--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 17:12:36 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/312-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1840.91 -1851.71
2 -1840.85 -1850.27
--------------------------------------
TOTAL -1840.88 -1851.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.604022 0.008092 0.432692 0.775354 0.595804 1087.02 1294.01 1.000
r(A<->C){all} 0.155688 0.001711 0.080626 0.238850 0.152153 839.50 939.82 1.002
r(A<->G){all} 0.233587 0.002300 0.148066 0.329988 0.229467 832.89 844.61 1.000
r(A<->T){all} 0.083681 0.001373 0.012998 0.154825 0.081445 820.23 857.39 1.000
r(C<->G){all} 0.045308 0.000370 0.011687 0.083857 0.043428 884.50 951.23 1.001
r(C<->T){all} 0.410770 0.003442 0.299526 0.524556 0.409477 813.38 842.99 1.001
r(G<->T){all} 0.070966 0.000601 0.026995 0.120696 0.068726 932.29 970.85 1.000
pi(A){all} 0.241139 0.000225 0.210460 0.268392 0.240507 1155.18 1203.80 1.002
pi(C){all} 0.255445 0.000219 0.226752 0.284879 0.255122 1043.90 1254.00 1.000
pi(G){all} 0.293829 0.000254 0.264040 0.326669 0.293878 1291.46 1300.31 1.000
pi(T){all} 0.209588 0.000192 0.181994 0.235297 0.209126 1241.31 1364.99 1.000
alpha{1,2} 0.058014 0.001463 0.000109 0.125964 0.053762 1031.87 1097.91 1.000
alpha{3} 2.216936 0.618578 0.925568 3.758775 2.082527 1465.36 1483.18 1.000
pinvar{all} 0.274660 0.006584 0.122201 0.436488 0.278309 1174.89 1182.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1686.662006
Model 2: PositiveSelection -1686.662006
Model 0: one-ratio -1704.244967
Model 3: discrete -1686.589764
Model 7: beta -1686.925699
Model 8: beta&w>1 -1686.663631
Model 0 vs 1 35.16592200000014
Model 2 vs 1 0.0
Model 8 vs 7 0.5241359999999986
>C1
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPDLELDHYYGLNLKRGVRG
VFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLSTAE
FVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREEYDL
ESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKTooo
>C2
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQELELDHYYGLNLKRGVRG
VFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLSTAE
FVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREEYDL
ESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKTooo
>C3
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQELDHYYGLNLKRGVRGVF
DVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLSTAEFV
RRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREEYDLES
LWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKTooooo
>C4
MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
VQNKYKIFRDEEATEIFDVEEARNLEQELPEQEVEPDQYYGLNLKRGVRG
VFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLTTAE
FVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREEYDL
ESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLKoooo
>C5
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=249
C1 MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
C2 MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
C3 MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
C4 MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
C5 MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
**************************:*****. :.** *..* *.****
C1 VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPD-LELDHYYGLNLKR--G
C2 VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQE-LELDHYYGLNLKR--G
C3 VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQ---ELDHYYGLNLKR--G
C4 VQNKYKIFRDEEATEIFDVEEARNLEQELPEQE-VEPDQYYGLNLKR--G
C5 VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
**:***************:****: **:*** * *:******** *
C1 VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
C2 VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
C3 VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
C4 VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
C5 VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
*************************************************:
C1 TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
C2 TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
C3 TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
C4 TAEFVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
C5 TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
*************.:***********************************
C1 YDLESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKTooo--
C2 YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKTooo--
C3 YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKTooooo
C4 YDLESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLKoooo--
C5 YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET-----
***********::****** ***.******** :. .***:
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 244 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 244 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5274]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5274]--->[5116]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/312-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.282 Mb, Max= 30.559 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPD-LELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKTooo--
>C2
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQE-LELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKTooo--
>C3
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQ---ELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKTooooo
>C4
MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
VQNKYKIFRDEEATEIFDVEEARNLEQELPEQE-VEPDQYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLKoooo--
>C5
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET-----
FORMAT of file /tmp/tmp2811873993553889688aln Not Supported[FATAL:T-COFFEE]
>C1
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPD-LELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKTooo--
>C2
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQE-LELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKTooo--
>C3
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQ---ELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKTooooo
>C4
MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
VQNKYKIFRDEEATEIFDVEEARNLEQELPEQE-VEPDQYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLKoooo--
