 -- [-1195.037] (-1191.380) (-1199.073) (-1196.438) * (-1195.466) (-1198.433) [-1193.589] (-1198.271) -- 0:00:26
855000 -- (-1193.724) (-1196.486) [-1192.349] (-1193.667) * (-1201.554) (-1194.965) [-1191.714] (-1189.149) -- 0:00:25
Average standard deviation of split frequencies: 0.006278
855500 -- (-1190.256) (-1194.219) (-1192.608) [-1194.896] * (-1193.419) [-1201.136] (-1196.466) (-1191.940) -- 0:00:25
856000 -- [-1192.842] (-1194.515) (-1190.485) (-1196.590) * (-1194.014) (-1191.727) (-1194.306) [-1193.755] -- 0:00:25
856500 -- [-1194.277] (-1196.514) (-1196.823) (-1192.211) * (-1202.320) [-1195.972] (-1200.005) (-1191.122) -- 0:00:25
857000 -- (-1194.378) (-1197.737) [-1195.180] (-1195.301) * [-1190.154] (-1197.507) (-1195.328) (-1196.383) -- 0:00:25
857500 -- (-1193.619) (-1196.250) [-1188.853] (-1189.339) * [-1196.079] (-1198.675) (-1194.718) (-1189.461) -- 0:00:25
858000 -- (-1197.594) (-1195.037) [-1197.226] (-1195.760) * (-1197.396) (-1192.246) (-1195.729) [-1191.502] -- 0:00:25
858500 -- (-1195.319) (-1198.668) [-1193.200] (-1191.403) * (-1192.677) (-1192.704) (-1194.078) [-1195.769] -- 0:00:25
859000 -- (-1194.020) [-1198.547] (-1199.451) (-1190.207) * (-1190.393) [-1193.324] (-1192.225) (-1191.767) -- 0:00:25
859500 -- (-1196.680) (-1205.981) (-1194.764) [-1190.149] * (-1191.323) (-1191.532) [-1190.790] (-1199.845) -- 0:00:25
860000 -- (-1193.959) (-1200.438) (-1197.469) [-1193.158] * (-1192.788) [-1190.713] (-1190.622) (-1201.308) -- 0:00:25
Average standard deviation of split frequencies: 0.007339
860500 -- (-1199.507) (-1191.756) (-1196.708) [-1192.688] * [-1190.665] (-1191.346) (-1194.215) (-1194.001) -- 0:00:24
861000 -- (-1200.856) (-1198.345) [-1190.783] (-1193.401) * (-1193.614) (-1191.659) (-1199.237) [-1194.957] -- 0:00:24
861500 -- (-1198.833) [-1196.840] (-1190.683) (-1192.317) * [-1190.788] (-1197.018) (-1197.178) (-1192.703) -- 0:00:24
862000 -- (-1196.348) (-1201.593) [-1195.827] (-1191.660) * (-1195.466) [-1193.874] (-1194.889) (-1189.956) -- 0:00:24
862500 -- (-1198.245) (-1195.103) [-1194.344] (-1200.374) * [-1199.855] (-1197.276) (-1196.481) (-1199.387) -- 0:00:24
863000 -- (-1192.329) (-1199.173) (-1188.523) [-1193.041] * (-1196.906) (-1191.601) (-1197.184) [-1187.592] -- 0:00:24
863500 -- [-1193.413] (-1193.086) (-1197.453) (-1194.694) * [-1196.899] (-1193.957) (-1199.717) (-1191.421) -- 0:00:24
864000 -- (-1201.973) [-1195.524] (-1195.481) (-1189.962) * [-1196.843] (-1207.334) (-1189.178) (-1193.350) -- 0:00:24
864500 -- [-1190.729] (-1192.804) (-1198.314) (-1197.604) * (-1196.139) (-1207.908) (-1194.888) [-1188.618] -- 0:00:24
865000 -- [-1193.458] (-1191.729) (-1191.923) (-1191.050) * (-1190.760) [-1201.492] (-1206.033) (-1193.079) -- 0:00:24
Average standard deviation of split frequencies: 0.007730
865500 -- (-1195.644) (-1189.285) [-1193.632] (-1196.074) * [-1189.967] (-1195.738) (-1197.075) (-1189.976) -- 0:00:24
866000 -- (-1188.240) [-1188.084] (-1196.889) (-1194.178) * (-1198.072) (-1197.087) [-1204.936] (-1193.275) -- 0:00:23
866500 -- (-1196.793) [-1197.275] (-1202.087) (-1191.474) * (-1193.824) [-1190.461] (-1193.834) (-1192.301) -- 0:00:23
867000 -- [-1194.115] (-1194.801) (-1207.459) (-1197.779) * [-1191.539] (-1194.817) (-1193.843) (-1197.431) -- 0:00:23
867500 -- (-1191.357) [-1190.652] (-1196.374) (-1195.497) * (-1197.255) [-1195.571] (-1190.739) (-1201.511) -- 0:00:23
868000 -- (-1193.168) (-1198.558) [-1190.586] (-1195.148) * (-1201.875) (-1197.855) [-1190.222] (-1199.232) -- 0:00:23
868500 -- (-1194.901) (-1199.442) [-1190.882] (-1192.460) * [-1196.328] (-1194.722) (-1195.077) (-1191.281) -- 0:00:23
869000 -- [-1190.799] (-1192.892) (-1192.780) (-1190.321) * (-1191.104) (-1191.860) (-1191.973) [-1195.902] -- 0:00:23
869500 -- [-1194.503] (-1196.125) (-1195.880) (-1193.172) * [-1189.583] (-1196.026) (-1192.469) (-1190.343) -- 0:00:23
870000 -- (-1189.375) (-1196.173) (-1200.030) [-1194.007] * (-1194.597) (-1200.034) (-1198.297) [-1186.755] -- 0:00:23
Average standard deviation of split frequencies: 0.007363
870500 -- (-1189.563) [-1197.404] (-1194.516) (-1196.558) * [-1192.487] (-1191.753) (-1192.409) (-1193.636) -- 0:00:23
871000 -- [-1192.393] (-1199.758) (-1194.525) (-1189.457) * [-1198.627] (-1191.379) (-1198.451) (-1196.363) -- 0:00:23
871500 -- (-1196.172) (-1191.899) [-1189.994] (-1198.703) * (-1192.550) [-1191.689] (-1197.266) (-1191.675) -- 0:00:23
872000 -- (-1193.720) [-1192.315] (-1191.796) (-1201.815) * (-1192.225) [-1192.740] (-1190.713) (-1196.833) -- 0:00:22
872500 -- (-1190.298) (-1201.722) (-1196.399) [-1194.852] * (-1190.211) [-1189.515] (-1198.415) (-1203.514) -- 0:00:22
873000 -- (-1197.753) (-1196.687) (-1193.512) [-1190.610] * (-1193.490) [-1193.316] (-1193.396) (-1203.532) -- 0:00:22
873500 -- (-1197.740) (-1197.187) (-1194.382) [-1191.775] * (-1198.637) (-1195.494) [-1191.957] (-1198.139) -- 0:00:22
874000 -- (-1198.403) (-1197.653) (-1194.203) [-1194.096] * (-1196.060) (-1197.256) (-1194.624) [-1194.691] -- 0:00:22
874500 -- (-1200.652) (-1191.467) (-1191.754) [-1196.677] * (-1191.944) (-1196.141) [-1193.955] (-1195.067) -- 0:00:22
875000 -- (-1194.987) (-1195.364) (-1194.342) [-1191.229] * (-1191.043) (-1194.925) (-1195.654) [-1190.726] -- 0:00:22
Average standard deviation of split frequencies: 0.008180
875500 -- (-1194.272) (-1196.321) (-1194.951) [-1192.916] * (-1192.385) (-1193.495) (-1197.173) [-1195.035] -- 0:00:22
876000 -- (-1193.935) (-1194.635) (-1194.225) [-1191.194] * (-1190.174) (-1197.949) (-1200.395) [-1193.456] -- 0:00:22
876500 -- (-1194.599) [-1192.017] (-1193.541) (-1192.520) * (-1189.664) [-1193.689] (-1191.536) (-1199.534) -- 0:00:22
877000 -- (-1192.761) (-1190.862) (-1197.442) [-1192.167] * (-1186.458) (-1188.465) [-1193.364] (-1195.775) -- 0:00:22
877500 -- [-1189.953] (-1201.308) (-1193.987) (-1194.588) * (-1194.050) (-1199.359) (-1195.046) [-1192.889] -- 0:00:21
878000 -- (-1194.506) [-1190.835] (-1198.825) (-1198.755) * [-1192.222] (-1194.660) (-1189.199) (-1191.067) -- 0:00:21
878500 -- (-1195.153) (-1194.975) [-1195.006] (-1191.193) * (-1196.894) (-1193.501) (-1194.600) [-1191.402] -- 0:00:21
879000 -- (-1193.511) (-1190.938) [-1191.652] (-1192.898) * (-1194.165) [-1195.270] (-1195.909) (-1196.917) -- 0:00:21
879500 -- (-1195.678) [-1196.220] (-1194.811) (-1194.128) * (-1198.513) (-1192.744) (-1188.478) [-1200.871] -- 0:00:21
880000 -- (-1195.513) [-1190.883] (-1196.544) (-1196.242) * [-1193.386] (-1200.016) (-1193.672) (-1189.158) -- 0:00:21
Average standard deviation of split frequencies: 0.008565
880500 -- (-1197.280) (-1195.197) [-1190.362] (-1196.276) * (-1188.738) (-1194.952) [-1195.040] (-1192.555) -- 0:00:21
881000 -- (-1201.941) (-1192.944) [-1188.645] (-1193.888) * [-1191.395] (-1195.390) (-1194.033) (-1199.192) -- 0:00:21
881500 -- (-1199.413) (-1188.932) (-1194.556) [-1193.749] * (-1198.129) (-1199.425) (-1196.593) [-1191.823] -- 0:00:21
882000 -- (-1192.262) [-1187.495] (-1188.714) (-1195.044) * (-1196.726) [-1193.659] (-1196.107) (-1195.987) -- 0:00:21
882500 -- (-1194.119) (-1192.375) [-1197.524] (-1198.758) * (-1194.473) [-1196.354] (-1201.868) (-1204.031) -- 0:00:21
883000 -- (-1195.942) [-1189.229] (-1195.825) (-1195.073) * (-1196.032) (-1198.708) (-1191.212) [-1196.507] -- 0:00:20
883500 -- (-1196.110) [-1189.863] (-1203.528) (-1193.332) * (-1200.922) (-1190.020) (-1190.924) [-1194.405] -- 0:00:20
884000 -- (-1194.882) [-1192.392] (-1204.749) (-1196.591) * (-1191.384) (-1192.542) [-1190.793] (-1197.651) -- 0:00:20
884500 -- (-1197.922) (-1195.563) (-1195.630) [-1192.371] * [-1190.564] (-1193.107) (-1195.344) (-1196.806) -- 0:00:20
885000 -- [-1192.997] (-1190.757) (-1191.157) (-1188.528) * (-1188.720) [-1192.402] (-1206.614) (-1199.113) -- 0:00:20
Average standard deviation of split frequencies: 0.008300
885500 -- (-1199.397) (-1200.500) (-1192.646) [-1196.174] * (-1203.974) [-1189.449] (-1201.700) (-1196.576) -- 0:00:20
886000 -- (-1193.418) (-1194.117) (-1197.108) [-1195.132] * [-1197.090] (-1194.308) (-1192.233) (-1188.717) -- 0:00:20
886500 -- (-1198.540) (-1207.271) [-1196.098] (-1196.320) * (-1200.809) (-1201.421) (-1192.020) [-1196.218] -- 0:00:20
887000 -- (-1205.255) [-1192.397] (-1198.011) (-1185.481) * (-1206.231) (-1197.078) [-1192.628] (-1196.637) -- 0:00:20
887500 -- (-1195.264) [-1197.690] (-1192.773) (-1192.940) * (-1200.253) [-1196.147] (-1197.632) (-1200.536) -- 0:00:20
888000 -- [-1197.967] (-1199.048) (-1198.797) (-1192.877) * [-1194.070] (-1191.361) (-1195.859) (-1199.179) -- 0:00:20
888500 -- (-1208.648) (-1193.158) [-1194.153] (-1188.639) * (-1193.483) (-1195.676) (-1206.522) [-1191.478] -- 0:00:19
889000 -- (-1200.160) (-1200.010) (-1198.870) [-1196.368] * (-1193.601) [-1186.482] (-1200.278) (-1199.592) -- 0:00:19
889500 -- (-1189.835) (-1198.612) [-1195.265] (-1194.813) * (-1192.760) (-1189.718) (-1194.779) [-1194.063] -- 0:00:19
890000 -- (-1198.683) [-1190.756] (-1197.443) (-1195.008) * (-1196.432) (-1195.146) (-1195.069) [-1196.491] -- 0:00:19
Average standard deviation of split frequencies: 0.008574
890500 -- (-1199.721) (-1192.158) [-1193.319] (-1199.324) * [-1193.413] (-1191.170) (-1195.159) (-1193.945) -- 0:00:19
891000 -- (-1192.608) (-1193.538) (-1198.437) [-1197.731] * [-1200.528] (-1195.241) (-1194.167) (-1198.263) -- 0:00:19
891500 -- [-1196.551] (-1193.428) (-1189.013) (-1199.461) * (-1197.052) (-1196.491) (-1193.845) [-1193.379] -- 0:00:19
892000 -- [-1192.479] (-1194.494) (-1194.488) (-1195.900) * (-1188.840) [-1197.387] (-1192.921) (-1202.998) -- 0:00:19
892500 -- (-1196.433) (-1199.364) (-1194.146) [-1197.215] * (-1187.526) [-1193.181] (-1197.262) (-1198.234) -- 0:00:19
893000 -- [-1190.174] (-1196.512) (-1195.764) (-1195.898) * (-1195.974) [-1195.515] (-1193.288) (-1200.255) -- 0:00:19
893500 -- (-1199.683) (-1197.724) [-1191.946] (-1200.242) * (-1192.597) [-1192.742] (-1196.437) (-1198.816) -- 0:00:19
894000 -- (-1200.896) [-1189.181] (-1196.955) (-1195.823) * [-1194.860] (-1199.104) (-1197.230) (-1198.418) -- 0:00:18
894500 -- (-1198.939) (-1195.281) (-1200.360) [-1193.084] * (-1194.929) (-1195.733) [-1197.126] (-1191.114) -- 0:00:18
895000 -- (-1194.958) (-1191.979) (-1193.665) [-1189.127] * (-1199.558) (-1196.139) [-1195.492] (-1197.943) -- 0:00:18
Average standard deviation of split frequencies: 0.008944
895500 -- (-1195.410) [-1188.980] (-1191.576) (-1190.869) * (-1190.799) (-1197.094) [-1190.480] (-1194.224) -- 0:00:18
896000 -- (-1195.390) [-1189.466] (-1193.636) (-1197.471) * (-1204.081) (-1203.572) (-1199.195) [-1193.065] -- 0:00:18
896500 -- (-1192.737) [-1196.468] (-1191.903) (-1192.597) * (-1206.749) (-1208.672) [-1194.413] (-1190.711) -- 0:00:18
897000 -- (-1190.213) (-1196.781) (-1194.885) [-1199.556] * [-1194.260] (-1198.724) (-1191.133) (-1190.355) -- 0:00:18
897500 -- (-1197.213) (-1200.748) [-1189.416] (-1199.335) * (-1194.758) (-1198.249) [-1193.671] (-1193.830) -- 0:00:18
898000 -- (-1198.606) (-1199.394) [-1192.606] (-1198.248) * [-1191.889] (-1197.427) (-1193.300) (-1194.372) -- 0:00:18
898500 -- (-1191.056) (-1196.101) [-1193.001] (-1192.535) * (-1195.983) (-1209.683) [-1190.168] (-1191.809) -- 0:00:18
899000 -- (-1190.479) (-1198.611) (-1202.216) [-1191.303] * (-1199.531) (-1189.999) [-1194.113] (-1197.358) -- 0:00:18
899500 -- [-1191.591] (-1192.907) (-1200.500) (-1193.328) * (-1192.680) (-1189.458) [-1199.351] (-1196.075) -- 0:00:17
900000 -- (-1194.815) [-1191.684] (-1209.267) (-1191.130) * (-1194.272) (-1196.127) [-1189.602] (-1202.466) -- 0:00:17
Average standard deviation of split frequencies: 0.009526
900500 -- (-1190.250) (-1196.503) [-1193.225] (-1194.181) * [-1189.606] (-1198.735) (-1191.722) (-1196.755) -- 0:00:17
901000 -- (-1198.117) (-1191.630) [-1204.118] (-1192.681) * (-1194.546) (-1193.255) (-1190.630) [-1193.869] -- 0:00:17
901500 -- [-1197.674] (-1199.034) (-1199.088) (-1192.337) * [-1198.635] (-1199.243) (-1189.632) (-1195.185) -- 0:00:17
902000 -- (-1197.287) (-1194.494) (-1196.509) [-1189.936] * [-1203.650] (-1189.141) (-1194.138) (-1195.251) -- 0:00:17
902500 -- (-1195.247) (-1187.212) [-1191.686] (-1195.705) * (-1202.401) (-1195.405) (-1195.453) [-1191.689] -- 0:00:17
903000 -- (-1200.396) [-1193.737] (-1191.619) (-1193.453) * (-1201.894) (-1191.746) [-1197.437] (-1191.169) -- 0:00:17
903500 -- (-1197.281) (-1198.429) [-1190.771] (-1199.384) * (-1196.028) (-1202.117) [-1190.902] (-1192.903) -- 0:00:17
904000 -- (-1205.660) (-1196.151) [-1190.616] (-1193.699) * (-1194.146) (-1205.522) [-1193.951] (-1191.928) -- 0:00:17
904500 -- (-1202.439) (-1192.508) (-1194.592) [-1194.500] * (-1193.228) (-1200.456) (-1191.442) [-1188.726] -- 0:00:17
905000 -- (-1193.851) [-1192.140] (-1193.450) (-1195.212) * (-1191.738) (-1193.866) (-1201.564) [-1201.479] -- 0:00:17
Average standard deviation of split frequencies: 0.009053
905500 -- (-1190.858) [-1199.979] (-1200.156) (-1201.241) * [-1190.661] (-1201.176) (-1191.797) (-1200.591) -- 0:00:16
906000 -- (-1190.528) (-1195.836) (-1193.707) [-1190.969] * [-1195.274] (-1194.971) (-1196.061) (-1191.064) -- 0:00:16
906500 -- (-1194.619) [-1191.849] (-1193.986) (-1193.461) * (-1199.776) (-1196.891) [-1190.844] (-1194.138) -- 0:00:16
907000 -- (-1191.520) (-1194.630) [-1201.133] (-1193.075) * (-1194.023) (-1192.597) (-1206.945) [-1190.003] -- 0:00:16
907500 -- (-1195.832) (-1192.136) (-1199.405) [-1190.011] * (-1190.640) (-1196.725) (-1194.901) [-1190.738] -- 0:00:16
908000 -- (-1199.390) (-1190.407) [-1194.527] (-1190.955) * (-1200.736) (-1196.905) (-1194.275) [-1191.178] -- 0:00:16
908500 -- (-1191.849) (-1190.739) (-1210.461) [-1187.827] * (-1198.018) (-1191.447) (-1190.795) [-1191.507] -- 0:00:16
909000 -- (-1201.674) [-1197.781] (-1199.755) (-1196.044) * [-1191.355] (-1191.121) (-1195.528) (-1194.579) -- 0:00:16
909500 -- (-1194.472) (-1195.782) [-1196.798] (-1194.542) * (-1189.772) (-1193.927) (-1195.310) [-1195.076] -- 0:00:16
910000 -- (-1195.909) (-1195.159) (-1204.338) [-1193.350] * (-1191.996) (-1198.268) (-1193.702) [-1193.193] -- 0:00:16
Average standard deviation of split frequencies: 0.008593
910500 -- (-1197.121) [-1193.487] (-1199.991) (-1196.769) * (-1194.654) (-1195.552) (-1199.607) [-1189.830] -- 0:00:16
911000 -- (-1198.278) (-1204.832) [-1196.220] (-1199.862) * [-1190.274] (-1197.786) (-1196.186) (-1197.877) -- 0:00:15
911500 -- (-1200.561) [-1199.230] (-1192.991) (-1194.731) * [-1189.112] (-1194.821) (-1190.966) (-1193.965) -- 0:00:15
912000 -- (-1199.345) (-1203.723) (-1193.706) [-1190.877] * [-1195.853] (-1198.684) (-1192.883) (-1198.011) -- 0:00:15
912500 -- [-1193.777] (-1200.070) (-1195.331) (-1196.450) * [-1191.315] (-1196.871) (-1195.076) (-1193.614) -- 0:00:15
913000 -- (-1189.897) (-1200.267) [-1195.057] (-1194.631) * [-1197.199] (-1197.300) (-1199.220) (-1199.213) -- 0:00:15
913500 -- (-1192.543) (-1198.314) [-1191.636] (-1194.435) * [-1193.023] (-1191.709) (-1199.099) (-1193.501) -- 0:00:15
914000 -- (-1190.718) (-1190.692) (-1194.603) [-1190.373] * (-1192.752) [-1188.267] (-1194.875) (-1194.628) -- 0:00:15
914500 -- (-1193.688) [-1204.249] (-1192.583) (-1200.778) * (-1202.644) (-1194.650) [-1194.523] (-1191.417) -- 0:00:15
915000 -- (-1195.880) [-1194.908] (-1197.027) (-1193.816) * (-1192.298) (-1196.534) [-1200.140] (-1191.354) -- 0:00:15
Average standard deviation of split frequencies: 0.008131
915500 -- [-1191.491] (-1193.247) (-1190.329) (-1195.959) * (-1187.189) (-1190.151) [-1190.755] (-1193.891) -- 0:00:15
916000 -- (-1197.492) (-1197.772) (-1196.621) [-1190.010] * (-1203.118) (-1197.876) (-1195.948) [-1195.212] -- 0:00:15
916500 -- [-1191.091] (-1201.674) (-1197.139) (-1190.423) * (-1196.261) (-1195.011) [-1190.037] (-1192.176) -- 0:00:14
917000 -- (-1194.992) (-1194.894) [-1196.754] (-1196.741) * (-1193.786) (-1188.686) [-1194.069] (-1193.672) -- 0:00:14
917500 -- (-1190.210) (-1202.182) (-1199.852) [-1193.094] * (-1195.329) [-1196.534] (-1195.314) (-1192.034) -- 0:00:14
918000 -- [-1197.966] (-1193.956) (-1193.617) (-1198.168) * [-1192.731] (-1195.740) (-1188.930) (-1189.683) -- 0:00:14
918500 -- (-1196.740) (-1196.614) [-1193.099] (-1199.262) * (-1200.655) (-1191.326) (-1194.833) [-1187.770] -- 0:00:14
919000 -- (-1205.606) (-1202.870) (-1193.880) [-1191.161] * [-1191.938] (-1189.805) (-1198.377) (-1190.472) -- 0:00:14
919500 -- (-1192.308) (-1199.345) (-1197.394) [-1191.306] * (-1195.588) (-1191.531) [-1190.268] (-1198.419) -- 0:00:14
920000 -- (-1195.709) (-1203.771) [-1192.121] (-1193.019) * (-1191.961) [-1194.338] (-1197.303) (-1198.528) -- 0:00:14
Average standard deviation of split frequencies: 0.007885
920500 -- (-1195.404) (-1197.668) (-1192.246) [-1190.780] * (-1190.139) [-1191.202] (-1189.696) (-1192.325) -- 0:00:14
921000 -- (-1194.078) (-1195.078) (-1193.981) [-1197.842] * (-1191.046) (-1189.971) (-1200.079) [-1190.138] -- 0:00:14
921500 -- (-1194.114) (-1189.556) [-1194.158] (-1200.009) * [-1194.850] (-1195.513) (-1194.597) (-1205.613) -- 0:00:14
922000 -- [-1189.345] (-1190.407) (-1194.481) (-1199.897) * (-1191.359) [-1191.059] (-1198.407) (-1194.799) -- 0:00:13
922500 -- [-1187.631] (-1188.142) (-1193.851) (-1200.574) * (-1193.846) [-1188.869] (-1194.893) (-1198.257) -- 0:00:13
923000 -- [-1192.313] (-1187.598) (-1190.267) (-1191.416) * (-1191.427) (-1197.781) (-1194.372) [-1193.812] -- 0:00:13
923500 -- [-1190.754] (-1190.180) (-1197.017) (-1190.986) * (-1194.295) (-1193.492) (-1194.368) [-1196.643] -- 0:00:13
924000 -- [-1189.735] (-1192.091) (-1201.424) (-1194.908) * (-1192.093) (-1194.192) (-1191.083) [-1198.829] -- 0:00:13
924500 -- [-1193.752] (-1191.574) (-1204.529) (-1192.898) * (-1197.869) [-1201.078] (-1198.189) (-1204.644) -- 0:00:13
925000 -- (-1193.417) (-1190.659) (-1199.235) [-1189.584] * (-1189.498) (-1192.478) [-1193.167] (-1193.264) -- 0:00:13
Average standard deviation of split frequencies: 0.007636
925500 -- (-1198.299) [-1191.296] (-1191.691) (-1199.472) * (-1196.512) [-1189.265] (-1194.717) (-1199.936) -- 0:00:13
926000 -- (-1195.980) [-1192.296] (-1192.629) (-1205.145) * (-1201.140) (-1201.894) (-1196.023) [-1187.133] -- 0:00:13
926500 -- (-1191.647) [-1196.190] (-1197.720) (-1194.351) * [-1199.569] (-1195.095) (-1190.722) (-1196.494) -- 0:00:13
927000 -- (-1198.918) (-1195.030) [-1194.315] (-1197.119) * (-1201.025) (-1201.376) [-1202.126] (-1198.790) -- 0:00:13
927500 -- (-1195.253) (-1198.985) [-1196.908] (-1201.527) * (-1199.123) (-1196.808) [-1192.313] (-1190.169) -- 0:00:12
928000 -- (-1189.734) (-1198.051) [-1195.848] (-1199.600) * (-1195.689) (-1207.632) (-1191.662) [-1187.942] -- 0:00:12
928500 -- [-1189.576] (-1195.226) (-1200.927) (-1195.117) * [-1187.898] (-1206.095) (-1190.973) (-1197.135) -- 0:00:12
929000 -- (-1189.014) (-1199.443) (-1190.302) [-1189.426] * [-1194.461] (-1204.063) (-1197.401) (-1189.406) -- 0:00:12
929500 -- [-1189.442] (-1194.793) (-1195.894) (-1191.805) * (-1197.626) (-1201.136) [-1193.870] (-1194.859) -- 0:00:12
930000 -- (-1201.360) [-1199.469] (-1196.914) (-1201.431) * (-1200.165) (-1198.512) (-1199.779) [-1188.793] -- 0:00:12
Average standard deviation of split frequencies: 0.007902
930500 -- (-1194.838) (-1191.821) [-1193.711] (-1200.160) * (-1200.368) (-1193.153) (-1195.543) [-1193.741] -- 0:00:12
931000 -- (-1199.044) [-1193.879] (-1193.219) (-1201.959) * (-1200.144) (-1200.862) [-1193.028] (-1197.188) -- 0:00:12
931500 -- (-1197.887) (-1198.194) [-1196.513] (-1199.600) * (-1194.435) (-1196.513) [-1198.223] (-1197.294) -- 0:00:12
932000 -- (-1203.136) (-1201.048) (-1188.873) [-1192.747] * (-1195.803) (-1199.548) (-1197.541) [-1189.984] -- 0:00:12
932500 -- (-1208.244) [-1194.042] (-1195.137) (-1195.738) * (-1197.876) (-1201.901) (-1195.588) [-1193.337] -- 0:00:12
933000 -- [-1199.895] (-1193.468) (-1198.285) (-1197.377) * (-1191.143) (-1194.257) [-1190.939] (-1201.096) -- 0:00:11
933500 -- (-1202.958) (-1194.690) [-1193.653] (-1193.984) * (-1195.132) (-1195.991) [-1191.720] (-1200.984) -- 0:00:11
934000 -- [-1196.567] (-1194.058) (-1198.352) (-1196.744) * (-1192.787) (-1198.500) (-1194.972) [-1198.108] -- 0:00:11
934500 -- (-1199.048) (-1185.963) (-1197.129) [-1199.988] * (-1198.315) [-1197.981] (-1198.205) (-1195.079) -- 0:00:11
935000 -- (-1199.003) [-1190.052] (-1198.660) (-1197.156) * [-1187.968] (-1194.067) (-1195.229) (-1198.315) -- 0:00:11