>C5
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET-----
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:249 S:98 BS:249
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 97.13 C1 C2 97.13
TOP 1 0 97.13 C2 C1 97.13
BOT 0 2 98.35 C1 C3 98.35
TOP 2 0 98.35 C3 C1 98.35
BOT 0 3 89.34 C1 C4 89.34
TOP 3 0 89.34 C4 C1 89.34
BOT 0 4 90.87 C1 C5 90.87
TOP 4 0 90.87 C5 C1 90.87
BOT 1 2 99.17 C2 C3 99.17
TOP 2 1 99.17 C3 C2 99.17
BOT 1 3 89.75 C2 C4 89.75
TOP 3 1 89.75 C4 C2 89.75
BOT 1 4 90.04 C2 C5 90.04
TOP 4 1 90.04 C5 C2 90.04
BOT 2 3 90.50 C3 C4 90.50
TOP 3 2 90.50 C4 C3 90.50
BOT 2 4 91.21 C3 C5 91.21
TOP 4 2 91.21 C5 C3 91.21
BOT 3 4 88.38 C4 C5 88.38
TOP 4 3 88.38 C5 C4 88.38
AVG 0 C1 * 93.92
AVG 1 C2 * 94.03
AVG 2 C3 * 94.81
AVG 3 C4 * 89.49
AVG 4 C5 * 90.13
TOT TOT * 92.48
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGACCCGCGTGTTCCGCCTAGTGCACGACAGGCGCCTGAGTGTGCC
C2 ATGCTGACCCGCGTGTTCCGCCTGGTGCACGACAGGCGCCTGAGTGTGCC
C3 ATGCTGACCCGCGTGTTCCGCCTGGTGCACGACAGGCGCCTGAGTGTGCC
C4 ATGCTGACCCGCGTGTTCCGCCTGGTTCACGACAGACGACTGAGTGTGCC
C5 ATGCTGACCCGCGTATTCCGCCTGGTCCACGACAGGCGCCTGAGTGTGCC
**************.********.** ********.**.***********
C1 TGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
C2 GGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
C3 TGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
C4 TGTCCTGCGTTGCTTCCACCACGAGTTTACAAAGCCGCCACAGCAGCCAG
C5 TGTCCTGCGCTGCTTCCACCACGAGTTCTCAAAACCGCCCCAACAGCCTG
******** ***************** :*.**.*****.**.*** *:*
C1 CGAAGGGCCAGGAAATCGAAGGCAATCCCGAAAAGACTTTGGTTGCCGGC
C2 CGAATGGCCAGGAAATCGAGGGTAATCCCGAAAAGACTTTGGTTGCCGGC
C3 CAAATGGCCAGGAAATCGAAGGTAATCCCGAAAAGACTTTGGTTGCCGGC
C4 TCAAGGGCCAGGAAGTCGAAGGCAATCCCGCAAAGACTTTGGTTGCCGGC
C5 GAAAGAGCCAGGAAACTGAGGATAGTCCCGGCAAGAACTTGGTGGCCGGT
** .********. **.*. *.***** .****. ***** *****
C1 GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAAGCCACGGAGATTTT
C2 GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAGGCCACGGAGATTTT
C3 GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAGGCCACGGAGATTTT
C4 GTGCAGAACAAGTACAAAATATTCCGTGATGAGGAGGCCACGGAGATTTT
C5 GTGCAGGACAAGTACAAAATATTCCGGGATGAGGAGGCCACGGAGATTTT
*****..******************* ********.**************
C1 TGATGTGGAAGAGGCACGCCACCAGGAGCAGCAACTTCCAGAGCCGGAC-
C2 TGATATAGAAGAGGCGCGCCACCAGGAGCAGCAACTTCCAGAGCAGGAA-
C3 TGATGTAGAAGAGGCGCGCCACCAGGAGCAGCAACTTCCAGAGCAG----
C4 TGATGTGGAGGAGGCGCGAAATCTGGAGCAAGAACTTCCAGAGCAGGAA-
C5 CGATGTGGAGGAGGCACGCCACCAGGAGCAGCAGCTTCCCGAGGACTCTG
***.*.**.*****.**..* *:******. *.*****.*** .
C1 --CTGGAGCTGGATCACTATTACGGCCTCAATTTAAAGCGA------GGT
C2 --CTGGAGTTGGATCACTATTACGGACTAAATTTAAAGAGA------GGC
C3 -----GAGTTGGATCACTATTACGGGCTAAATTTAAAGAGA------GGC
C4 --GTGGAGCCGGATCAGTATTACGGCCTAAACTTAAAGCGT------GGA
C5 AACTTGAGCAGGATCACTACTATGGCCTGAATTTAAAGCGTAAGTTAGGT
*** ****** ** ** ** ** ** ******.*: **
C1 GTTCGCGGAGTGTTCGACGTTGAGGACTTGGTGGAGCTGCTCCGCAAGGA
C2 GTTCGCGGAGTGTTTGACGTTGAGGACTTGGTGGAGCTGCTCCGTAAGGA
C3 GTTCGCGGAGTGTTCGACGTTGAGGACTTGGTGGAGCTGCTGCGTAAGGA
C4 GTTCGCGGAGTTTTTGATGTTGAGGACTTGGTTGAGCTGCTCCGAAAGGA
C5 GTTCGTGGCGTTTTCGATGTGGAGGATTTGGTGGAGCTGCTCCGCAAGGA
***** **.** ** ** ** ***** ***** ******** ** *****
C1 GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTACG
C2 GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTATG
C3 GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTATG
C4 GAATGTGGACGATATATTCGTCTGCTACGTGCCGGAAAACCTGAAGTATG
C5 GAATGTGGACGACATATTCGTCTGCTATGTGCCGGAGAACCTGAAATATG
************ ************** ********.********.** *
C1 TTGACCACCTGGTGGTTTGCAGTGGTCGCAGTTACCGACACATGCTGTCC
C2 TTGACCACCTGGTAGTTTGCAGTGGTCGCAGCTACCGGCACATGCTGTCC
C3 TTGACCACCTGGTAGTTTGCAGTGGTCGCAGCTACCGGCACATGCTGTCC
C4 TGGACCACCTGGTGGTCTGCAGTGGACGCAGCTACCGGCACATGCTGACC
C5 TGGACCACCTCGTGGTCTGCAGTGGACGCAGTTATCGGCACATGCTGACC
* ******** **.** ********:***** ** **.*********:**
C1 ACCGCGGAGTTCGTGCGCCGAATGTTCAAGATCAAGCGGGGCAAGGGTGA
C2 ACGGCGGAGTTTGTGCGCCGAATGTTCAAGATTAAGCGCGGCAAGGGTGA
C3 ACGGCGGAGTTCGTGCGCCGAATGTTCAAGATTAAGCGCGGCAAGGGTGA
C4 ACGGCGGAATTCGTGCGCAGAATGTTCAAGATCAAGCGCTCCAAGGGTGA
C5 ACGGCTGAGTTTGTGCGTCGCATGTTCAAGATCAAGCGGAACAGAGGCGA
** ** **.** ***** .*.*********** ***** **..** **
C1 CATATTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
C2 CATTTTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
C3 CATTTTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
C4 CATTCTGCCACGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
C5 CATTCTGCCCCGCATCGAGGGCGACAAGAGTCGGGATTGGATGGCCATGG
***: **** ************** ***** *******************
C1 ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
C2 ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
C3 ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
C4 ACTTGGGCAACATTGCCCTGCACATATTTTCACCCAGTGCTCGCGAGGAA
C5 ATTTAGGCAACATTGCCCTGCATATATTTTCACCGAGCGCTCGCGAGGAA
* **.***************** *********** ** ************
C1 TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAATTCGACCGCGAAAG
C2 TACGATCTGGAGTCGCTGTGGGCCATTGGTTCCGAATTCGACCGCGAAAG
C3 TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAATTCGACCGCGAAAG
C4 TACGATCTGGAGTCGCTGTGGGCCATTGGCTCACAATACGACCGCGAAAG
C5 TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAGTACGATCGCGAGAG
***************************** **. *.*:*** *****.**
C1 CCAAAAACCCACCAATCCCTATGGCGATATTTTCATGGCTCAAACACCCC