Average standard deviation of split frequencies: 0.008260
935500 -- (-1199.359) (-1198.140) (-1202.191) [-1189.424] * [-1190.935] (-1191.053) (-1194.335) (-1200.404) -- 0:00:11
936000 -- (-1203.676) [-1195.889] (-1194.560) (-1189.635) * (-1194.541) [-1193.895] (-1196.611) (-1191.043) -- 0:00:11
936500 -- (-1200.320) (-1207.227) [-1194.616] (-1190.888) * [-1194.009] (-1188.685) (-1193.427) (-1193.677) -- 0:00:11
937000 -- (-1198.672) (-1193.293) (-1192.712) [-1188.859] * (-1192.156) (-1202.116) (-1192.645) [-1194.623] -- 0:00:11
937500 -- (-1193.015) [-1194.765] (-1198.134) (-1216.890) * [-1197.693] (-1193.918) (-1192.368) (-1200.014) -- 0:00:11
938000 -- (-1188.506) (-1198.655) (-1196.205) [-1194.078] * (-1195.772) (-1198.197) [-1193.599] (-1199.289) -- 0:00:11
938500 -- (-1195.471) (-1211.665) [-1196.293] (-1189.643) * (-1197.389) (-1200.119) [-1194.102] (-1200.925) -- 0:00:11
939000 -- (-1193.531) (-1192.839) [-1189.781] (-1196.591) * (-1196.100) (-1192.645) [-1191.134] (-1205.437) -- 0:00:10
939500 -- [-1197.326] (-1194.734) (-1191.957) (-1204.487) * (-1192.112) [-1190.079] (-1191.852) (-1197.213) -- 0:00:10
940000 -- (-1195.057) (-1194.867) (-1195.113) [-1189.406] * [-1191.286] (-1197.978) (-1190.898) (-1191.529) -- 0:00:10
Average standard deviation of split frequencies: 0.008219
940500 -- (-1199.871) (-1205.800) [-1191.149] (-1191.417) * (-1190.353) (-1197.632) (-1193.452) [-1198.411] -- 0:00:10
941000 -- (-1199.693) (-1196.386) [-1189.135] (-1197.162) * (-1197.735) (-1194.185) (-1199.119) [-1192.260] -- 0:00:10
941500 -- (-1199.170) [-1198.824] (-1194.055) (-1197.248) * [-1187.922] (-1198.012) (-1196.053) (-1197.325) -- 0:00:10
942000 -- (-1196.081) (-1191.460) [-1193.940] (-1199.849) * (-1194.013) (-1199.773) (-1196.381) [-1190.765] -- 0:00:10
942500 -- (-1193.199) (-1191.574) (-1193.292) [-1196.550] * (-1198.537) (-1193.546) [-1203.065] (-1195.124) -- 0:00:10
943000 -- (-1196.646) (-1198.568) [-1192.479] (-1195.785) * [-1194.742] (-1191.710) (-1195.165) (-1193.626) -- 0:00:10
943500 -- (-1195.856) (-1194.865) (-1194.539) [-1192.995] * (-1196.428) [-1191.383] (-1199.437) (-1202.263) -- 0:00:10
944000 -- (-1189.915) (-1194.579) (-1194.012) [-1190.673] * (-1192.594) (-1193.706) (-1195.234) [-1192.714] -- 0:00:10
944500 -- (-1189.960) (-1201.339) (-1198.593) [-1197.356] * (-1192.278) (-1193.499) (-1196.492) [-1191.215] -- 0:00:09
945000 -- [-1188.336] (-1194.268) (-1198.558) (-1202.499) * [-1195.143] (-1195.493) (-1204.825) (-1193.007) -- 0:00:09
Average standard deviation of split frequencies: 0.008372
945500 -- (-1193.143) [-1199.150] (-1206.543) (-1193.089) * [-1186.765] (-1197.049) (-1195.205) (-1191.408) -- 0:00:09
946000 -- [-1193.627] (-1196.273) (-1207.572) (-1202.837) * (-1193.399) (-1194.150) (-1200.343) [-1189.427] -- 0:00:09
946500 -- [-1192.034] (-1198.911) (-1194.812) (-1191.738) * (-1192.166) (-1195.020) (-1192.717) [-1187.542] -- 0:00:09
947000 -- (-1193.354) (-1193.352) (-1191.123) [-1191.249] * [-1193.892] (-1194.011) (-1192.669) (-1195.040) -- 0:00:09
947500 -- [-1189.150] (-1197.396) (-1189.396) (-1197.798) * (-1199.269) [-1192.552] (-1189.023) (-1199.492) -- 0:00:09
948000 -- (-1188.969) (-1195.610) [-1197.318] (-1196.804) * (-1192.001) [-1194.194] (-1193.145) (-1197.670) -- 0:00:09
948500 -- [-1190.537] (-1189.370) (-1196.219) (-1202.167) * (-1193.184) (-1202.733) (-1188.724) [-1192.305] -- 0:00:09
949000 -- (-1191.173) (-1194.191) [-1189.693] (-1202.478) * (-1189.879) (-1200.680) [-1188.129] (-1190.395) -- 0:00:09
949500 -- (-1190.929) [-1189.716] (-1194.762) (-1204.820) * [-1192.309] (-1193.200) (-1197.967) (-1200.344) -- 0:00:09
950000 -- [-1201.151] (-1196.834) (-1193.280) (-1200.896) * (-1202.615) (-1196.162) [-1190.038] (-1189.002) -- 0:00:08
Average standard deviation of split frequencies: 0.008430
950500 -- [-1197.408] (-1193.984) (-1196.521) (-1190.961) * [-1188.963] (-1192.938) (-1197.640) (-1187.806) -- 0:00:08
951000 -- (-1200.441) (-1198.525) [-1192.213] (-1196.395) * (-1189.988) [-1185.950] (-1200.410) (-1191.021) -- 0:00:08
951500 -- (-1198.399) (-1210.071) [-1193.736] (-1190.989) * (-1196.469) [-1193.183] (-1198.298) (-1190.766) -- 0:00:08
952000 -- (-1198.649) (-1190.819) [-1193.703] (-1194.420) * (-1195.456) (-1193.290) [-1194.670] (-1194.395) -- 0:00:08
952500 -- (-1199.320) [-1189.579] (-1197.587) (-1193.354) * [-1188.597] (-1202.488) (-1197.047) (-1192.620) -- 0:00:08
953000 -- (-1197.791) (-1194.092) [-1189.870] (-1198.440) * [-1192.380] (-1195.876) (-1193.833) (-1193.393) -- 0:00:08
953500 -- (-1201.304) [-1192.038] (-1192.269) (-1198.061) * (-1197.706) (-1193.511) (-1191.294) [-1193.744] -- 0:00:08
954000 -- (-1193.193) (-1202.472) [-1191.960] (-1194.783) * (-1195.359) (-1208.795) [-1201.942] (-1190.269) -- 0:00:08
954500 -- (-1193.587) (-1198.857) (-1202.405) [-1190.460] * (-1197.037) (-1198.195) [-1192.920] (-1191.701) -- 0:00:08
955000 -- [-1188.788] (-1199.814) (-1193.645) (-1193.553) * [-1206.626] (-1195.980) (-1194.698) (-1194.445) -- 0:00:08
Average standard deviation of split frequencies: 0.008383
955500 -- [-1190.133] (-1195.445) (-1196.308) (-1187.701) * (-1197.368) [-1191.212] (-1194.963) (-1195.470) -- 0:00:07
956000 -- (-1188.918) (-1192.076) (-1190.826) [-1189.405] * (-1192.200) [-1188.430] (-1192.672) (-1199.053) -- 0:00:07
956500 -- (-1191.860) (-1191.385) (-1196.971) [-1191.091] * [-1192.830] (-1193.784) (-1192.747) (-1190.859) -- 0:00:07
957000 -- (-1198.518) (-1200.653) (-1190.286) [-1200.622] * (-1191.532) (-1186.993) (-1195.785) [-1196.152] -- 0:00:07
957500 -- (-1194.465) [-1192.075] (-1196.498) (-1205.807) * (-1193.852) [-1191.508] (-1196.009) (-1191.885) -- 0:00:07
958000 -- (-1196.118) (-1197.918) [-1193.592] (-1195.834) * [-1195.060] (-1192.984) (-1195.959) (-1195.099) -- 0:00:07
958500 -- (-1195.717) (-1201.376) (-1193.145) [-1195.855] * (-1195.233) (-1189.352) [-1192.374] (-1190.922) -- 0:00:07
959000 -- (-1192.990) (-1196.131) [-1189.593] (-1194.969) * (-1193.855) (-1197.225) (-1193.620) [-1188.241] -- 0:00:07
959500 -- (-1193.579) [-1192.542] (-1197.392) (-1195.917) * (-1195.093) (-1197.125) [-1191.492] (-1203.122) -- 0:00:07
960000 -- (-1198.075) (-1194.204) (-1194.995) [-1195.069] * [-1189.489] (-1191.973) (-1194.669) (-1193.668) -- 0:00:07
Average standard deviation of split frequencies: 0.008538
960500 -- (-1193.603) (-1194.533) (-1196.391) [-1198.584] * (-1198.945) (-1191.701) [-1192.565] (-1189.708) -- 0:00:07
961000 -- [-1192.422] (-1192.253) (-1192.516) (-1194.777) * [-1195.862] (-1195.321) (-1195.970) (-1198.925) -- 0:00:06
961500 -- (-1192.051) (-1188.389) (-1190.030) [-1195.544] * (-1198.862) [-1193.218] (-1193.854) (-1191.138) -- 0:00:06
962000 -- (-1191.603) (-1203.075) (-1199.293) [-1191.910] * (-1199.301) [-1193.859] (-1189.749) (-1194.131) -- 0:00:06
962500 -- (-1196.137) [-1194.834] (-1190.802) (-1188.936) * (-1189.082) (-1192.717) (-1195.414) [-1190.737] -- 0:00:06
963000 -- (-1198.612) (-1191.272) [-1194.242] (-1190.906) * [-1193.534] (-1192.230) (-1190.630) (-1197.328) -- 0:00:06
963500 -- (-1192.373) [-1190.983] (-1204.478) (-1204.740) * (-1191.391) [-1197.663] (-1190.764) (-1204.392) -- 0:00:06
964000 -- (-1191.222) (-1200.899) [-1200.478] (-1200.958) * [-1193.610] (-1191.517) (-1194.067) (-1197.791) -- 0:00:06
964500 -- (-1188.738) [-1187.500] (-1201.953) (-1197.497) * (-1197.889) (-1193.749) (-1197.206) [-1195.071] -- 0:00:06
965000 -- (-1195.012) (-1196.892) (-1190.038) [-1194.816] * (-1197.944) (-1201.966) (-1187.686) [-1197.315] -- 0:00:06
Average standard deviation of split frequencies: 0.008394
965500 -- [-1194.042] (-1196.534) (-1190.451) (-1194.603) * [-1193.280] (-1201.998) (-1195.181) (-1202.932) -- 0:00:06
966000 -- (-1197.333) (-1188.052) [-1194.452] (-1193.296) * [-1191.132] (-1202.788) (-1193.577) (-1200.589) -- 0:00:06
966500 -- [-1193.583] (-1192.218) (-1194.462) (-1194.054) * [-1195.925] (-1195.251) (-1195.001) (-1192.707) -- 0:00:05
967000 -- (-1204.800) (-1197.227) [-1192.103] (-1194.714) * (-1200.440) [-1196.218] (-1193.831) (-1196.842) -- 0:00:05
967500 -- (-1191.174) (-1193.724) [-1190.351] (-1202.054) * [-1199.538] (-1201.671) (-1187.054) (-1196.166) -- 0:00:05
968000 -- (-1191.680) (-1193.928) [-1192.315] (-1195.916) * (-1197.291) (-1192.998) (-1193.030) [-1195.507] -- 0:00:05
968500 -- [-1193.831] (-1198.287) (-1199.090) (-1195.553) * (-1198.422) (-1192.091) [-1189.816] (-1194.979) -- 0:00:05
969000 -- (-1191.411) [-1195.751] (-1193.112) (-1197.648) * [-1198.426] (-1199.157) (-1189.606) (-1203.803) -- 0:00:05
969500 -- (-1200.668) (-1197.097) (-1190.134) [-1197.469] * [-1192.463] (-1197.221) (-1197.131) (-1200.059) -- 0:00:05
970000 -- (-1194.704) (-1197.750) (-1202.215) [-1191.136] * (-1193.090) (-1198.878) (-1192.829) [-1194.945] -- 0:00:05
Average standard deviation of split frequencies: 0.008159
970500 -- (-1189.861) (-1191.477) [-1190.774] (-1190.802) * [-1192.276] (-1196.337) (-1193.170) (-1195.478) -- 0:00:05
971000 -- (-1195.753) (-1189.532) [-1196.252] (-1192.698) * (-1196.433) (-1202.396) [-1195.222] (-1195.754) -- 0:00:05
971500 -- [-1187.370] (-1189.187) (-1194.442) (-1198.293) * [-1202.654] (-1193.185) (-1194.007) (-1189.495) -- 0:00:05
972000 -- (-1192.595) [-1195.201] (-1200.717) (-1194.812) * [-1191.347] (-1191.490) (-1192.443) (-1199.145) -- 0:00:04
972500 -- [-1193.786] (-1195.032) (-1196.090) (-1192.054) * (-1195.006) (-1197.149) (-1195.820) [-1193.858] -- 0:00:04
973000 -- (-1190.385) (-1195.234) (-1197.516) [-1191.568] * (-1194.744) (-1195.313) (-1194.659) [-1192.338] -- 0:00:04
973500 -- [-1192.160] (-1191.213) (-1194.870) (-1196.329) * [-1191.424] (-1199.965) (-1200.106) (-1199.409) -- 0:00:04
974000 -- (-1196.753) (-1198.682) (-1200.044) [-1192.432] * (-1194.476) [-1193.677] (-1196.338) (-1192.497) -- 0:00:04
974500 -- (-1197.238) (-1192.068) [-1200.515] (-1196.724) * (-1191.159) (-1194.197) [-1190.271] (-1195.315) -- 0:00:04
975000 -- (-1204.314) (-1191.322) [-1194.375] (-1202.301) * (-1190.796) (-1193.044) [-1188.871] (-1195.001) -- 0:00:04
Average standard deviation of split frequencies: 0.008501
975500 -- (-1198.292) [-1189.098] (-1197.347) (-1202.887) * (-1197.247) [-1199.381] (-1192.970) (-1193.499) -- 0:00:04
976000 -- (-1193.272) [-1189.188] (-1193.764) (-1188.347) * (-1188.494) (-1202.335) [-1192.581] (-1197.241) -- 0:00:04
976500 -- (-1194.801) (-1195.951) (-1194.608) [-1188.903] * (-1193.044) (-1195.067) (-1195.124) [-1197.175] -- 0:00:04
977000 -- (-1190.864) [-1193.646] (-1191.974) (-1197.189) * (-1202.395) (-1195.491) [-1193.625] (-1193.448) -- 0:00:04
977500 -- (-1189.816) [-1189.130] (-1191.676) (-1193.320) * (-1194.119) (-1190.115) [-1188.816] (-1197.573) -- 0:00:04
978000 -- (-1191.607) [-1193.297] (-1191.074) (-1200.580) * (-1197.140) [-1192.065] (-1194.347) (-1194.457) -- 0:00:03
978500 -- (-1194.679) (-1188.677) (-1193.699) [-1194.018] * (-1192.475) (-1195.475) (-1195.839) [-1195.343] -- 0:00:03
979000 -- [-1192.577] (-1196.674) (-1196.599) (-1196.472) * (-1195.831) (-1196.181) (-1192.801) [-1191.392] -- 0:00:03
979500 -- (-1201.381) (-1195.067) (-1190.275) [-1194.108] * (-1189.853) (-1197.779) [-1189.599] (-1201.610) -- 0:00:03
980000 -- (-1200.840) (-1194.160) (-1188.348) [-1191.976] * (-1198.927) [-1190.034] (-1190.752) (-1196.281) -- 0:00:03
Average standard deviation of split frequencies: 0.009806
980500 -- [-1190.357] (-1193.616) (-1194.339) (-1190.531) * (-1204.379) [-1189.267] (-1194.616) (-1191.697) -- 0:00:03
981000 -- [-1189.892] (-1192.146) (-1198.512) (-1192.553) * (-1190.155) (-1199.966) (-1191.074) [-1201.704] -- 0:00:03
981500 -- (-1193.222) (-1199.954) (-1196.404) [-1192.976] * [-1199.776] (-1194.619) (-1197.872) (-1194.811) -- 0:00:03
982000 -- (-1193.379) (-1193.184) (-1203.394) [-1193.381] * (-1201.025) [-1189.058] (-1200.860) (-1198.596) -- 0:00:03
982500 -- (-1200.021) [-1197.394] (-1201.279) (-1191.673) * (-1194.089) (-1200.227) [-1195.069] (-1196.473) -- 0:00:03
983000 -- (-1200.046) (-1195.479) [-1201.270] (-1196.328) * [-1195.309] (-1198.576) (-1195.800) (-1200.062) -- 0:00:03
983500 -- (-1206.594) (-1194.563) (-1202.190) [-1190.479] * (-1191.840) (-1194.345) [-1193.320] (-1199.680) -- 0:00:02
984000 -- [-1199.205] (-1195.298) (-1196.562) (-1195.170) * (-1190.354) [-1191.316] (-1195.611) (-1205.008) -- 0:00:02
984500 -- [-1191.938] (-1189.832) (-1202.775) (-1196.436) * [-1189.676] (-1197.840) (-1194.217) (-1194.707) -- 0:00:02
985000 -- (-1192.878) [-1192.655] (-1193.996) (-1192.526) * (-1192.637) (-1194.660) [-1190.742] (-1193.773) -- 0:00:02
Average standard deviation of split frequencies: 0.009658
985500 -- (-1203.181) (-1193.397) [-1205.435] (-1189.999) * [-1190.174] (-1197.268) (-1190.964) (-1193.480) -- 0:00:02
986000 -- (-1195.905) (-1194.177) (-1194.568) [-1190.299] * [-1189.667] (-1198.060) (-1195.878) (-1197.394) -- 0:00:02
986500 -- (-1191.820) (-1198.480) [-1190.979] (-1192.469) * (-1191.981) (-1205.271) [-1193.232] (-1197.226) -- 0:00:02
987000 -- (-1189.304) (-1199.660) (-1198.150) [-1194.001] * (-1197.362) (-1193.196) [-1190.831] (-1189.973) -- 0:00:02
987500 -- [-1189.858] (-1192.917) (-1194.320) (-1193.424) * (-1193.708) (-1201.344) [-1198.033] (-1190.197) -- 0:00:02
988000 -- (-1191.016) [-1192.197] (-1192.215) (-1193.766) * (-1198.405) (-1199.592) [-1198.252] (-1194.949) -- 0:00:02
988500 -- (-1194.825) (-1196.510) [-1192.759] (-1192.034) * (-1195.462) (-1208.204) [-1189.696] (-1194.396) -- 0:00:02
989000 -- (-1201.674) (-1194.835) (-1203.741) [-1194.405] * (-1193.729) [-1192.221] (-1191.176) (-1191.702) -- 0:00:01
989500 -- [-1190.074] (-1189.988) (-1195.897) (-1206.511) * (-1194.194) (-1191.399) (-1192.844) [-1190.028] -- 0:00:01
990000 -- (-1194.119) [-1192.681] (-1189.404) (-1196.610) * [-1197.765] (-1199.093) (-1192.831) (-1195.609) -- 0:00:01
Average standard deviation of split frequencies: 0.009041
990500 -- (-1193.043) (-1192.315) [-1189.481] (-1197.763) * (-1199.601) (-1195.218) (-1195.526) [-1189.892] -- 0:00:01
991000 -- (-1199.282) [-1187.692] (-1189.125) (-1196.728) * (-1198.318) (-1193.578) [-1187.072] (-1194.052) -- 0:00:01
991500 -- (-1195.174) (-1191.905) (-1195.897) [-1195.212] * (-1202.238) (-1191.245) [-1190.198] (-1191.941) -- 0:00:01
992000 -- (-1196.035) (-1196.010) (-1196.225) [-1191.700] * (-1194.383) (-1202.804) (-1187.642) [-1200.664] -- 0:00:01
992500 -- [-1189.811] (-1202.114) (-1196.719) (-1193.491) * (-1201.168) (-1199.855) [-1194.586] (-1201.102) -- 0:00:01
993000 -- (-1193.743) (-1199.130) [-1200.472] (-1191.557) * (-1193.022) (-1191.418) [-1193.243] (-1196.670) -- 0:00:01
993500 -- (-1200.043) [-1191.349] (-1190.703) (-1192.229) * (-1193.524) [-1197.368] (-1191.705) (-1194.739) -- 0:00:01
994000 -- (-1203.993) (-1193.108) [-1188.793] (-1203.862) * (-1200.620) (-1191.611) [-1196.069] (-1198.070) -- 0:00:01
994500 -- (-1200.613) (-1192.967) [-1189.827] (-1195.449) * (-1198.046) (-1191.246) [-1194.284] (-1201.431) -- 0:00:00
995000 -- [-1191.041] (-1199.893) (-1197.882) (-1194.706) * (-1198.218) [-1189.673] (-1193.329) (-1195.544) -- 0:00:00
Average standard deviation of split frequencies: 0.009750
995500 -- (-1191.283) (-1199.989) [-1192.986] (-1205.152) * (-1191.821) [-1190.335] (-1196.286) (-1196.931) -- 0:00:00
996000 -- [-1194.678] (-1197.147) (-1188.759) (-1199.289) * (-1189.987) [-1193.040] (-1192.387) (-1193.327) -- 0:00:00
996500 -- (-1194.775) [-1191.729] (-1190.979) (-1200.588) * (-1191.327) (-1190.566) [-1191.024] (-1192.512) -- 0:00:00
997000 -- (-1199.130) (-1197.826) (-1196.618) [-1194.363] * (-1194.993) [-1190.271] (-1200.740) (-1194.491) -- 0:00:00
997500 -- (-1201.219) (-1193.390) (-1191.611) [-1197.588] * (-1193.914) (-1195.375) [-1190.968] (-1199.368) -- 0:00:00
998000 -- (-1192.321) (-1192.552) [-1201.775] (-1192.559) * (-1196.204) (-1196.454) (-1193.584) [-1192.577] -- 0:00:00
998500 -- (-1192.093) (-1197.702) [-1190.236] (-1199.083) * [-1198.279] (-1196.165) (-1194.145) (-1194.859) -- 0:00:00
999000 -- (-1198.545) (-1195.852) [-1197.862] (-1192.838) * (-1197.585) (-1193.426) (-1196.318) [-1197.712] -- 0:00:00
999500 -- (-1193.868) (-1195.850) (-1196.709) [-1194.283] * (-1191.245) [-1190.920] (-1194.959) (-1192.589) -- 0:00:00
1000000 -- [-1189.646] (-1194.119) (-1196.569) (-1194.537) * (-1189.655) (-1191.941) (-1197.861) [-1193.836] -- 0:00:00
Average standard deviation of split frequencies: 0.010176
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1189.646462 -- 17.763726
Chain 1 -- -1189.646462 -- 17.763726
Chain 2 -- -1194.118749 -- 9.188503
Chain 2 -- -1194.118752 -- 9.188503
Chain 3 -- -1196.568731 -- 16.490879
Chain 3 -- -1196.568730 -- 16.490879
Chain 4 -- -1194.536791 -- 18.113285
Chain 4 -- -1194.536790 -- 18.113285
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1189.654669 -- 17.019835
Chain 1 -- -1189.654669 -- 17.019835
Chain 2 -- -1191.940918 -- 19.403712
Chain 2 -- -1191.940919 -- 19.403712
Chain 3 -- -1197.860625 -- 18.360589
Chain 3 -- -1197.860629 -- 18.360589
Chain 4 -- -1193.835890 -- 19.634221
Chain 4 -- -1193.835890 -- 19.634221
Analysis completed in 2 mins 58 seconds
Analysis used 178.53 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1184.09
Likelihood of best state for "cold" chain of run 2 was -1184.12
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
60.0 % ( 53 %) Dirichlet(Revmat{all})
75.4 % ( 71 %) Slider(Revmat{all})
28.8 % ( 22 %) Dirichlet(Pi{all})
30.9 % ( 18 %) Slider(Pi{all})
67.0 % ( 44 %) Multiplier(Alpha{1,2})
52.7 % ( 31 %) Multiplier(Alpha{3})
64.9 % ( 41 %) Slider(Pinvar{all})
8.0 % ( 6 %) ExtSPR(Tau{all},V{all})
4.2 % ( 1 %) ExtTBR(Tau{all},V{all})
16.0 % ( 18 %) NNI(Tau{all},V{all})
19.2 % ( 22 %) ParsSPR(Tau{all},V{all})
26.7 % ( 23 %) Multiplier(V{all})
40.8 % ( 46 %) Nodeslider(V{all})
26.3 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
60.9 % ( 53 %) Dirichlet(Revmat{all})
75.8 % ( 65 %) Slider(Revmat{all})
29.4 % ( 23 %) Dirichlet(Pi{all})
29.9 % ( 26 %) Slider(Pi{all})
66.3 % ( 36 %) Multiplier(Alpha{1,2})
52.7 % ( 26 %) Multiplier(Alpha{3})
64.8 % ( 35 %) Slider(Pinvar{all})
7.8 % ( 4 %) ExtSPR(Tau{all},V{all})
4.1 % ( 3 %) ExtTBR(Tau{all},V{all})
15.9 % ( 18 %) NNI(Tau{all},V{all})
19.0 % ( 18 %) ParsSPR(Tau{all},V{all})
26.6 % ( 17 %) Multiplier(V{all})
40.2 % ( 37 %) Nodeslider(V{all})
26.0 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.65 0.52
2 | 166001 0.83 0.68
3 | 167092 167013 0.84
4 | 166537 166594 166763
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.51
2 | 166843 0.83 0.67
3 | 166516 166610 0.84
4 | 166894 166622 166515
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1191.22
| 2 |
| 2 |
| |
| 2 2 1 |
| 2 1 1 1 1 2 |
| 2 2 21 2 1 11 1 1 2 21|
| 2 1 21 122 1 2 1 1 22 2 2 1 21211 1 |
| 21 1 * * 2 22 1 22 1 1 1 2 1 2 2|
|2 2 1 21 2122 21 12 1 21 22 1 1 |
| 2 1 11* 1 1* 2 1 |
|11 1 * 1 21 2 |
| 1 2 1 2 1 1 2 |
| 2 2 |
| |
| 1 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1195.52
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1190.31 -1201.62
2 -1189.97 -1204.03
--------------------------------------
TOTAL -1190.13 -1203.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.280929 0.003202 0.181063 0.394628 0.275292 1259.35 1270.70 1.000
r(A<->C){all} 0.071970 0.000945 0.021271 0.134133 0.068368 780.19 933.85 1.000
r(A<->G){all} 0.194199 0.002985 0.091518 0.302733 0.190111 610.47 613.23 1.000
r(A<->T){all} 0.050709 0.001588 0.000003 0.126243 0.042169 679.55 723.10 1.000
r(C<->G){all} 0.063712 0.000698 0.016475 0.116520 0.060413 964.50 985.30 1.000
r(C<->T){all} 0.471510 0.008747 0.282010 0.647502 0.469780 478.79 522.61 1.000
r(G<->T){all} 0.147900 0.003028 0.050256 0.256120 0.140921 547.31 618.92 1.000
pi(A){all} 0.252698 0.000315 0.219549 0.288960 0.252361 1013.58 1040.22 1.000
pi(C){all} 0.279210 0.000317 0.245774 0.313919 0.279351 1145.25 1269.69 1.000
pi(G){all} 0.317237 0.000347 0.280985 0.353037 0.316754 1163.96 1189.76 1.000
pi(T){all} 0.150855 0.000202 0.124092 0.179251 0.150352 1254.95 1342.43 1.000
alpha{1,2} 0.074764 0.004235 0.000101 0.191338 0.059423 1362.55 1390.03 1.000
alpha{3} 1.471551 0.480868 0.428196 2.840744 1.346490 1350.79 1425.90 1.000
pinvar{all} 0.453619 0.011691 0.252176 0.670771 0.467630 1192.62 1262.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...***
8 -- .**...
9 -- ...**.