C2 CCAAAAGCCTCACAATCCCTATGGCGATATTTTCATGGCCCAAACCCCCC
C3 CCAAAAGCCCCACAATCCCTATGGCGATATTTTCATGGCCCAAACCCCCC
C4 CCAAAAGCTGCACAATCCCTATGACGATATTTTCATGGCCCAAACGCCCA
C5 CCAAAAGCCGCATAATCCCTATGGCGATATATTCATGGCTCAAACTCCTC
******.* .. **********.******:******** ***** ** .
C1 TTTCTTTCGTAGACAAATCGAAACTAAAGACG---------------
C2 GTTCTTTTGTAGACTCGTCAAAACTAAAGACG---------------
C3 TTTCTTTTGTAGACTCGTCGAAACTAAAGACG---------------
C4 TTTCTGTTGTGGAAAATTCGAAACTAAAG------------------
C5 TCACCGTTTCGGGTAATTCGAAACTGGAGACG---------------
:* * .*. :. **.*****..**
>C1
ATGCTGACCCGCGTGTTCCGCCTAGTGCACGACAGGCGCCTGAGTGTGCC
TGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
CGAAGGGCCAGGAAATCGAAGGCAATCCCGAAAAGACTTTGGTTGCCGGC
GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAAGCCACGGAGATTTT
TGATGTGGAAGAGGCACGCCACCAGGAGCAGCAACTTCCAGAGCCGGAC-
--CTGGAGCTGGATCACTATTACGGCCTCAATTTAAAGCGA------GGT
GTTCGCGGAGTGTTCGACGTTGAGGACTTGGTGGAGCTGCTCCGCAAGGA
GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTACG
TTGACCACCTGGTGGTTTGCAGTGGTCGCAGTTACCGACACATGCTGTCC
ACCGCGGAGTTCGTGCGCCGAATGTTCAAGATCAAGCGGGGCAAGGGTGA
CATATTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAATTCGACCGCGAAAG
CCAAAAACCCACCAATCCCTATGGCGATATTTTCATGGCTCAAACACCCC
TTTCTTTCGTAGACAAATCGAAACTAAAGACG---------------
>C2
ATGCTGACCCGCGTGTTCCGCCTGGTGCACGACAGGCGCCTGAGTGTGCC
GGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
CGAATGGCCAGGAAATCGAGGGTAATCCCGAAAAGACTTTGGTTGCCGGC
GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAGGCCACGGAGATTTT
TGATATAGAAGAGGCGCGCCACCAGGAGCAGCAACTTCCAGAGCAGGAA-
--CTGGAGTTGGATCACTATTACGGACTAAATTTAAAGAGA------GGC
GTTCGCGGAGTGTTTGACGTTGAGGACTTGGTGGAGCTGCTCCGTAAGGA
GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTATG
TTGACCACCTGGTAGTTTGCAGTGGTCGCAGCTACCGGCACATGCTGTCC
ACGGCGGAGTTTGTGCGCCGAATGTTCAAGATTAAGCGCGGCAAGGGTGA
CATTTTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGTTCCGAATTCGACCGCGAAAG
CCAAAAGCCTCACAATCCCTATGGCGATATTTTCATGGCCCAAACCCCCC
GTTCTTTTGTAGACTCGTCAAAACTAAAGACG---------------
>C3
ATGCTGACCCGCGTGTTCCGCCTGGTGCACGACAGGCGCCTGAGTGTGCC
TGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
CAAATGGCCAGGAAATCGAAGGTAATCCCGAAAAGACTTTGGTTGCCGGC
GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAGGCCACGGAGATTTT
TGATGTAGAAGAGGCGCGCCACCAGGAGCAGCAACTTCCAGAGCAG----
-----GAGTTGGATCACTATTACGGGCTAAATTTAAAGAGA------GGC
GTTCGCGGAGTGTTCGACGTTGAGGACTTGGTGGAGCTGCTGCGTAAGGA
GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTATG
TTGACCACCTGGTAGTTTGCAGTGGTCGCAGCTACCGGCACATGCTGTCC
ACGGCGGAGTTCGTGCGCCGAATGTTCAAGATTAAGCGCGGCAAGGGTGA
CATTTTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAATTCGACCGCGAAAG
CCAAAAGCCCCACAATCCCTATGGCGATATTTTCATGGCCCAAACCCCCC
TTTCTTTTGTAGACTCGTCGAAACTAAAGACG---------------
>C4
ATGCTGACCCGCGTGTTCCGCCTGGTTCACGACAGACGACTGAGTGTGCC
TGTCCTGCGTTGCTTCCACCACGAGTTTACAAAGCCGCCACAGCAGCCAG
TCAAGGGCCAGGAAGTCGAAGGCAATCCCGCAAAGACTTTGGTTGCCGGC
GTGCAGAACAAGTACAAAATATTCCGTGATGAGGAGGCCACGGAGATTTT
TGATGTGGAGGAGGCGCGAAATCTGGAGCAAGAACTTCCAGAGCAGGAA-
--GTGGAGCCGGATCAGTATTACGGCCTAAACTTAAAGCGT------GGA
GTTCGCGGAGTTTTTGATGTTGAGGACTTGGTTGAGCTGCTCCGAAAGGA
GAATGTGGACGATATATTCGTCTGCTACGTGCCGGAAAACCTGAAGTATG
TGGACCACCTGGTGGTCTGCAGTGGACGCAGCTACCGGCACATGCTGACC
ACGGCGGAATTCGTGCGCAGAATGTTCAAGATCAAGCGCTCCAAGGGTGA
CATTCTGCCACGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCCAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCACAATACGACCGCGAAAG
CCAAAAGCTGCACAATCCCTATGACGATATTTTCATGGCCCAAACGCCCA
TTTCTGTTGTGGAAAATTCGAAACTAAAG------------------
>C5
ATGCTGACCCGCGTATTCCGCCTGGTCCACGACAGGCGCCTGAGTGTGCC
TGTCCTGCGCTGCTTCCACCACGAGTTCTCAAAACCGCCCCAACAGCCTG
GAAAGAGCCAGGAAACTGAGGATAGTCCCGGCAAGAACTTGGTGGCCGGT
GTGCAGGACAAGTACAAAATATTCCGGGATGAGGAGGCCACGGAGATTTT
CGATGTGGAGGAGGCACGCCACCAGGAGCAGCAGCTTCCCGAGGACTCTG
AACTTGAGCAGGATCACTACTATGGCCTGAATTTAAAGCGTAAGTTAGGT
GTTCGTGGCGTTTTCGATGTGGAGGATTTGGTGGAGCTGCTCCGCAAGGA
GAATGTGGACGACATATTCGTCTGCTATGTGCCGGAGAACCTGAAATATG
TGGACCACCTCGTGGTCTGCAGTGGACGCAGTTATCGGCACATGCTGACC
ACGGCTGAGTTTGTGCGTCGCATGTTCAAGATCAAGCGGAACAGAGGCGA
CATTCTGCCCCGCATCGAGGGCGACAAGAGTCGGGATTGGATGGCCATGG
ATTTAGGCAACATTGCCCTGCATATATTTTCACCGAGCGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAGTACGATCGCGAGAG
CCAAAAGCCGCATAATCCCTATGGCGATATATTCATGGCTCAAACTCCTC
TCACCGTTTCGGGTAATTCGAAACTGGAGACG---------------
>C1
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPDoLELDHYYGLNLKRooG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKT
>C2
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQEoLELDHYYGLNLKRooG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKT
>C3
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQoooELDHYYGLNLKRooG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKT
>C4
MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
VQNKYKIFRDEEATEIFDVEEARNLEQELPEQEoVEPDQYYGLNLKRooG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLKo
>C5
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 747 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480093645
Setting output file names to "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1955596252
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7355314233
Seed = 1631521164
Swapseed = 1480093645
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 32 unique site patterns
Division 2 has 25 unique site patterns