10 -- ...*.*
11 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 3002 1.000000 0.000000 1.000000 1.000000 2
8 2966 0.988008 0.003769 0.985343 0.990673 2
9 1967 0.655230 0.010835 0.647568 0.662891 2
10 632 0.210526 0.023555 0.193871 0.227182 2
11 403 0.134244 0.012719 0.125250 0.143238 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.028214 0.000126 0.009725 0.050597 0.026520 1.000 2
length{all}[2] 0.004869 0.000014 0.000025 0.012159 0.004008 1.000 2
length{all}[3] 0.009722 0.000026 0.001443 0.019768 0.008877 1.000 2
length{all}[4] 0.029305 0.000149 0.009347 0.052933 0.027512 1.000 2
length{all}[5] 0.018715 0.000085 0.003599 0.036697 0.017482 1.000 2
length{all}[6] 0.101664 0.000887 0.046169 0.157334 0.097730 1.001 2
length{all}[7] 0.062306 0.000484 0.026273 0.106621 0.059369 1.000 2
length{all}[8] 0.014784 0.000070 0.001372 0.030589 0.013379 1.000 2
length{all}[9] 0.013558 0.000099 0.000010 0.032651 0.011462 1.000 2
length{all}[10] 0.008633 0.000048 0.000003 0.021883 0.007171 1.005 2
length{all}[11] 0.005850 0.000025 0.000029 0.015407 0.004473 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010176
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C4 (4)
| /-----------66----------+
| | \------------------------ C5 (5)
+----------100----------+
| \------------------------------------------------ C6 (6)
|
| /------------------------ C2 (2)
\-----------------------99----------------------+
\------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------------ C1 (1)
|
| /------------- C4 (4)
| /----+
| | \-------- C5 (5)
+--------------------------+
| \--------------------------------------------- C6 (6)
|
| /-- C2 (2)
\-----+
\---- C3 (3)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (9 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 4 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 558
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
95 patterns at 186 / 186 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
92720 bytes for conP
12920 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 72
185440 bytes for conP, adjusted
0.048906 0.076258 0.014716 0.047066 0.038115 0.158609 0.024960 0.006596 0.015110 0.300000 1.300000
ntime & nrate & np: 9 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 11
lnL0 = -1237.077677
Iterating by ming2
Initial: fx= 1237.077677
x= 0.04891 0.07626 0.01472 0.04707 0.03811 0.15861 0.02496 0.00660 0.01511 0.30000 1.30000
1 h-m-p 0.0000 0.0002 152.5751 ++YYYCCC 1235.225846 5 0.0001 25 | 0/11
2 h-m-p 0.0000 0.0002 855.4705 +YCCC 1232.777511 3 0.0001 45 | 0/11
3 h-m-p 0.0002 0.0008 312.5889 +YYYYYC 1221.594734 5 0.0006 65 | 0/11
4 h-m-p 0.0001 0.0003 2189.7293 +YCCC 1210.238165 3 0.0002 85 | 0/11
5 h-m-p 0.0001 0.0003 371.8201 +YYYCCC 1205.099606 5 0.0002 107 | 0/11
6 h-m-p 0.0003 0.0016 133.7013 CYCCC 1202.576563 4 0.0005 128 | 0/11
7 h-m-p 0.0005 0.0026 82.8511 CCCCC 1201.130079 4 0.0007 150 | 0/11
8 h-m-p 0.0004 0.0041 167.0227 +YCYCCCC 1185.461367 6 0.0034 176 | 0/11
9 h-m-p 0.0000 0.0000 9016.5955 +YYYCYCYCCC 1167.745072 9 0.0000 204 | 0/11
10 h-m-p 0.0000 0.0000 3022.5214 YYYCCCC 1167.354600 6 0.0000 227 | 0/11
11 h-m-p 0.0052 0.0298 3.3734 YCCC 1167.250564 3 0.0031 246 | 0/11
12 h-m-p 0.0070 0.1564 1.4790 ++YCYCCC 1143.710634 5 0.1378 271 | 0/11
13 h-m-p 0.6833 3.4167 0.1023 CCC 1139.898161 2 0.8565 289 | 0/11
14 h-m-p 0.5449 2.7611 0.1608 YCCCCC 1135.968166 5 1.1016 323 | 0/11
15 h-m-p 0.3297 1.6484 0.2584 YCCC 1133.800890 3 0.5915 353 | 0/11
16 h-m-p 0.8768 4.8333 0.1743 YCCC 1131.154416 3 1.6905 383 | 0/11
17 h-m-p 1.1299 5.6494 0.1734 CCCC 1129.750592 3 1.4041 414 | 0/11
18 h-m-p 0.8625 4.3127 0.2178 YCCCC 1128.272066 4 1.6567 446 | 0/11
19 h-m-p 1.2820 6.4100 0.1709 CCCCC 1127.634815 4 1.4700 479 | 0/11
20 h-m-p 1.6000 8.0000 0.1190 CYC 1127.230424 2 1.9236 507 | 0/11
21 h-m-p 1.6000 8.0000 0.0711 CCC 1127.100082 2 2.0692 536 | 0/11
22 h-m-p 1.6000 8.0000 0.0144 CCC 1127.018103 2 2.1373 565 | 0/11
23 h-m-p 0.8803 8.0000 0.0351 +YC 1126.981869 1 2.4017 592 | 0/11
24 h-m-p 1.6000 8.0000 0.0188 YC 1126.960403 1 3.2928 618 | 0/11
25 h-m-p 1.6000 8.0000 0.0087 ++ 1126.877257 m 8.0000 643 | 0/11
26 h-m-p 0.7288 8.0000 0.0950 +YC 1126.746191 1 2.1410 670 | 0/11
27 h-m-p 1.6000 8.0000 0.0411 CC 1126.712085 1 1.3743 697 | 0/11
28 h-m-p 1.6000 8.0000 0.0190 CC 1126.707598 1 1.4203 724 | 0/11
29 h-m-p 1.6000 8.0000 0.0032 CC 1126.706981 1 1.3238 751 | 0/11
30 h-m-p 1.6000 8.0000 0.0011 Y 1126.706969 0 1.1448 776 | 0/11
31 h-m-p 1.6000 8.0000 0.0000 C 1126.706968 0 1.5119 801 | 0/11
32 h-m-p 0.9386 8.0000 0.0001 C 1126.706968 0 1.1138 826 | 0/11
33 h-m-p 1.6000 8.0000 0.0000 C 1126.706968 0 1.4923 851 | 0/11
34 h-m-p 1.6000 8.0000 0.0000 ---C 1126.706968 0 0.0063 879 | 0/11
35 h-m-p 0.0619 8.0000 0.0000 -----C 1126.706968 0 0.0000 909
Out..
lnL = -1126.706968
910 lfun, 910 eigenQcodon, 8190 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 72
0.048906 0.076258 0.014716 0.047066 0.038115 0.158609 0.024960 0.006596 0.015110 2.734242 0.747245 0.296991
ntime & nrate & np: 9 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.223876
np = 12
lnL0 = -1150.838290
Iterating by ming2
Initial: fx= 1150.838290
x= 0.04891 0.07626 0.01472 0.04707 0.03811 0.15861 0.02496 0.00660 0.01511 2.73424 0.74724 0.29699
1 h-m-p 0.0000 0.0002 107.9362 ++YYYYC 1149.842287 4 0.0002 23 | 0/12
2 h-m-p 0.0000 0.0011 448.9031 +YCYCCC 1148.518892 5 0.0001 47 | 0/12
3 h-m-p 0.0002 0.0011 245.8703 +YCYYCCC 1132.268910 6 0.0010 73 | 0/12
4 h-m-p 0.0000 0.0000 4265.7551 CYCCC 1130.056115 4 0.0000 95 | 0/12
5 h-m-p 0.0006 0.0028 33.1166 CCCC 1129.639374 3 0.0008 116 | 0/12
6 h-m-p 0.0025 0.0128 10.7325 YCC 1129.612713 2 0.0005 134 | 0/12
7 h-m-p 0.0007 0.0127 7.8168 CCC 1129.596843 2 0.0006 153 | 0/12
8 h-m-p 0.0018 0.0793 2.4322 YC 1129.549972 1 0.0043 169 | 0/12
9 h-m-p 0.0024 0.3329 4.3980 ++YCCC 1127.423724 3 0.0661 191 | 0/12
10 h-m-p 0.0010 0.0048 60.2368 CCCCC 1126.854501 4 0.0012 214 | 0/12
11 h-m-p 0.0006 0.0030 120.5117 YYC 1126.400893 2 0.0005 231 | 0/12
12 h-m-p 0.0011 0.0056 23.4933 YCCC 1126.322524 3 0.0006 251 | 0/12
13 h-m-p 0.0340 1.6224 0.3979 ++YCYCCC 1123.889315 5 1.0078 276 | 0/12
14 h-m-p 0.3304 1.6521 0.0856 CCC 1123.713162 2 0.3905 307 | 0/12
15 h-m-p 0.7600 8.0000 0.0440 CCC 1123.663291 2 0.7044 338 | 0/12
16 h-m-p 0.5765 8.0000 0.0538 +YCC 1123.623599 2 1.8552 369 | 0/12
17 h-m-p 0.9591 8.0000 0.1040 CC 1123.588729 1 1.1005 398 | 0/12
18 h-m-p 1.6000 8.0000 0.0350 YC 1123.582396 1 0.9578 426 | 0/12
19 h-m-p 1.6000 8.0000 0.0011 YC 1123.581917 1 0.7683 454 | 0/12
20 h-m-p 1.0896 8.0000 0.0008 C 1123.581901 0 0.8958 481 | 0/12
21 h-m-p 1.6000 8.0000 0.0003 Y 1123.581900 0 0.7067 508 | 0/12
22 h-m-p 1.6000 8.0000 0.0000 Y 1123.581900 0 0.9310 535 | 0/12
23 h-m-p 1.6000 8.0000 0.0000 C 1123.581900 0 1.6000 562 | 0/12
24 h-m-p 1.6000 8.0000 0.0000 Y 1123.581900 0 1.6000 589 | 0/12
25 h-m-p 1.6000 8.0000 0.0000 Y 1123.581900 0 1.6000 616 | 0/12
26 h-m-p 1.6000 8.0000 0.0000 C 1123.581900 0 1.6000 643 | 0/12
27 h-m-p 1.6000 8.0000 0.0000 Y 1123.581900 0 0.4000 670 | 0/12
28 h-m-p 0.1738 8.0000 0.0000 -----------C 1123.581900 0 0.0000 708
Out..
lnL = -1123.581900
709 lfun, 2127 eigenQcodon, 12762 P(t)
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 72
initial w for M2:NSpselection reset.
0.048906 0.076258 0.014716 0.047066 0.038115 0.158609 0.024960 0.006596 0.015110 2.766581 0.896732 0.199894 0.157918 2.073080
ntime & nrate & np: 9 3 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.246470
np = 14
lnL0 = -1163.988478
Iterating by ming2
Initial: fx= 1163.988478
x= 0.04891 0.07626 0.01472 0.04707 0.03811 0.15861 0.02496 0.00660 0.01511 2.76658 0.89673 0.19989 0.15792 2.07308
1 h-m-p 0.0000 0.0007 123.0125 ++YYCCC 1162.693863 4 0.0002 27 | 0/14
2 h-m-p 0.0003 0.0029 104.1600 CYCCC 1162.215154 4 0.0002 51 | 0/14
3 h-m-p 0.0001 0.0009 167.0589 +YYYYCCCCC 1159.837577 8 0.0005 81 | 0/14
4 h-m-p 0.0001 0.0003 373.7890 +YYCCC 1157.586651 4 0.0002 105 | 0/14
5 h-m-p 0.0000 0.0001 281.4944 ++ 1155.998535 m 0.0001 122 | 1/14
6 h-m-p 0.0001 0.0015 243.9265 +YC 1154.758720 1 0.0008 141 | 1/14
7 h-m-p 0.0007 0.0034 80.3963 +CYC 1153.096473 2 0.0026 162 | 1/14
8 h-m-p 0.0006 0.0028 66.8948 +YCCC 1151.899904 3 0.0018 185 | 1/14
9 h-m-p 0.0003 0.0016 59.2583 ++ 1149.765090 m 0.0016 202 | 1/14
10 h-m-p 0.0013 0.0077 71.3074 +YYYCCC 1142.994960 5 0.0049 227 | 0/14
11 h-m-p 0.0002 0.0012 428.7819 CYCC 1140.709229 3 0.0003 249 | 0/14
12 h-m-p 0.0003 0.0017 254.8265 CYCCC 1137.658661 4 0.0006 273 | 0/14
13 h-m-p 0.0183 0.0917 8.1720 ++ 1132.721856 m 0.0917 290 | 1/14
14 h-m-p 0.2990 1.4951 0.9055 CYCCC 1130.205039 4 0.2601 314 | 1/14
15 h-m-p 0.1446 0.7229 0.6340 CYCCC 1127.751649 4 0.2734 351 | 1/14
16 h-m-p 0.2440 3.2633 0.7102 YCCC 1125.985130 3 0.5269 386 | 1/14
17 h-m-p 0.6572 3.2858 0.4549 YCCC 1124.812080 3 1.1100 421 | 1/14
18 h-m-p 1.4910 8.0000 0.3387 CYC 1124.098952 2 1.4071 454 | 1/14
19 h-m-p 1.2766 6.7793 0.3733 YCCC 1123.848634 3 0.7921 489 | 1/14
20 h-m-p 1.3481 6.7403 0.1308 CYC 1123.754718 2 1.2286 522 | 0/14
21 h-m-p 0.5512 8.0000 0.2916 +YCC 1123.600023 2 1.4787 556 | 0/14
22 h-m-p 0.9586 8.0000 0.4498 CCC 1123.406947 2 1.3928 591 | 0/14
23 h-m-p 1.6000 8.0000 0.3902 YCC 1123.303015 2 1.0480 625 | 0/14
24 h-m-p 1.6000 8.0000 0.0348 YCC 1123.284120 2 0.9552 659 | 0/14
25 h-m-p 0.9278 8.0000 0.0359 CC 1123.281242 1 1.2947 692 | 0/14
26 h-m-p 1.1128 8.0000 0.0417 CC 1123.279084 1 1.6939 725 | 0/14
27 h-m-p 1.2299 8.0000 0.0575 +YC 1123.274008 1 3.9356 758 | 0/14
28 h-m-p 1.6000 8.0000 0.1393 CCC 1123.267338 2 2.6132 793 | 0/14
29 h-m-p 1.6000 8.0000 0.1431 CY 1123.262258 1 1.6686 826 | 0/14
30 h-m-p 1.4844 8.0000 0.1609 YC 1123.254681 1 3.3124 858 | 0/14
31 h-m-p 1.6000 8.0000 0.2827 YC 1123.244831 1 2.9119 890 | 0/14
32 h-m-p 1.6000 8.0000 0.2395 C 1123.242443 0 1.5550 921 | 0/14
33 h-m-p 1.6000 8.0000 0.1605 YC 1123.240832 1 3.0162 953 | 0/14
34 h-m-p 0.6677 8.0000 0.7253 C 1123.239858 0 0.7237 984 | 0/14
35 h-m-p 1.2870 8.0000 0.4078 CY 1123.238954 1 1.5527 1017 | 0/14
36 h-m-p 1.6000 8.0000 0.3036 YC 1123.238440 1 2.9993 1049 | 0/14
37 h-m-p 1.6000 8.0000 0.3812 C 1123.238237 0 2.0967 1080 | 0/14
38 h-m-p 1.6000 8.0000 0.3195 Y 1123.238149 0 2.5622 1111 | 0/14
39 h-m-p 1.6000 8.0000 0.3775 C 1123.238108 0 2.1852 1142 | 0/14
40 h-m-p 1.6000 8.0000 0.3393 Y 1123.238090 0 2.6774 1173 | 0/14
41 h-m-p 1.6000 8.0000 0.3672 C 1123.238083 0 2.1866 1204 | 0/14
42 h-m-p 1.6000 8.0000 0.3475 Y 1123.238080 0 2.5936 1235 | 0/14
43 h-m-p 1.6000 8.0000 0.3638 C 1123.238078 0 2.1679 1266 | 0/14
44 h-m-p 1.6000 8.0000 0.3526 Y 1123.238078 0 2.7014 1297 | 0/14
45 h-m-p 1.6000 8.0000 0.3554 C 1123.238078 0 2.2187 1328 | 0/14
46 h-m-p 1.6000 8.0000 0.3498 Y 1123.238077 0 2.9720 1359 | 0/14
47 h-m-p 1.6000 8.0000 0.3295 C 1123.238077 0 2.0230 1390 | 0/14
48 h-m-p 1.3949 8.0000 0.4779 +C 1123.238077 0 5.5969 1422 | 0/14
49 h-m-p 1.6000 8.0000 0.0642 Y 1123.238077 0 0.9158 1453 | 0/14
50 h-m-p 0.2087 8.0000 0.2818 +C 1123.238077 0 0.8348 1485 | 0/14
51 h-m-p 0.0924 8.0000 2.5457 ----Y 1123.238077 0 0.0001 1520 | 0/14
52 h-m-p 0.3819 8.0000 0.0006 ------------Y 1123.238077 0 0.0000 1549 | 0/14
53 h-m-p 0.0160 8.0000 0.0010 C 1123.238077 0 0.0040 1580 | 0/14
54 h-m-p 0.0160 8.0000 0.0005 -------Y 1123.238077 0 0.0000 1618 | 0/14
55 h-m-p 0.0160 8.0000 0.0004 -------------.. | 0/14
56 h-m-p 0.0160 8.0000 0.0005 ------------- | 0/14
57 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -1123.238077
1745 lfun, 6980 eigenQcodon, 47115 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1132.610980 S = -1078.889351 -45.415818
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 95 patterns 0:22
did 20 / 95 patterns 0:22
did 30 / 95 patterns 0:22
did 40 / 95 patterns 0:23
did 50 / 95 patterns 0:23
did 60 / 95 patterns 0:23
did 70 / 95 patterns 0:23
did 80 / 95 patterns 0:23
did 90 / 95 patterns 0:23
did 95 / 95 patterns 0:23
Time used: 0:23
Model 3: discrete
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 72
0.048906 0.076258 0.014716 0.047066 0.038115 0.158609 0.024960 0.006596 0.015110 2.792927 0.215184 0.509770 0.042059 0.105354 0.152676
ntime & nrate & np: 9 4 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 13.629895
np = 15
lnL0 = -1127.268722
Iterating by ming2
Initial: fx= 1127.268722
x= 0.04891 0.07626 0.01472 0.04707 0.03811 0.15861 0.02496 0.00660 0.01511 2.79293 0.21518 0.50977 0.04206 0.10535 0.15268
1 h-m-p 0.0000 0.0002 81.9325 +YCYCCC 1126.913216 5 0.0001 44 | 0/15
2 h-m-p 0.0001 0.0010 150.3209 YCCC 1126.497990 3 0.0001 82 | 0/15
3 h-m-p 0.0002 0.0009 70.8221 CYCCC 1126.056311 4 0.0003 122 | 0/15
4 h-m-p 0.0002 0.0009 44.5380 CCCC 1125.897547 3 0.0003 161 | 0/15
5 h-m-p 0.0001 0.0005 47.4858 ++ 1125.557027 m 0.0005 194 | 1/15
6 h-m-p 0.0005 0.0076 20.5464 +CCCC 1125.357765 3 0.0022 234 | 1/15
7 h-m-p 0.0002 0.0008 147.7250 YCCCC 1125.099303 4 0.0004 273 | 1/15
8 h-m-p 0.0012 0.0059 20.7534 CC 1125.028249 1 0.0010 307 | 1/15
9 h-m-p 0.0048 0.0310 4.3554 -YC 1125.024011 1 0.0005 341 | 0/15
10 h-m-p 0.0003 0.0680 7.3637 +CYC 1124.985106 2 0.0015 377 | 0/15
11 h-m-p 0.0011 0.0076 9.5989 CCC 1124.961389 2 0.0009 414 | 0/15
12 h-m-p 0.0011 0.0054 8.4299 YC 1124.949305 1 0.0007 448 | 0/15
13 h-m-p 0.0139 0.3349 0.4363 ++YCCC 1124.852378 3 0.1562 488 | 0/15
14 h-m-p 0.1070 1.6415 0.6370 +CCCC 1124.480177 3 0.5267 528 | 0/15
15 h-m-p 0.6538 3.2690 0.1802 CCC 1124.455218 2 0.6937 565 | 0/15
16 h-m-p 1.0220 5.1101 0.1146 YC 1124.417632 1 1.8667 599 | 0/15
17 h-m-p 0.5173 8.0000 0.4135 +CCCCC 1124.297388 4 2.4770 641 | 0/15
18 h-m-p 0.6722 3.3609 0.7986 CCCC 1124.220140 3 0.7480 680 | 0/15
19 h-m-p 0.2916 1.4578 0.1859 YCCC 1124.155008 3 0.5404 718 | 0/15
20 h-m-p 0.3330 3.5441 0.3016 +CCC 1124.067208 2 1.6534 756 | 0/15
21 h-m-p 0.1729 0.8646 0.1987 ++ 1123.996892 m 0.8646 789 | 1/15
22 h-m-p 0.0700 2.5144 2.4539 +CCC 1123.849922 2 0.2758 827 | 1/15
23 h-m-p 0.4648 2.3239 1.3708 YYCCC 1123.715994 4 0.3732 865 | 1/15
24 h-m-p 0.5360 8.0000 0.9543 YYC 1123.635668 2 0.4521 899 | 0/15
25 h-m-p 0.2501 8.0000 1.7251 CYC 1123.600129 2 0.0490 934 | 0/15
26 h-m-p 0.1471 8.0000 0.5750 +CCCC 1123.508195 3 0.8449 974 | 0/15
27 h-m-p 0.8541 4.2703 0.1839 CC 1123.435821 1 1.1532 1009 | 0/15
28 h-m-p 0.5919 8.0000 0.3583 +YCCC 1123.299496 3 3.5178 1048 | 0/15
29 h-m-p 1.6000 8.0000 0.4565 YC 1123.249980 1 1.2454 1082 | 0/15
30 h-m-p 1.6000 8.0000 0.1962 YC 1123.241227 1 0.6492 1116 | 0/15
31 h-m-p 0.7469 8.0000 0.1705 YC 1123.238216 1 1.6452 1150 | 0/15
32 h-m-p 1.6000 8.0000 0.0201 Y 1123.238081 0 1.2450 1183 | 0/15
33 h-m-p 1.6000 8.0000 0.0024 Y 1123.238078 0 1.1412 1216 | 0/15
34 h-m-p 1.6000 8.0000 0.0002 Y 1123.238078 0 1.1183 1249 | 0/15
35 h-m-p 1.6000 8.0000 0.0000 +Y 1123.238078 0 6.7430 1283 | 0/15
36 h-m-p 1.4480 8.0000 0.0001 ++ 1123.238077 m 8.0000 1316 | 0/15
37 h-m-p 1.6000 8.0000 0.0005 C 1123.238077 0 1.4877 1349 | 0/15
38 h-m-p 1.6000 8.0000 0.0001 Y 1123.238077 0 1.2603 1382 | 0/15
39 h-m-p 1.6000 8.0000 0.0000 C 1123.238077 0 1.6000 1415 | 0/15
40 h-m-p 1.6000 8.0000 0.0000 ------Y 1123.238077 0 0.0001 1454
Out..
lnL = -1123.238077
1455 lfun, 5820 eigenQcodon, 39285 P(t)
Time used: 0:35
Model 7: beta
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 72
0.048906 0.076258 0.014716 0.047066 0.038115 0.158609 0.024960 0.006596 0.015110 2.792928 0.603915 1.022819
ntime & nrate & np: 9 1 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.246250
np = 12
lnL0 = -1143.313945
Iterating by ming2
Initial: fx= 1143.313945
x= 0.04891 0.07626 0.01472 0.04707 0.03811 0.15861 0.02496 0.00660 0.01511 2.79293 0.60392 1.02282
1 h-m-p 0.0000 0.0003 91.8910 ++YYCC 1142.755998 3 0.0001 35 | 0/12
2 h-m-p 0.0001 0.0084 167.4359 CYCCC 1142.461361 4 0.0001 69 | 0/12
3 h-m-p 0.0001 0.0013 84.2326 +YYCCCCC 1141.380721 6 0.0005 107 | 0/12
4 h-m-p 0.0001 0.0005 175.3184 YCCCC 1140.505573 4 0.0002 141 | 0/12
5 h-m-p 0.0003 0.0037 165.5508 +YYCYYCCC 1130.968843 7 0.0022 180 | 0/12
6 h-m-p 0.0000 0.0002 1475.1225 CYCCCC 1129.505432 5 0.0000 216 | 0/12
7 h-m-p 0.0001 0.0005 113.4941 CCCC 1129.235805 3 0.0002 249 | 0/12
8 h-m-p 0.0012 0.0063 13.6941 YYYC 1129.132855 3 0.0011 279 | 0/12
9 h-m-p 0.0003 0.0185 49.0871 ++YYCC 1127.876387 3 0.0044 312 | 0/12
10 h-m-p 0.0006 0.0030 219.4052 CCCC 1127.346661 3 0.0005 345 | 0/12
11 h-m-p 0.0007 0.0165 149.9429 +CYCC 1125.552903 3 0.0025 378 | 0/12
12 h-m-p 0.8984 4.4918 0.1453 CCCCC 1124.471035 4 1.1797 413 | 0/12
13 h-m-p 1.6000 8.0000 0.0614 YYC 1124.368570 2 1.3003 442 | 0/12
14 h-m-p 1.6000 8.0000 0.0152 YC 1124.362060 1 1.0814 470 | 0/12
15 h-m-p 0.9976 8.0000 0.0165 CC 1124.361225 1 1.2180 499 | 0/12
16 h-m-p 1.2031 8.0000 0.0167 CC 1124.360164 1 1.7756 528 | 0/12
17 h-m-p 1.0563 8.0000 0.0281 +C 1124.356247 0 4.1912 556 | 0/12
18 h-m-p 1.6000 8.0000 0.0397 CC 1124.353578 1 2.1308 585 | 0/12
19 h-m-p 1.6000 8.0000 0.0133 C 1124.353338 0 1.6616 612 | 0/12
20 h-m-p 1.6000 8.0000 0.0003 C 1124.353306 0 1.7010 639 | 0/12
21 h-m-p 0.7730 8.0000 0.0006 Y 1124.353303 0 1.5963 666 | 0/12
22 h-m-p 1.6000 8.0000 0.0003 C 1124.353303 0 1.3578 693 | 0/12
23 h-m-p 1.6000 8.0000 0.0000 C 1124.353303 0 1.4863 720 | 0/12
24 h-m-p 1.6000 8.0000 0.0000 C 1124.353303 0 1.6778 747 | 0/12
25 h-m-p 1.6000 8.0000 0.0000 C 1124.353303 0 0.4000 774 | 0/12
26 h-m-p 0.2144 8.0000 0.0000 --------C 1124.353303 0 0.0000 809
Out..
lnL = -1124.353303
810 lfun, 8910 eigenQcodon, 72900 P(t)
Time used: 0:59
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 72
initial w for M8:NSbetaw>1 reset.
0.048906 0.076258 0.014716 0.047066 0.038115 0.158609 0.024960 0.006596 0.015110 2.761680 0.900000 0.523761 1.873198 2.941449
ntime & nrate & np: 9 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.067419
np = 14
lnL0 = -1145.274604
Iterating by ming2
Initial: fx= 1145.274604
x= 0.04891 0.07626 0.01472 0.04707 0.03811 0.15861 0.02496 0.00660 0.01511 2.76168 0.90000 0.52376 1.87320 2.94145
1 h-m-p 0.0000 0.0007 211.9929 +++YCCCC 1135.798489 4 0.0004 43 | 0/14
2 h-m-p 0.0000 0.0002 153.7299 +CYCCC 1133.908147 4 0.0002 82 | 0/14
3 h-m-p 0.0000 0.0000 571.8117 ++ 1133.013362 m 0.0000 113 | 0/14
4 h-m-p 0.0000 0.0000 35.7392
h-m-p: 0.00000000e+00 0.00000000e+00 3.57392498e+01 1133.013362
.. | 0/14
5 h-m-p 0.0000 0.0006 114.1028 ++CYCCC 1131.314029 4 0.0003 181 | 0/14
6 h-m-p 0.0000 0.0002 133.9012 YCYCCC 1130.644262 5 0.0001 220 | 0/14
7 h-m-p 0.0000 0.0002 77.1697 ++ 1130.374575 m 0.0002 251 | 1/14
8 h-m-p 0.0002 0.0042 51.3472 +CCCCC 1129.427926 4 0.0011 291 | 1/14
9 h-m-p 0.0004 0.0027 167.0277 +YYCCC 1126.236801 4 0.0011 328 | 1/14
10 h-m-p 0.0003 0.0016 167.8773 CCCCC 1125.325234 4 0.0004 366 | 1/14
11 h-m-p 0.0008 0.0038 23.3964 YC 1125.271434 1 0.0003 397 | 0/14
12 h-m-p 0.0001 0.0030 88.8795 CYC 1125.095255 2 0.0001 430 | 0/14
13 h-m-p 0.0005 0.0222 9.9006 CCC 1125.059152 2 0.0008 465 | 0/14
14 h-m-p 0.0027 0.0352 2.9551 YC 1125.052960 1 0.0012 497 | 0/14
15 h-m-p 0.0004 0.0639 9.5545 ++CCC 1124.943085 2 0.0073 534 | 0/14
16 h-m-p 0.0006 0.0107 126.0072 +CCCC 1124.423381 3 0.0027 572 | 0/14
17 h-m-p 0.0009 0.0047 204.5545 YCCC 1124.235262 3 0.0006 608 | 0/14
18 h-m-p 0.7565 5.2308 0.1681 CCCC 1123.999141 3 1.1286 645 | 0/14
19 h-m-p 1.1936 8.0000 0.1590 CCC 1123.941661 2 1.0074 680 | 0/14
20 h-m-p 1.1211 8.0000 0.1429 CCC 1123.903254 2 1.5770 715 | 0/14
21 h-m-p 1.2607 8.0000 0.1787 +YC 1123.838108 1 3.2730 748 | 0/14
22 h-m-p 1.1092 8.0000 0.5273 CCC 1123.752375 2 1.6628 783 | 0/14
23 h-m-p 1.4415 8.0000 0.6082 YC 1123.612660 1 2.6201 815 | 0/14
24 h-m-p 1.6000 8.0000 0.6246 CC 1123.553783 1 2.2494 848 | 0/14
25 h-m-p 1.6000 8.0000 0.5376 YC 1123.499144 1 3.9872 880 | 0/14
26 h-m-p 1.6000 8.0000 1.0937 YCCC 1123.419609 3 3.4905 916 | 0/14
27 h-m-p 1.6000 8.0000 1.6648 YC 1123.362395 1 2.5767 948 | 0/14
28 h-m-p 1.6000 8.0000 2.0375 YC 1123.331962 1 3.8797 980 | 0/14
29 h-m-p 1.6000 8.0000 3.5000 YC 1123.305329 1 3.0282 1012 | 0/14
30 h-m-p 1.6000 8.0000 4.6315 YC 1123.289474 1 3.5911 1044 | 0/14
31 h-m-p 1.3651 6.8257 6.8193 YC 1123.277971 1 3.0299 1076 | 0/14
32 h-m-p 0.5145 2.5723 10.0627 ++ 1123.270428 m 2.5723 1107 | 1/14
33 h-m-p 0.3342 8.0000 5.3848 ---------------.. | 1/14
34 h-m-p 0.0001 0.0388 1.3758 YC 1123.270261 1 0.0002 1182 | 1/14
35 h-m-p 0.0002 0.0088 1.0776 C 1123.270233 0 0.0001 1212 | 1/14
36 h-m-p 0.0001 0.0457 0.8002 C 1123.270210 0 0.0001 1242 | 1/14
37 h-m-p 0.0007 0.2909 0.1369 Y 1123.270206 0 0.0005 1272 | 1/14
38 h-m-p 0.0014 0.6827 0.2849 C 1123.270200 0 0.0004 1302 | 1/14
39 h-m-p 0.0033 1.6498 0.2393 C 1123.270192 0 0.0008 1332 | 1/14
40 h-m-p 0.0008 0.3793 0.3670 C 1123.270183 0 0.0007 1362 | 1/14
41 h-m-p 0.0028 1.3950 0.4354 +YC 1123.270074 1 0.0074 1394 | 1/14
42 h-m-p 0.0012 0.5754 7.9679 YC 1123.269830 1 0.0009 1425 | 1/14
43 h-m-p 0.0011 0.5495 11.1002 +YC 1123.266493 1 0.0089 1457 | 1/14
44 h-m-p 0.0008 0.0550 125.1714 YC 1123.260688 1 0.0014 1488 | 1/14
45 h-m-p 1.6000 8.0000 0.0649 YC 1123.259686 1 0.7179 1519 | 1/14
46 h-m-p 1.2164 8.0000 0.0383 CC 1123.258733 1 1.9064 1551 | 1/14
47 h-m-p 1.6000 8.0000 0.0046 Y 1123.258724 0 1.0015 1581 | 1/14
48 h-m-p 1.6000 8.0000 0.0002 Y 1123.258724 0 0.9900 1611 | 1/14
49 h-m-p 1.6000 8.0000 0.0000 Y 1123.258724 0 0.6839 1641 | 1/14
50 h-m-p 1.2808 8.0000 0.0000 C 1123.258724 0 0.3202 1671 | 1/14
51 h-m-p 0.3391 8.0000 0.0000 +Y 1123.258724 0 1.0290 1702 | 1/14
52 h-m-p 1.6000 8.0000 0.0000 C 1123.258724 0 1.6000 1732 | 1/14
53 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/14
54 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -1123.258724
1818 lfun, 21816 eigenQcodon, 179982 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1133.104853 S = -1078.882971 -46.578192
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 95 patterns 1:58
did 20 / 95 patterns 1:58
did 30 / 95 patterns 1:58
did 40 / 95 patterns 1:58
did 50 / 95 patterns 1:59
did 60 / 95 patterns 1:59
did 70 / 95 patterns 1:59
did 80 / 95 patterns 1:59
did 90 / 95 patterns 1:59
did 95 / 95 patterns 1:59
Time used: 1:59
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=186
D_melanogaster_4EHP-PC MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
D_sechellia_4EHP-PC MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
D_simulans_4EHP-PC MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH
D_yakuba_4EHP-PC MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH
D_erecta_4EHP-PC MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