Division 3 has 66 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2167.124164 -- -25.624409
Chain 2 -- -2166.697505 -- -25.624409
Chain 3 -- -2171.525298 -- -25.624409
Chain 4 -- -2167.124164 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2167.124164 -- -25.624409
Chain 2 -- -2171.525298 -- -25.624409
Chain 3 -- -2167.797317 -- -25.624409
Chain 4 -- -2155.987523 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2167.124] (-2166.698) (-2171.525) (-2167.124) * [-2167.124] (-2171.525) (-2167.797) (-2155.988)
500 -- [-1890.427] (-1889.330) (-1894.064) (-1899.216) * (-1900.008) (-1900.926) (-1888.788) [-1888.751] -- 0:33:19
1000 -- (-1879.718) (-1879.280) [-1881.181] (-1889.456) * (-1890.005) (-1884.342) (-1880.611) [-1876.522] -- 0:16:39
1500 -- (-1874.459) (-1861.170) [-1864.987] (-1878.287) * (-1880.758) (-1872.973) [-1865.915] (-1870.547) -- 0:11:05
2000 -- (-1880.524) (-1854.194) [-1858.780] (-1878.304) * (-1873.386) [-1857.520] (-1852.086) (-1876.847) -- 0:08:19
2500 -- [-1853.025] (-1846.852) (-1852.908) (-1860.180) * (-1862.229) (-1861.777) [-1848.466] (-1868.816) -- 0:06:39
3000 -- [-1849.899] (-1844.380) (-1852.972) (-1842.661) * (-1848.619) (-1851.803) (-1853.190) [-1846.643] -- 0:05:32
3500 -- (-1850.506) (-1844.839) (-1843.246) [-1844.077] * (-1841.989) (-1859.541) [-1846.477] (-1843.882) -- 0:04:44
4000 -- (-1848.742) (-1852.762) (-1843.798) [-1842.144] * (-1843.113) [-1850.608] (-1849.473) (-1852.475) -- 0:04:09
4500 -- (-1846.598) (-1853.423) [-1840.776] (-1846.589) * [-1841.164] (-1850.296) (-1846.232) (-1844.614) -- 0:07:22
5000 -- (-1847.021) (-1846.284) (-1842.760) [-1842.934] * (-1846.333) (-1859.744) [-1843.423] (-1847.844) -- 0:06:38
Average standard deviation of split frequencies: 0.000000
5500 -- (-1848.440) (-1858.481) (-1847.370) [-1843.501] * (-1843.156) (-1852.924) (-1847.693) [-1846.436] -- 0:06:01
6000 -- (-1847.661) (-1852.877) (-1844.274) [-1844.371] * [-1840.921] (-1850.783) (-1845.841) (-1844.972) -- 0:05:31
6500 -- (-1843.875) (-1862.266) [-1842.340] (-1843.813) * (-1839.832) [-1844.432] (-1842.959) (-1862.816) -- 0:05:05
7000 -- (-1845.727) (-1850.199) (-1846.824) [-1842.817] * [-1842.324] (-1845.849) (-1844.366) (-1847.979) -- 0:04:43
7500 -- (-1845.386) (-1844.946) [-1842.954] (-1842.474) * (-1841.916) [-1842.805] (-1839.921) (-1844.605) -- 0:04:24
8000 -- (-1844.912) [-1847.339] (-1849.824) (-1846.862) * [-1843.190] (-1849.808) (-1839.941) (-1846.930) -- 0:04:08
8500 -- (-1854.090) [-1851.129] (-1841.652) (-1843.236) * [-1846.581] (-1851.737) (-1847.581) (-1845.105) -- 0:03:53
9000 -- (-1852.887) (-1846.438) (-1843.680) [-1847.879] * (-1845.384) (-1841.635) (-1847.301) [-1847.611] -- 0:05:30
9500 -- (-1849.901) [-1847.901] (-1844.335) (-1847.804) * (-1844.641) (-1846.816) [-1841.080] (-1848.563) -- 0:05:12
10000 -- (-1847.596) (-1849.468) (-1844.840) [-1843.381] * (-1849.407) (-1846.698) [-1842.350] (-1844.225) -- 0:04:57
Average standard deviation of split frequencies: 0.000000
10500 -- [-1845.906] (-1848.560) (-1842.433) (-1840.611) * [-1846.134] (-1848.121) (-1842.634) (-1839.336) -- 0:04:42
11000 -- (-1847.481) (-1847.862) (-1841.300) [-1843.246] * (-1847.819) [-1842.652] (-1841.967) (-1842.660) -- 0:04:29
11500 -- [-1843.890] (-1845.742) (-1839.243) (-1841.932) * (-1845.827) (-1847.896) [-1843.439] (-1846.966) -- 0:04:17
12000 -- [-1842.221] (-1841.618) (-1840.207) (-1839.464) * [-1846.113] (-1843.891) (-1845.165) (-1844.563) -- 0:04:07
12500 -- [-1848.425] (-1840.006) (-1841.296) (-1853.764) * (-1851.893) (-1842.410) [-1841.986] (-1849.574) -- 0:03:57
13000 -- (-1853.432) (-1843.404) (-1845.023) [-1844.435] * (-1846.786) [-1847.458] (-1841.872) (-1844.490) -- 0:03:47
13500 -- (-1852.147) (-1845.879) (-1848.053) [-1841.889] * (-1842.515) (-1844.082) [-1841.968] (-1847.055) -- 0:04:52
14000 -- (-1846.769) (-1844.643) (-1841.850) [-1846.168] * (-1845.077) [-1844.862] (-1846.606) (-1854.671) -- 0:04:41
14500 -- (-1843.239) [-1845.729] (-1845.487) (-1849.758) * [-1840.585] (-1847.264) (-1843.249) (-1850.332) -- 0:04:31
15000 -- (-1848.125) (-1846.710) (-1844.922) [-1847.435] * (-1841.835) (-1845.434) [-1839.286] (-1851.937) -- 0:04:22
Average standard deviation of split frequencies: 0.000000
15500 -- (-1846.104) (-1842.564) [-1843.137] (-1850.315) * (-1850.304) [-1846.263] (-1842.147) (-1848.974) -- 0:04:14
16000 -- (-1850.806) (-1842.842) [-1843.774] (-1845.468) * (-1839.805) [-1841.980] (-1839.497) (-1845.392) -- 0:04:06
16500 -- (-1842.833) (-1844.431) (-1840.114) [-1846.299] * (-1842.514) [-1841.273] (-1840.563) (-1841.322) -- 0:03:58
17000 -- [-1843.164] (-1844.964) (-1846.484) (-1844.714) * [-1845.731] (-1840.653) (-1842.082) (-1841.171) -- 0:03:51
17500 -- (-1845.244) [-1843.482] (-1842.695) (-1844.528) * [-1845.906] (-1839.699) (-1842.790) (-1844.524) -- 0:04:40
18000 -- (-1845.636) (-1847.753) [-1842.232] (-1846.784) * [-1843.432] (-1841.731) (-1840.312) (-1842.625) -- 0:04:32
18500 -- [-1845.712] (-1845.224) (-1846.535) (-1848.494) * (-1850.200) (-1848.501) (-1843.466) [-1847.007] -- 0:04:25
19000 -- (-1849.638) (-1845.289) (-1845.872) [-1844.038] * (-1843.496) (-1844.269) (-1843.978) [-1845.814] -- 0:04:18
19500 -- (-1842.998) (-1844.048) [-1846.469] (-1846.536) * (-1843.388) (-1842.753) [-1840.538] (-1849.007) -- 0:04:11