D_elegans_4EHP-PC MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH
*******.****:* ***:********:*:***::***************
D_melanogaster_4EHP-PC TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
D_sechellia_4EHP-PC TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
D_simulans_4EHP-PC TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
D_yakuba_4EHP-PC TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
D_erecta_4EHP-PC TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
D_elegans_4EHP-PC TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY
********* *****:*******:**************************
D_melanogaster_4EHP-PC RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
D_sechellia_4EHP-PC RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
D_simulans_4EHP-PC RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
D_yakuba_4EHP-PC RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
D_erecta_4EHP-PC RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
D_elegans_4EHP-PC RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF
*** ****** **************:*******::***************
D_melanogaster_4EHP-PC LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT
D_sechellia_4EHP-PC LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
D_simulans_4EHP-PC LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT
D_yakuba_4EHP-PC LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT
D_erecta_4EHP-PC LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT
D_elegans_4EHP-PC LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
********:**********:: ********** ***
>D_melanogaster_4EHP-PC ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC AGATATTGTCGACAGCGACGACAGCGATGTGGATAATCAGATAGATGTGG ACAACCTGCCACCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGCGCGGCCGCCGA CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTAC CGGGAGCTCCTCCTCTTCAAGCAGGGCATCATACCGATGTGGGAGGACCC GGCGAACAGCAAGGGCGGCCAGTGGTTGATACGACTACGCAAGAACAAGG TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGCGATG GAGTCACG >D_sechellia_4EHP-PC ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC AGATATCGTCGACAGCGACGACAGCGATGTGGATAACGAAATAGATGTGG ACAACCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGA CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACAGCCCTGAAGCCCTAC CGGGAGCTCCTCCTCTTCAAGCAGGGTATCATACCGATGTGGGAGGACCC GGCGAACAGCAAGGGCGGACAATGGTTGATACGGCTGCGCAAGAACAAGG TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGCCCTG GAGTCACG >D_simulans_4EHP-PC ATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCC AGATATCGTCGACAGCGACGACAGCGATGTGGATAACGAGATAGATGTGG ACAACCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC ACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGA CTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGT GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACAGCCCTGAAGCCCTAC CGGGAGCTCCTCCTCTTCAAGCAGGGTATCGTGCCGATGTGGGAGGACCC GGCGAACAGCAAGGGCGGACAATGGTTGATACGGCTGCGCAAGAACAAGG TCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC CTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGACGAAATATCCGAT AAAAACCGAACACAGCCGGCCAATGCATACAAATGAGCGAAGGAGTCCTG GAGTCACG >D_yakuba_4EHP-PC ATGAGCATGGAGAAAGTAGCCAACAAGCAGTATGAGTCGAAAAACTGGCC AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAACGAGATAGACGTGG AGAAGCTCCCCCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC ACATACTGCCTCTGGTTCTCTCGCAAGGGTACGCAACGGGCGGCCGCCGA CTACAGCAAATCGCTGCACGTGGTCGGACGGTGCGCCAGCGTGCAGCAGT GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTAC CGGGAGCTCAGCCTCTTCAAGCAGGGCATCAAACCGATGTGGGAGGACCC GGCGAACAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAGA TCGAGCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTT CTCGTCGGCGACGAGATATGCGGAATCGTGCTACAGACGAAATATCCGAT AAAAACCGAACACCGCCGGCCAATGCATACAAATGAGCGAAGGAGCCCGG GAGTCACG >D_erecta_4EHP-PC ATGAGCATGGAGAAAGTAGCCAACAAGCAGTATGAGTCGAAAAACTGGCC AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAATGAGATAGACGTGG ACAAGCTGCCGCCACTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC ACATACTGCCTCTGGTTCTCTCGCAAGGGGACGCAGCGGGCGGCCGCCGA CTACAGCAAATCGCTGCACGTGGTCGGCCGGTGCGCCAGCGTGCAGCAAT GGTGGTCGCTCTACTCGCACCTCATCCGGCCCACTGCCCTGAAGCCCTAC CGGGAGCTCAGCCTCTTCAAGCAGGGCATCAAACCGATGTGGGAGGACCC TGCGAACAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAGA TCGAGCGGGCCTGGGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTC CTCGTCGGCGACGAGATATGCGGAATCGTGCTACAAACGAAATATCCGAT AAAAACCAAACACAGTCGGCCAATGCATACAAATGAGCGAAGGAGCCCGG GAGTCACG >D_elegans_4EHP-PC ATGAGCATGGAGAAAGTAGCGAGCAAGCAGTACGAGTCGAAAATCTGGCC AGATCTCGTCGACAGCGACGACAGCGATGTGGAGAACGAGATAGATGTGG ATAAGCTGCCTCCGCTGGAGGTGGGTCCCGGCGAGAACCGGCTGCAGCAC ACATACTGCCTCTGGTTCTCCCGCAAAGGGACGCAGCGGGCGGCCTCCGA CTACAGCAAGTCGCTGCACGTGGTCGGCCGGTGCGCCAGCGTGCAGCAGT GGTGGTCGCTCTACTCGCATCTCATCCGGCCCACCGCCCTTAAGCCCTAC CGGGAGCTCAGCCTGTTCAAGCAGGGCATCAAGCCGATGTGGGAGGACCC GGCGAATAGCAAGGGCGGCCAGTGGGTGATACGGCTGCGCAAGAACAAAA TCGAGCGAGCCTGGGAGAACGTCTGCATGGCGATGCTCGGAGAGCAGTTT CTCGTCGGCGACGAGATATGCGGCATTGTGCTACAGACGAAATATCCGAT AAAAACCAAACGCAGTCGCCCAATGCATACAAATGAGCGGAGGAGCCCTG GAGTCACG
>D_melanogaster_4EHP-PC MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT >D_sechellia_4EHP-PC MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT >D_simulans_4EHP-PC MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQH TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY RELLLFKQGIVPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSPGVT >D_yakuba_4EHP-PC MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVEKLPPLEVGPGENRLQH TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF LVGDEICGIVLQTKYPIKTEHRRPMHTNERRSPGVT >D_erecta_4EHP-PC MSMEKVANKQYESKNWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH TYCLWFSRKGTQRAAADYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF LVGDEICGIVLQTKYPIKTKHSRPMHTNERRSPGVT >D_elegans_4EHP-PC MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLEVGPGENRLQH TYCLWFSRKGTQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPY RELSLFKQGIKPMWEDPANSKGGQWVIRLRKNKIERAWENVCMAMLGEQF LVGDEICGIVLQTKYPIKTKRSRPMHTNERRSPGVT
#NEXUS
[ID: 7562238747]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_4EHP-PC
D_sechellia_4EHP-PC
D_simulans_4EHP-PC
D_yakuba_4EHP-PC
D_erecta_4EHP-PC
D_elegans_4EHP-PC
;
end;
begin trees;
translate
1 D_melanogaster_4EHP-PC,
2 D_sechellia_4EHP-PC,
3 D_simulans_4EHP-PC,
4 D_yakuba_4EHP-PC,
5 D_erecta_4EHP-PC,
6 D_elegans_4EHP-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02651951,((4:0.02751152,5:0.01748174)0.655:0.01146223,6:0.09773044)1.000:0.05936864,(2:0.004008206,3:0.008877298)0.988:0.01337923);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02651951,((4:0.02751152,5:0.01748174):0.01146223,6:0.09773044):0.05936864,(2:0.004008206,3:0.008877298):0.01337923);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1190.31 -1201.62
2 -1189.97 -1204.03
--------------------------------------
TOTAL -1190.13 -1203.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/4EHP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.280929 0.003202 0.181063 0.394628 0.275292 1259.35 1270.70 1.000
r(A<->C){all} 0.071970 0.000945 0.021271 0.134133 0.068368 780.19 933.85 1.000
r(A<->G){all} 0.194199 0.002985 0.091518 0.302733 0.190111 610.47 613.23 1.000
r(A<->T){all} 0.050709 0.001588 0.000003 0.126243 0.042169 679.55 723.10 1.000
r(C<->G){all} 0.063712 0.000698 0.016475 0.116520 0.060413 964.50 985.30 1.000
r(C<->T){all} 0.471510 0.008747 0.282010 0.647502 0.469780 478.79 522.61 1.000
r(G<->T){all} 0.147900 0.003028 0.050256 0.256120 0.140921 547.31 618.92 1.000
pi(A){all} 0.252698 0.000315 0.219549 0.288960 0.252361 1013.58 1040.22 1.000
pi(C){all} 0.279210 0.000317 0.245774 0.313919 0.279351 1145.25 1269.69 1.000
pi(G){all} 0.317237 0.000347 0.280985 0.353037 0.316754 1163.96 1189.76 1.000
pi(T){all} 0.150855 0.000202 0.124092 0.179251 0.150352 1254.95 1342.43 1.000
alpha{1,2} 0.074764 0.004235 0.000101 0.191338 0.059423 1362.55 1390.03 1.000
alpha{3} 1.471551 0.480868 0.428196 2.840744 1.346490 1350.79 1425.90 1.000
pinvar{all} 0.453619 0.011691 0.252176 0.670771 0.467630 1192.62 1262.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/4EHP-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 186
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 1 0 1 | Ser TCT 1 1 1 1 1 0 | Tyr TAT 1 1 1 2 2 1 | Cys TGT 1 1 1 1 1 0
TTC 3 3 3 2 3 2 | TCC 0 0 0 0 0 2 | TAC 5 5 5 4 4 5 | TGC 3 3 3 3 3 4
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 0 0 0 | TCG 3 3 3 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 1 | Pro CCT 0 1 1 0 1 2 | His CAT 1 1 1 1 1 2 | Arg CGT 0 0 0 0 0 0
CTC 8 8 8 9 8 7 | CCC 3 3 3 4 3 3 | CAC 4 4 4 4 4 2 | CGC 3 2 2 3 2 4
CTA 2 1 1 1 1 1 | CCA 4 3 3 3 3 2 | Gln CAA 0 1 1 1 2 0 | CGA 2 1 1 1 1 1
CTG 5 6 6 5 6 6 | CCG 3 4 4 4 4 4 | CAG 10 8 8 8 7 9 | CGG 6 8 8 8 8 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 0 0 0 0 1 | Thr ACT 0 0 0 0 1 0 | Asn AAT 2 1 1 1 2 2 | Ser AGT 0 0 1 0 1 1
ATC 2 3 3 4 4 4 | ACC 2 1 1 2 1 2 | AAC 7 8 8 7 6 4 | AGC 8 8 7 8 8 9
ATA 5 5 4 4 4 4 | ACA 2 3 3 2 2 2 | Lys AAA 4 4 4 6 7 7 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 6 6 6 | ACG 4 4 4 3 3 3 | AAG 8 8 8 8 8 8 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 0 | Ala GCT 0 0 0 0 0 0 | Asp GAT 5 4 4 2 2 4 | Gly GGT 1 2 2 2 1 1
GTC 6 6 6 4 4 5 | GCC 6 6 6 6 6 4 | GAC 8 8 8 7 8 6 | GGC 6 4 4 5 6 7
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 1 2 1 1 0 0 | GGA 2 3 3 3 2 2
GTG 5 5 6 7 7 7 | GCG 3 3 3 3 3 4 | GAG 11 11 12 14 13 13 | GGG 1 1 1 1 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_4EHP-PC
position 1: T:0.13441 C:0.27419 A:0.28495 G:0.30645
position 2: T:0.25269 C:0.16667 A:0.36022 G:0.22043
position 3: T:0.07527 C:0.39785 A:0.12366 G:0.40323
Average T:0.15412 C:0.27957 A:0.25627 G:0.31004
#2: D_sechellia_4EHP-PC
position 1: T:0.13441 C:0.27419 A:0.28495 G:0.30645
position 2: T:0.25269 C:0.17204 A:0.35484 G:0.22043
position 3: T:0.06989 C:0.38710 A:0.12903 G:0.41398
Average T:0.15233 C:0.27778 A:0.25627 G:0.31362
#3: D_simulans_4EHP-PC
position 1: T:0.13441 C:0.27419 A:0.27957 G:0.31183
position 2: T:0.25269 C:0.17204 A:0.35484 G:0.22043
position 3: T:0.07527 C:0.38172 A:0.11828 G:0.42473
Average T:0.15412 C:0.27599 A:0.25090 G:0.31900
#4: D_yakuba_4EHP-PC
position 1: T:0.13441 C:0.27957 A:0.27957 G:0.30645
position 2: T:0.24194 C:0.17204 A:0.35484 G:0.23118
position 3: T:0.06452 C:0.38710 A:0.12366 G:0.42473
Average T:0.14695 C:0.27957 A:0.25269 G:0.32079
#5: D_erecta_4EHP-PC
position 1: T:0.13441 C:0.27419 A:0.29032 G:0.30108
position 2: T:0.24194 C:0.17204 A:0.35484 G:0.23118
position 3: T:0.07527 C:0.37634 A:0.12366 G:0.42473
Average T:0.15054 C:0.27419 A:0.25627 G:0.31900
#6: D_elegans_4EHP-PC
position 1: T:0.13978 C:0.27419 A:0.29032 G:0.29570
position 2: T:0.24731 C:0.17204 A:0.33871 G:0.24194
position 3: T:0.08602 C:0.37634 A:0.10753 G:0.43011
Average T:0.15771 C:0.27419 A:0.24552 G:0.32258
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 2 | Ser S TCT 5 | Tyr Y TAT 8 | Cys C TGT 5
TTC 16 | TCC 2 | TAC 28 | TGC 19
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 3 | TCG 21 | TAG 0 | Trp W TGG 42
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 5 | His H CAT 7 | Arg R CGT 0