20000 -- (-1844.658) (-1842.577) [-1839.476] (-1840.974) * (-1844.148) [-1845.513] (-1843.728) (-1849.224) -- 0:04:05
Average standard deviation of split frequencies: 0.000000
20500 -- (-1843.596) (-1845.825) (-1845.924) [-1841.053] * [-1840.843] (-1849.086) (-1848.225) (-1840.792) -- 0:03:58
21000 -- (-1846.483) (-1842.730) (-1841.786) [-1844.714] * (-1840.172) (-1844.600) [-1843.424] (-1841.585) -- 0:03:53
21500 -- (-1844.496) (-1843.438) (-1842.505) [-1849.570] * [-1839.156] (-1842.695) (-1845.363) (-1858.909) -- 0:03:47
22000 -- (-1845.073) [-1843.276] (-1844.611) (-1847.668) * (-1843.431) (-1842.275) (-1845.688) [-1847.378] -- 0:04:26
22500 -- [-1842.799] (-1848.644) (-1847.273) (-1848.267) * (-1849.410) (-1842.013) [-1842.063] (-1848.259) -- 0:04:20
23000 -- (-1848.862) (-1844.205) [-1839.845] (-1840.501) * (-1853.371) (-1843.541) [-1846.274] (-1849.218) -- 0:04:14
23500 -- (-1854.836) (-1842.881) (-1845.439) [-1843.010] * [-1845.909] (-1840.993) (-1855.070) (-1853.022) -- 0:04:09
24000 -- [-1846.398] (-1843.797) (-1855.985) (-1849.967) * (-1843.029) (-1846.326) [-1844.367] (-1852.576) -- 0:04:04
24500 -- (-1847.411) (-1845.150) [-1843.925] (-1849.826) * (-1849.163) [-1840.851] (-1841.295) (-1846.439) -- 0:03:58
25000 -- [-1845.576] (-1840.906) (-1842.903) (-1854.600) * (-1848.955) (-1848.177) [-1843.541] (-1851.170) -- 0:03:54
Average standard deviation of split frequencies: 0.000000
25500 -- (-1843.538) (-1848.703) (-1839.354) [-1850.240] * [-1845.852] (-1853.849) (-1848.900) (-1845.075) -- 0:03:49
26000 -- (-1841.580) (-1850.607) [-1840.360] (-1847.346) * (-1855.491) (-1854.535) (-1842.156) [-1840.488] -- 0:03:44
26500 -- (-1845.511) (-1850.894) [-1843.800] (-1850.107) * (-1846.674) (-1853.796) (-1841.965) [-1840.012] -- 0:04:17
27000 -- (-1840.933) [-1843.288] (-1845.881) (-1842.900) * (-1844.471) (-1845.020) (-1845.076) [-1845.759] -- 0:04:12
27500 -- (-1843.798) [-1842.404] (-1845.630) (-1846.594) * (-1847.886) (-1843.830) (-1843.808) [-1841.328] -- 0:04:07
28000 -- [-1842.505] (-1841.924) (-1837.607) (-1841.703) * [-1845.042] (-1845.947) (-1846.917) (-1844.682) -- 0:04:03
28500 -- [-1847.474] (-1843.257) (-1839.214) (-1844.993) * [-1846.606] (-1845.103) (-1843.629) (-1845.506) -- 0:03:58
29000 -- (-1843.007) [-1848.303] (-1841.372) (-1849.348) * (-1851.146) (-1848.109) (-1847.236) [-1844.921] -- 0:03:54
29500 -- (-1841.570) (-1849.617) (-1842.895) [-1847.261] * (-1844.257) [-1848.961] (-1848.323) (-1846.140) -- 0:03:50
30000 -- (-1849.652) [-1847.672] (-1839.484) (-1843.635) * (-1841.737) (-1840.973) (-1849.343) [-1848.483] -- 0:03:46
Average standard deviation of split frequencies: 0.000000
30500 -- (-1848.348) [-1845.475] (-1848.789) (-1847.668) * [-1843.872] (-1842.904) (-1846.813) (-1845.327) -- 0:03:42
31000 -- (-1846.425) (-1847.157) (-1841.230) [-1844.130] * [-1841.076] (-1852.799) (-1849.584) (-1843.646) -- 0:04:10
31500 -- (-1843.056) (-1842.967) [-1845.713] (-1850.377) * [-1845.108] (-1847.191) (-1843.970) (-1844.884) -- 0:04:05
32000 -- (-1841.308) (-1845.445) (-1840.107) [-1845.143] * (-1840.512) [-1846.745] (-1841.701) (-1845.386) -- 0:04:02
32500 -- (-1844.881) (-1847.493) [-1842.620] (-1849.286) * (-1846.863) [-1848.948] (-1842.216) (-1849.260) -- 0:03:58
33000 -- (-1847.011) (-1844.639) (-1842.251) [-1842.337] * (-1847.257) (-1846.811) (-1844.420) [-1844.915] -- 0:03:54
33500 -- (-1844.814) (-1846.500) [-1840.370] (-1850.515) * (-1850.992) [-1845.130] (-1844.399) (-1842.880) -- 0:03:50
34000 -- (-1848.351) [-1841.535] (-1849.149) (-1847.698) * (-1846.093) (-1843.075) (-1844.223) [-1843.847] -- 0:03:47
34500 -- (-1843.580) (-1842.425) [-1843.940] (-1853.564) * (-1848.309) (-1845.057) (-1848.595) [-1843.716] -- 0:03:43
35000 -- (-1844.575) (-1845.119) [-1843.898] (-1848.177) * (-1844.978) [-1844.078] (-1851.722) (-1839.108) -- 0:03:40
Average standard deviation of split frequencies: 0.000000
35500 -- [-1846.149] (-1850.054) (-1844.653) (-1843.600) * (-1849.729) [-1846.686] (-1851.083) (-1845.418) -- 0:04:04
36000 -- (-1849.741) (-1844.749) (-1847.232) [-1842.856] * (-1855.399) (-1840.033) (-1846.520) [-1844.116] -- 0:04:01
36500 -- (-1845.490) (-1850.662) [-1844.583] (-1843.345) * [-1849.290] (-1845.591) (-1851.595) (-1841.892) -- 0:03:57
37000 -- (-1848.258) (-1845.092) [-1843.126] (-1841.686) * [-1847.008] (-1840.707) (-1842.313) (-1846.160) -- 0:03:54
37500 -- (-1842.631) [-1842.055] (-1847.775) (-1845.238) * (-1847.497) (-1841.303) (-1844.894) [-1845.616] -- 0:03:51
38000 -- (-1843.843) (-1843.567) [-1845.859] (-1842.876) * (-1844.580) (-1845.966) (-1844.794) [-1846.887] -- 0:03:47
38500 -- (-1845.597) [-1844.084] (-1846.818) (-1842.514) * (-1839.570) (-1840.683) (-1851.391) [-1847.534] -- 0:03:44
39000 -- (-1848.104) [-1843.780] (-1847.382) (-1840.259) * (-1844.498) (-1843.007) (-1843.735) [-1838.926] -- 0:03:41
39500 -- [-1847.109] (-1844.871) (-1841.390) (-1844.424) * [-1842.652] (-1842.225) (-1844.456) (-1841.751) -- 0:04:03
40000 -- (-1847.336) (-1848.666) [-1840.296] (-1848.514) * (-1836.980) (-1844.030) (-1845.473) [-1845.160] -- 0:04:00
Average standard deviation of split frequencies: 0.000000
40500 -- (-1841.640) (-1842.440) [-1842.015] (-1845.326) * (-1840.279) [-1842.244] (-1846.462) (-1847.692) -- 0:03:56
41000 -- (-1838.893) [-1840.983] (-1840.341) (-1841.765) * (-1847.184) [-1841.206] (-1846.552) (-1848.421) -- 0:03:53