CTC 48 | CCC 19 | CAC 22 | CGC 16
CTA 7 | CCA 18 | Gln Q CAA 5 | CGA 7
CTG 34 | CCG 23 | CAG 50 | CGG 45
------------------------------------------------------------------------------
Ile I ATT 2 | Thr T ACT 1 | Asn N AAT 9 | Ser S AGT 3
ATC 20 | ACC 9 | AAC 40 | AGC 48
ATA 26 | ACA 14 | Lys K AAA 32 | Arg R AGA 0
Met M ATG 39 | ACG 21 | AAG 48 | AGG 6
------------------------------------------------------------------------------
Val V GTT 5 | Ala A GCT 0 | Asp D GAT 21 | Gly G GGT 9
GTC 31 | GCC 34 | GAC 45 | GGC 32
GTA 6 | GCA 0 | Glu E GAA 5 | GGA 15
GTG 37 | GCG 19 | GAG 74 | GGG 7
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13530 C:0.27509 A:0.28495 G:0.30466
position 2: T:0.24821 C:0.17115 A:0.35305 G:0.22760
position 3: T:0.07437 C:0.38441 A:0.12097 G:0.42025
Average T:0.15263 C:0.27688 A:0.25299 G:0.31750
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_4EHP-PC
D_sechellia_4EHP-PC 0.0743 (0.0070 0.0937)
D_simulans_4EHP-PC 0.1067 (0.0105 0.0981) 0.1723 (0.0035 0.0202)
D_yakuba_4EHP-PC 0.3750 (0.0453 0.1207) 0.2945 (0.0368 0.1249) 0.2991 (0.0396 0.1325)
D_erecta_4EHP-PC 0.3574 (0.0416 0.1163) 0.2749 (0.0331 0.1204) 0.2808 (0.0360 0.1281) 0.0689 (0.0070 0.1014)
D_elegans_4EHP-PC 0.2078 (0.0515 0.2476) 0.1790 (0.0441 0.2464) 0.1886 (0.0454 0.2406) 0.0628 (0.0164 0.2614) 0.0328 (0.0093 0.2848)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 72
lnL(ntime: 9 np: 11): -1126.706968 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.052915 0.107541 0.016294 0.055174 0.035339 0.167208 0.024466 0.004736 0.017950 2.734242 0.084118
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.48162
(1: 0.052915, ((4: 0.055174, 5: 0.035339): 0.016294, 6: 0.167208): 0.107541, (2: 0.004736, 3: 0.017950): 0.024466);
(D_melanogaster_4EHP-PC: 0.052915, ((D_yakuba_4EHP-PC: 0.055174, D_erecta_4EHP-PC: 0.035339): 0.016294, D_elegans_4EHP-PC: 0.167208): 0.107541, (D_sechellia_4EHP-PC: 0.004736, D_simulans_4EHP-PC: 0.017950): 0.024466);
Detailed output identifying parameters
kappa (ts/tv) = 2.73424
omega (dN/dS) = 0.08412
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.053 460.4 97.6 0.0841 0.0061 0.0722 2.8 7.0
7..8 0.108 460.4 97.6 0.0841 0.0123 0.1467 5.7 14.3
8..9 0.016 460.4 97.6 0.0841 0.0019 0.0222 0.9 2.2
9..4 0.055 460.4 97.6 0.0841 0.0063 0.0753 2.9 7.3
9..5 0.035 460.4 97.6 0.0841 0.0041 0.0482 1.9 4.7
8..6 0.167 460.4 97.6 0.0841 0.0192 0.2281 8.8 22.3
7..10 0.024 460.4 97.6 0.0841 0.0028 0.0334 1.3 3.3
10..2 0.005 460.4 97.6 0.0841 0.0005 0.0065 0.3 0.6
10..3 0.018 460.4 97.6 0.0841 0.0021 0.0245 0.9 2.4
tree length for dN: 0.0553
tree length for dS: 0.6570
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 72
lnL(ntime: 9 np: 12): -1123.581900 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.054623 0.112322 0.017218 0.056205 0.035631 0.173088 0.025363 0.004879 0.018331 2.766581 0.959232 0.054164
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.49766
(1: 0.054623, ((4: 0.056205, 5: 0.035631): 0.017218, 6: 0.173088): 0.112322, (2: 0.004879, 3: 0.018331): 0.025363);
(D_melanogaster_4EHP-PC: 0.054623, ((D_yakuba_4EHP-PC: 0.056205, D_erecta_4EHP-PC: 0.035631): 0.017218, D_elegans_4EHP-PC: 0.173088): 0.112322, (D_sechellia_4EHP-PC: 0.004879, D_simulans_4EHP-PC: 0.018331): 0.025363);
Detailed output identifying parameters
kappa (ts/tv) = 2.76658
dN/dS (w) for site classes (K=2)
p: 0.95923 0.04077
w: 0.05416 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.055 460.2 97.8 0.0927 0.0067 0.0723 3.1 7.1
7..8 0.112 460.2 97.8 0.0927 0.0138 0.1488 6.3 14.5
8..9 0.017 460.2 97.8 0.0927 0.0021 0.0228 1.0 2.2
9..4 0.056 460.2 97.8 0.0927 0.0069 0.0744 3.2 7.3
9..5 0.036 460.2 97.8 0.0927 0.0044 0.0472 2.0 4.6
8..6 0.173 460.2 97.8 0.0927 0.0213 0.2292 9.8 22.4
7..10 0.025 460.2 97.8 0.0927 0.0031 0.0336 1.4 3.3
10..2 0.005 460.2 97.8 0.0927 0.0006 0.0065 0.3 0.6
10..3 0.018 460.2 97.8 0.0927 0.0023 0.0243 1.0 2.4
Time used: 0:07
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 72
check convergence..
lnL(ntime: 9 np: 14): -1123.238077 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.056048 0.115502 0.018152 0.057052 0.036182 0.178458 0.026230 0.005086 0.018665 2.792927 0.977671 0.000000 0.061710 2.104014
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51137
(1: 0.056048, ((4: 0.057052, 5: 0.036182): 0.018152, 6: 0.178458): 0.115502, (2: 0.005086, 3: 0.018665): 0.026230);
(D_melanogaster_4EHP-PC: 0.056048, ((D_yakuba_4EHP-PC: 0.057052, D_erecta_4EHP-PC: 0.036182): 0.018152, D_elegans_4EHP-PC: 0.178458): 0.115502, (D_sechellia_4EHP-PC: 0.005086, D_simulans_4EHP-PC: 0.018665): 0.026230);
Detailed output identifying parameters
kappa (ts/tv) = 2.79293
dN/dS (w) for site classes (K=3)
p: 0.97767 0.00000 0.02233
w: 0.06171 1.00000 2.10401
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.056 460.1 97.9 0.1073 0.0076 0.0708 3.5 6.9
7..8 0.116 460.1 97.9 0.1073 0.0157 0.1459 7.2 14.3
8..9 0.018 460.1 97.9 0.1073 0.0025 0.0229 1.1 2.2
9..4 0.057 460.1 97.9 0.1073 0.0077 0.0721 3.6 7.1
9..5 0.036 460.1 97.9 0.1073 0.0049 0.0457 2.3 4.5
8..6 0.178 460.1 97.9 0.1073 0.0242 0.2254 11.1 22.1
7..10 0.026 460.1 97.9 0.1073 0.0036 0.0331 1.6 3.2
10..2 0.005 460.1 97.9 0.1073 0.0007 0.0064 0.3 0.6
10..3 0.019 460.1 97.9 0.1073 0.0025 0.0236 1.2 2.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_4EHP-PC)
Pr(w>1) post mean +- SE for w
104 L 0.575 1.237
111 I 0.955* 2.012
170 E 0.816 1.728
183 D 0.902 1.904
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_4EHP-PC)
Pr(w>1) post mean +- SE for w
111 I 0.713 2.528 +- 1.953
170 E 0.518 1.810 +- 1.433
183 D 0.683 2.454 +- 1.957
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.409 0.223 0.133 0.083 0.053 0.035 0.024 0.017 0.013 0.010
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.993
sum of density on p0-p1 = 1.000000
Time used: 0:23
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 72
lnL(ntime: 9 np: 15): -1123.238077 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.056048 0.115502 0.018152 0.057052 0.036182 0.178458 0.026230 0.005086 0.018665 2.792928 0.975114 0.002558 0.061711 0.061714 2.104019
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51137
(1: 0.056048, ((4: 0.057052, 5: 0.036182): 0.018152, 6: 0.178458): 0.115502, (2: 0.005086, 3: 0.018665): 0.026230);
(D_melanogaster_4EHP-PC: 0.056048, ((D_yakuba_4EHP-PC: 0.057052, D_erecta_4EHP-PC: 0.036182): 0.018152, D_elegans_4EHP-PC: 0.178458): 0.115502, (D_sechellia_4EHP-PC: 0.005086, D_simulans_4EHP-PC: 0.018665): 0.026230);
Detailed output identifying parameters
kappa (ts/tv) = 2.79293
dN/dS (w) for site classes (K=3)
p: 0.97511 0.00256 0.02233
w: 0.06171 0.06171 2.10402
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.056 460.1 97.9 0.1073 0.0076 0.0708 3.5 6.9
7..8 0.116 460.1 97.9 0.1073 0.0157 0.1459 7.2 14.3
8..9 0.018 460.1 97.9 0.1073 0.0025 0.0229 1.1 2.2
9..4 0.057 460.1 97.9 0.1073 0.0077 0.0721 3.6 7.1
9..5 0.036 460.1 97.9 0.1073 0.0049 0.0457 2.3 4.5
8..6 0.178 460.1 97.9 0.1073 0.0242 0.2254 11.1 22.1
7..10 0.026 460.1 97.9 0.1073 0.0036 0.0331 1.6 3.2
10..2 0.005 460.1 97.9 0.1073 0.0007 0.0064 0.3 0.6
10..3 0.019 460.1 97.9 0.1073 0.0025 0.0236 1.2 2.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_4EHP-PC)
Pr(w>1) post mean +- SE for w
104 L 0.575 1.237
111 I 0.955* 2.012
170 E 0.816 1.728
183 D 0.902 1.904
Time used: 0:35
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 72
lnL(ntime: 9 np: 12): -1124.353303 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.053533 0.109140 0.016885 0.055485 0.035221 0.169992 0.024837 0.004765 0.018043 2.761680 0.238630 2.291802
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.48790
(1: 0.053533, ((4: 0.055485, 5: 0.035221): 0.016885, 6: 0.169992): 0.109140, (2: 0.004765, 3: 0.018043): 0.024837);
(D_melanogaster_4EHP-PC: 0.053533, ((D_yakuba_4EHP-PC: 0.055485, D_erecta_4EHP-PC: 0.035221): 0.016885, D_elegans_4EHP-PC: 0.169992): 0.109140, (D_sechellia_4EHP-PC: 0.004765, D_simulans_4EHP-PC: 0.018043): 0.024837);
Detailed output identifying parameters
kappa (ts/tv) = 2.76168
Parameters in M7 (beta):
p = 0.23863 q = 2.29180
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00012 0.00104 0.00428 0.01238 0.02920 0.06079 0.11753 0.22171 0.45159
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.054 460.3 97.7 0.0899 0.0064 0.0716 3.0 7.0
7..8 0.109 460.3 97.7 0.0899 0.0131 0.1459 6.0 14.3
8..9 0.017 460.3 97.7 0.0899 0.0020 0.0226 0.9 2.2
9..4 0.055 460.3 97.7 0.0899 0.0067 0.0742 3.1 7.3
9..5 0.035 460.3 97.7 0.0899 0.0042 0.0471 1.9 4.6
8..6 0.170 460.3 97.7 0.0899 0.0204 0.2273 9.4 22.2
7..10 0.025 460.3 97.7 0.0899 0.0030 0.0332 1.4 3.2
10..2 0.005 460.3 97.7 0.0899 0.0006 0.0064 0.3 0.6
10..3 0.018 460.3 97.7 0.0899 0.0022 0.0241 1.0 2.4
Time used: 0:59
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 72
check convergence..
lnL(ntime: 9 np: 14): -1123.258724 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.056025 0.115404 0.018153 0.057053 0.036183 0.178485 0.026223 0.005086 0.018656 2.791889 0.978493 6.647389 99.000000 2.145763
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51127
(1: 0.056025, ((4: 0.057053, 5: 0.036183): 0.018153, 6: 0.178485): 0.115404, (2: 0.005086, 3: 0.018656): 0.026223);
(D_melanogaster_4EHP-PC: 0.056025, ((D_yakuba_4EHP-PC: 0.057053, D_erecta_4EHP-PC: 0.036183): 0.018153, D_elegans_4EHP-PC: 0.178485): 0.115404, (D_sechellia_4EHP-PC: 0.005086, D_simulans_4EHP-PC: 0.018656): 0.026223);
Detailed output identifying parameters
kappa (ts/tv) = 2.79189
Parameters in M8 (beta&w>1):
p0 = 0.97849 p = 6.64739 q = 99.00000
(p1 = 0.02151) w = 2.14576
dN/dS (w) for site classes (K=11)
p: 0.09785 0.09785 0.09785 0.09785 0.09785 0.09785 0.09785 0.09785 0.09785 0.09785 0.02151
w: 0.02947 0.03917 0.04584 0.05168 0.05731 0.06312 0.06949 0.07703 0.08713 0.10576 2.14576
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.056 460.1 97.9 0.1074 0.0076 0.0708 3.5 6.9
7..8 0.115 460.1 97.9 0.1074 0.0157 0.1457 7.2 14.3
8..9 0.018 460.1 97.9 0.1074 0.0025 0.0229 1.1 2.2
9..4 0.057 460.1 97.9 0.1074 0.0077 0.0721 3.6 7.1
9..5 0.036 460.1 97.9 0.1074 0.0049 0.0457 2.3 4.5
8..6 0.178 460.1 97.9 0.1074 0.0242 0.2254 11.1 22.1
7..10 0.026 460.1 97.9 0.1074 0.0036 0.0331 1.6 3.2
10..2 0.005 460.1 97.9 0.1074 0.0007 0.0064 0.3 0.6
10..3 0.019 460.1 97.9 0.1074 0.0025 0.0236 1.2 2.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_4EHP-PC)
Pr(w>1) post mean +- SE for w
104 L 0.533 1.179
111 I 0.946 2.035
170 E 0.790 1.711
183 D 0.887 1.913
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_4EHP-PC)
Pr(w>1) post mean +- SE for w
111 I 0.833 2.269 +- 1.692
170 E 0.642 1.692 +- 1.400
183 D 0.782 2.165 +- 1.709
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.011 0.042 0.099 0.181 0.279 0.386
ws: 0.534 0.214 0.107 0.059 0.034 0.021 0.013 0.009 0.006 0.004
Time used: 1:59
Model 1: NearlyNeutral -1123.5819 Model 2: PositiveSelection -1123.238077 Model 0: one-ratio -1126.706968 Model 3: discrete -1123.238077 Model 7: beta -1124.353303 Model 8: beta&w>1 -1123.258724 Model 0 vs 1 6.250136000000111 Model 2 vs 1 0.6876459999998588 Model 8 vs 7 2.189158000000134
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