41500 -- (-1842.453) (-1845.243) [-1843.107] (-1848.192) * (-1842.636) (-1840.940) [-1842.659] (-1846.371) -- 0:03:50
42000 -- (-1843.373) (-1848.339) (-1838.362) [-1848.297] * (-1842.879) (-1839.045) [-1846.484] (-1845.969) -- 0:03:48
42500 -- (-1840.768) (-1850.356) [-1847.748] (-1846.784) * (-1840.740) [-1843.475] (-1844.940) (-1848.438) -- 0:03:45
43000 -- [-1846.015] (-1845.675) (-1849.368) (-1850.339) * [-1841.900] (-1842.677) (-1841.925) (-1851.543) -- 0:03:42
43500 -- [-1849.914] (-1843.909) (-1841.697) (-1849.879) * (-1846.483) (-1842.100) [-1845.929] (-1853.865) -- 0:03:39
44000 -- (-1846.147) (-1844.294) [-1840.424] (-1842.845) * (-1840.017) (-1847.288) [-1842.259] (-1852.615) -- 0:03:59
44500 -- (-1850.974) (-1841.635) (-1842.002) [-1842.369] * (-1842.921) (-1839.525) (-1843.962) [-1844.322] -- 0:03:56
45000 -- (-1844.047) [-1838.670] (-1847.806) (-1846.801) * (-1840.546) (-1843.873) (-1846.655) [-1839.045] -- 0:03:53
Average standard deviation of split frequencies: 0.000000
45500 -- (-1844.575) (-1844.073) [-1844.722] (-1842.207) * (-1847.993) (-1848.408) (-1848.360) [-1844.840] -- 0:03:50
46000 -- (-1843.616) (-1844.872) [-1840.885] (-1841.017) * [-1847.952] (-1843.094) (-1845.047) (-1853.374) -- 0:03:48
46500 -- (-1847.080) (-1852.165) [-1842.892] (-1853.085) * [-1839.640] (-1846.271) (-1847.820) (-1846.283) -- 0:03:45
47000 -- (-1844.672) (-1845.452) [-1841.611] (-1848.910) * [-1842.221] (-1843.239) (-1850.716) (-1849.729) -- 0:03:43
47500 -- [-1845.299] (-1844.383) (-1841.541) (-1854.431) * [-1847.321] (-1849.760) (-1842.451) (-1845.978) -- 0:03:40
48000 -- [-1853.714] (-1839.987) (-1846.397) (-1846.285) * (-1854.292) (-1851.569) [-1848.631] (-1844.735) -- 0:03:38
48500 -- (-1842.647) (-1846.992) [-1841.346] (-1846.043) * (-1848.677) (-1842.957) (-1850.744) [-1843.199] -- 0:03:55
49000 -- [-1843.768] (-1839.438) (-1839.911) (-1844.744) * (-1848.932) (-1847.064) [-1843.470] (-1848.804) -- 0:03:52
49500 -- (-1843.643) [-1846.769] (-1841.980) (-1843.944) * (-1845.494) [-1847.025] (-1847.178) (-1851.803) -- 0:03:50
50000 -- (-1849.699) [-1845.736] (-1843.450) (-1842.346) * (-1845.439) (-1846.997) (-1843.540) [-1841.084] -- 0:03:48
Average standard deviation of split frequencies: 0.000000
50500 -- (-1842.661) (-1845.614) (-1847.140) [-1848.030] * (-1842.741) [-1853.458] (-1843.527) (-1841.743) -- 0:03:45
51000 -- (-1842.172) (-1842.370) (-1850.780) [-1842.455] * (-1842.400) [-1843.685] (-1845.096) (-1843.912) -- 0:03:43
51500 -- (-1845.666) (-1844.877) (-1837.122) [-1839.892] * (-1844.873) (-1843.402) [-1839.195] (-1844.103) -- 0:03:41
52000 -- (-1844.601) (-1843.907) [-1841.261] (-1847.145) * (-1853.431) (-1846.690) (-1842.842) [-1847.938] -- 0:03:38
52500 -- [-1844.634] (-1843.625) (-1840.104) (-1842.302) * (-1847.986) (-1857.634) (-1843.776) [-1846.393] -- 0:03:36
53000 -- (-1845.481) (-1838.541) (-1849.863) [-1841.339] * (-1844.474) (-1844.798) (-1848.244) [-1846.794] -- 0:03:52
53500 -- (-1842.802) (-1841.972) (-1850.174) [-1844.435] * (-1846.878) (-1849.516) (-1848.289) [-1844.884] -- 0:03:49
54000 -- [-1846.672] (-1842.530) (-1846.356) (-1852.292) * (-1840.293) (-1839.142) [-1841.073] (-1849.049) -- 0:03:47
54500 -- [-1843.106] (-1840.727) (-1844.670) (-1848.280) * (-1846.896) (-1842.380) (-1840.314) [-1846.481] -- 0:03:45
55000 -- (-1838.442) (-1845.463) (-1843.668) [-1845.877] * (-1844.398) (-1843.853) (-1852.635) [-1843.448] -- 0:03:43
Average standard deviation of split frequencies: 0.004209
55500 -- [-1841.128] (-1840.576) (-1839.795) (-1842.190) * (-1843.455) (-1841.060) (-1844.246) [-1841.960] -- 0:03:41
56000 -- (-1842.510) [-1843.299] (-1842.672) (-1848.637) * [-1842.688] (-1842.958) (-1847.961) (-1842.191) -- 0:03:39
56500 -- (-1842.938) (-1844.876) [-1838.337] (-1848.865) * (-1843.087) [-1842.926] (-1844.425) (-1844.081) -- 0:03:37
57000 -- (-1847.821) (-1844.412) [-1845.813] (-1845.873) * (-1843.960) (-1846.494) (-1854.442) [-1851.606] -- 0:03:51
57500 -- (-1849.103) [-1839.980] (-1853.106) (-1844.286) * [-1844.696] (-1846.315) (-1848.777) (-1853.603) -- 0:03:49
58000 -- (-1852.457) (-1845.661) (-1854.907) [-1844.429] * (-1846.849) [-1846.120] (-1841.499) (-1852.024) -- 0:03:47
58500 -- (-1854.823) [-1843.998] (-1848.813) (-1840.374) * (-1841.785) (-1845.402) [-1841.317] (-1849.718) -- 0:03:45
59000 -- [-1843.484] (-1844.591) (-1844.359) (-1848.242) * [-1847.690] (-1847.803) (-1843.934) (-1845.045) -- 0:03:43
59500 -- (-1849.841) (-1842.883) (-1846.743) [-1839.121] * [-1840.605] (-1852.504) (-1845.195) (-1846.511) -- 0:03:41
60000 -- (-1847.396) (-1840.206) (-1846.131) [-1841.988] * (-1843.190) (-1846.325) [-1843.965] (-1842.963) -- 0:03:39
Average standard deviation of split frequencies: 0.007770
60500 -- [-1844.456] (-1853.986) (-1844.451) (-1841.007) * (-1844.016) [-1846.413] (-1839.341) (-1839.981) -- 0:03:37
61000 -- [-1844.848] (-1845.912) (-1842.504) (-1852.301) * (-1844.283) (-1843.549) (-1843.215) [-1843.765] -- 0:03:35
61500 -- (-1846.386) [-1841.924] (-1846.927) (-1852.760) * (-1842.462) (-1843.809) [-1842.072] (-1843.763) -- 0:03:48
62000 -- (-1844.675) (-1846.564) (-1844.320) [-1846.026] * (-1843.556) (-1846.964) [-1845.921] (-1844.560) -- 0:03:46
62500 -- (-1843.092) [-1849.495] (-1846.265) (-1845.781) * (-1843.507) (-1850.142) [-1840.090] (-1841.958) -- 0:03:45
63000 -- (-1851.365) (-1849.488) (-1847.316) [-1846.365] * [-1845.427] (-1843.113) (-1843.165) (-1843.762) -- 0:03:43
63500 -- (-1846.576) [-1841.416] (-1848.957) (-1842.509) * (-1847.512) (-1844.036) [-1840.495] (-1840.951) -- 0:03:41
64000 -- [-1842.038] (-1846.352) (-1854.280) (-1844.056) * (-1847.745) (-1842.939) [-1843.029] (-1842.389) -- 0:03:39
64500 -- [-1841.183] (-1842.069) (-1846.060) (-1846.106) * (-1849.415) (-1844.124) (-1840.642) [-1839.968] -- 0:03:37
65000 -- (-1843.297) (-1842.419) [-1841.840] (-1848.047) * (-1847.078) (-1849.733) (-1845.407) [-1841.650] -- 0:03:35
Average standard deviation of split frequencies: 0.007142
65500 -- (-1849.480) [-1840.019] (-1838.803) (-1850.267) * (-1853.302) (-1842.253) [-1845.140] (-1842.580) -- 0:03:34
66000 -- [-1845.125] (-1843.250) (-1845.107) (-1848.664) * (-1845.858) (-1845.930) [-1843.888] (-1846.648) -- 0:03:46
66500 -- [-1845.076] (-1853.881) (-1846.331) (-1852.749) * [-1844.674] (-1851.677) (-1850.240) (-1843.383) -- 0:03:44
67000 -- (-1844.216) (-1852.337) [-1846.581] (-1840.876) * (-1843.003) [-1841.746] (-1845.729) (-1845.652) -- 0:03:42
67500 -- (-1844.758) (-1840.291) [-1845.412] (-1844.044) * (-1845.743) (-1842.898) [-1842.182] (-1846.171) -- 0:03:41
68000 -- [-1840.850] (-1844.003) (-1849.535) (-1854.793) * (-1840.788) (-1844.192) [-1846.978] (-1842.436) -- 0:03:39
68500 -- (-1839.387) (-1846.382) (-1846.707) [-1841.902] * (-1846.701) (-1841.365) (-1844.999) [-1842.026] -- 0:03:37
69000 -- (-1848.183) (-1848.627) [-1849.687] (-1846.971) * (-1844.452) (-1843.435) [-1847.189] (-1846.316) -- 0:03:35
69500 -- (-1844.437) (-1846.788) (-1849.029) [-1844.193] * [-1844.257] (-1842.499) (-1843.532) (-1839.798) -- 0:03:34
70000 -- (-1841.031) [-1846.761] (-1852.984) (-1843.353) * (-1841.454) [-1838.864] (-1845.902) (-1841.344) -- 0:03:45
Average standard deviation of split frequencies: 0.006671
70500 -- (-1847.567) (-1844.264) [-1843.412] (-1841.506) * [-1845.517] (-1839.901) (-1846.176) (-1841.516) -- 0:03:44
71000 -- [-1847.767] (-1853.514) (-1846.121) (-1843.130) * (-1845.336) (-1839.997) (-1847.092) [-1847.264] -- 0:03:42
71500 -- (-1847.697) (-1845.866) [-1847.714] (-1839.490) * (-1847.614) (-1844.044) [-1846.148] (-1854.043) -- 0:03:40
72000 -- (-1845.385) [-1848.130] (-1842.046) (-1839.840) * (-1845.387) [-1842.396] (-1849.447) (-1844.523) -- 0:03:39
72500 -- (-1846.813) (-1842.193) (-1848.928) [-1845.207] * (-1850.325) [-1842.200] (-1843.551) (-1848.595) -- 0:03:37
73000 -- [-1841.097] (-1839.443) (-1846.629) (-1843.722) * [-1846.405] (-1845.886) (-1845.816) (-1848.585) -- 0:03:35
73500 -- [-1844.897] (-1845.401) (-1848.834) (-1842.824) * [-1841.421] (-1848.468) (-1839.050) (-1855.612) -- 0:03:34
74000 -- [-1839.795] (-1844.673) (-1845.217) (-1841.017) * [-1842.711] (-1843.410) (-1846.288) (-1850.722) -- 0:03:32
74500 -- (-1849.316) [-1844.590] (-1848.333) (-1844.188) * (-1842.574) (-1842.337) [-1843.964] (-1846.092) -- 0:03:43
75000 -- (-1853.076) [-1847.868] (-1843.938) (-1838.869) * (-1844.445) [-1839.087] (-1841.795) (-1844.089) -- 0:03:42
Average standard deviation of split frequencies: 0.006203
75500 -- [-1847.957] (-1841.901) (-1843.709) (-1841.014) * (-1845.644) [-1838.228] (-1844.147) (-1849.509) -- 0:03:40
76000 -- (-1845.783) (-1843.041) [-1845.621] (-1844.499) * (-1847.206) (-1839.808) (-1847.377) [-1841.481] -- 0:03:38
76500 -- (-1844.245) (-1842.424) [-1841.741] (-1843.052) * [-1846.857] (-1841.662) (-1845.767) (-1847.854) -- 0:03:37
77000 -- [-1844.542] (-1836.944) (-1842.693) (-1847.109) * (-1844.184) (-1844.465) [-1838.938] (-1845.505) -- 0:03:35
77500 -- (-1846.985) (-1842.576) (-1848.824) [-1855.513] * (-1843.969) (-1845.880) [-1842.723] (-1839.755) -- 0:03:34
78000 -- [-1842.849] (-1840.923) (-1840.971) (-1850.906) * [-1841.416] (-1848.959) (-1842.922) (-1846.707) -- 0:03:32
78500 -- (-1845.817) [-1842.972] (-1841.052) (-1846.820) * [-1842.340] (-1845.563) (-1843.970) (-1846.995) -- 0:03:31
79000 -- [-1840.996] (-1846.629) (-1848.946) (-1844.890) * (-1846.825) (-1845.129) [-1840.340] (-1845.634) -- 0:03:41
79500 -- (-1842.176) [-1844.402] (-1845.963) (-1842.508) * [-1838.143] (-1847.469) (-1838.595) (-1840.257) -- 0:03:39
80000 -- [-1845.078] (-1844.463) (-1851.272) (-1844.416) * (-1846.724) [-1841.333] (-1852.701) (-1845.330) -- 0:03:38
Average standard deviation of split frequencies: 0.005844
80500 -- (-1840.007) (-1841.384) [-1851.019] (-1844.607) * (-1846.029) (-1845.997) [-1848.374] (-1845.277) -- 0:03:37
81000 -- (-1848.175) [-1842.601] (-1844.125) (-1841.596) * [-1846.752] (-1846.924) (-1850.479) (-1853.258) -- 0:03:35
81500 -- (-1842.887) (-1849.219) (-1846.394) [-1840.679] * (-1843.439) [-1844.441] (-1848.177) (-1847.425) -- 0:03:34
82000 -- (-1847.570) [-1844.288] (-1845.836) (-1843.320) * (-1845.733) (-1843.457) (-1845.656) [-1843.925] -- 0:03:32
82500 -- (-1846.970) [-1847.534] (-1847.368) (-1841.582) * (-1842.254) [-1842.220] (-1846.888) (-1851.461) -- 0:03:31
83000 -- (-1844.653) [-1843.708] (-1843.254) (-1846.569) * (-1842.406) [-1841.058] (-1840.255) (-1842.755) -- 0:03:29
83500 -- (-1841.731) [-1841.623] (-1841.395) (-1843.696) * (-1850.563) (-1846.942) (-1843.086) [-1839.836] -- 0:03:39
84000 -- (-1839.094) (-1842.813) [-1841.452] (-1845.560) * [-1841.612] (-1844.480) (-1844.089) (-1848.085) -- 0:03:38
84500 -- (-1842.943) (-1849.297) (-1841.101) [-1843.759] * (-1844.018) (-1846.583) (-1848.486) [-1844.065] -- 0:03:36
85000 -- (-1843.368) (-1840.493) (-1845.828) [-1846.540] * [-1840.286] (-1846.555) (-1846.788) (-1841.459) -- 0:03:35
Average standard deviation of split frequencies: 0.005481
85500 -- (-1840.377) (-1839.550) (-1842.684) [-1839.052] * (-1845.275) (-1848.402) [-1844.615] (-1841.944) -- 0:03:33
86000 -- (-1856.158) (-1848.651) (-1840.466) [-1842.849] * [-1849.757] (-1845.167) (-1844.522) (-1841.413) -- 0:03:32
86500 -- (-1846.938) (-1840.551) (-1845.760) [-1841.488] * (-1842.408) [-1840.756] (-1846.418) (-1844.063) -- 0:03:31
87000 -- (-1844.327) (-1849.205) [-1843.767] (-1839.814) * [-1841.969] (-1847.663) (-1847.004) (-1843.467) -- 0:03:29
87500 -- (-1842.926) (-1846.933) [-1844.406] (-1847.071) * (-1845.382) (-1843.015) [-1849.638] (-1845.453) -- 0:03:39
88000 -- (-1846.714) (-1845.307) [-1842.249] (-1843.377) * (-1840.051) (-1840.180) (-1842.529) [-1847.641] -- 0:03:37
88500 -- (-1847.912) [-1843.957] (-1839.865) (-1841.657) * (-1849.285) [-1843.718] (-1853.657) (-1840.837) -- 0:03:36
89000 -- (-1842.753) [-1844.392] (-1840.891) (-1841.491) * (-1841.889) (-1847.683) [-1845.985] (-1846.205) -- 0:03:34
89500 -- (-1843.830) (-1848.726) [-1839.970] (-1847.419) * [-1843.213] (-1847.400) (-1844.793) (-1845.964) -- 0:03:33
90000 -- [-1842.739] (-1839.600) (-1843.354) (-1846.811) * (-1842.047) [-1843.833] (-1846.875) (-1854.646) -- 0:03:32
Average standard deviation of split frequencies: 0.005199
90500 -- [-1840.431] (-1847.684) (-1844.239) (-1841.342) * (-1847.545) (-1845.836) [-1838.033] (-1842.844) -- 0:03:31
91000 -- (-1842.380) [-1844.213] (-1845.173) (-1842.971) * [-1844.878] (-1840.590) (-1844.451) (-1848.438) -- 0:03:29
91500 -- (-1845.880) (-1846.054) (-1847.051) [-1846.245] * [-1840.799] (-1849.008) (-1854.875) (-1843.705) -- 0:03:38
92000 -- (-1847.190) (-1850.545) [-1846.523] (-1848.814) * (-1843.516) (-1850.535) [-1842.790] (-1845.939) -- 0:03:37
92500 -- (-1841.864) (-1845.105) [-1840.972] (-1843.247) * [-1841.021] (-1848.906) (-1842.477) (-1842.141) -- 0:03:35
93000 -- (-1842.778) [-1838.510] (-1841.418) (-1847.337) * (-1840.649) (-1840.519) [-1841.004] (-1844.389) -- 0:03:34
93500 -- (-1844.684) [-1839.422] (-1848.337) (-1842.339) * (-1844.218) (-1846.614) [-1844.103] (-1846.336) -- 0:03:33
94000 -- (-1847.038) [-1840.592] (-1848.249) (-1841.972) * (-1848.318) (-1851.800) (-1839.996) [-1844.231] -- 0:03:32
94500 -- (-1852.023) [-1841.472] (-1846.600) (-1841.037) * (-1852.606) [-1844.867] (-1846.255) (-1840.626) -- 0:03:30
95000 -- (-1848.680) (-1842.350) [-1843.493] (-1840.778) * [-1847.737] (-1844.731) (-1854.116) (-1846.028) -- 0:03:29
Average standard deviation of split frequencies: 0.002455
95500 -- (-1843.447) [-1856.905] (-1840.892) (-1842.480) * (-1845.204) (-1847.011) [-1840.302] (-1837.842) -- 0:03:28
96000 -- (-1840.905) [-1845.388] (-1853.092) (-1843.955) * (-1840.861) [-1844.904] (-1852.135) (-1845.031) -- 0:03:36
96500 -- (-1838.260) (-1845.247) (-1846.439) [-1839.969] * (-1844.291) (-1844.249) (-1843.650) [-1842.848] -- 0:03:35
97000 -- (-1839.585) [-1842.139] (-1850.782) (-1843.626) * [-1842.991] (-1850.426) (-1849.719) (-1842.219) -- 0:03:34
97500 -- (-1840.627) [-1843.218] (-1846.366) (-1844.698) * [-1843.015] (-1847.168) (-1848.342) (-1844.302) -- 0:03:32
98000 -- (-1847.868) (-1841.348) (-1849.512) [-1843.002] * (-1844.286) (-1844.527) [-1840.216] (-1842.568) -- 0:03:31
98500 -- (-1845.894) [-1845.853] (-1843.627) (-1843.906) * [-1840.712] (-1841.740) (-1846.108) (-1840.092) -- 0:03:30
99000 -- [-1847.023] (-1850.953) (-1849.725) (-1841.282) * (-1841.660) [-1843.093] (-1844.234) (-1844.615) -- 0:03:29
99500 -- (-1838.519) (-1841.038) (-1854.607) [-1838.648] * [-1844.485] (-1842.349) (-1841.941) (-1843.004) -- 0:03:28
100000 -- [-1843.791] (-1842.444) (-1848.579) (-1842.755) * [-1844.954] (-1845.578) (-1842.449) (-1841.938) -- 0:03:36
Average standard deviation of split frequencies: 0.002341
100500 -- [-1844.865] (-1841.003) (-1853.989) (-1854.944) * (-1857.510) (-1842.463) (-1843.957) [-1848.835] -- 0:03:34
101000 -- (-1843.383) (-1843.364) (-1842.926) [-1840.947] * [-1843.711] (-1845.200) (-1842.026) (-1844.142) -- 0:03:33
101500 -- (-1843.372) [-1844.952] (-1844.212) (-1842.243) * (-1843.526) (-1844.784) [-1838.431] (-1851.866) -- 0:03:32
102000 -- (-1845.159) [-1842.299] (-1848.361) (-1844.667) * (-1845.384) (-1842.125) (-1848.018) [-1845.514] -- 0:03:31
102500 -- [-1839.350] (-1842.587) (-1846.505) (-1848.163) * [-1845.593] (-1843.380) (-1842.452) (-1842.599) -- 0:03:30
103000 -- (-1842.271) (-1841.503) [-1842.005] (-1841.340) * (-1840.493) (-1844.547) (-1842.462) [-1845.994] -- 0:03:29
103500 -- [-1845.434] (-1841.204) (-1850.344) (-1848.137) * (-1844.729) (-1844.514) (-1845.665) [-1841.545] -- 0:03:27
104000 -- (-1844.794) (-1844.197) [-1843.133] (-1840.143) * (-1840.249) [-1845.352] (-1839.190) (-1843.459) -- 0:03:26
104500 -- (-1839.883) (-1841.442) (-1845.206) [-1844.246] * [-1844.057] (-1848.341) (-1842.604) (-1844.149) -- 0:03:34
105000 -- (-1842.802) [-1848.512] (-1846.356) (-1848.717) * (-1839.877) [-1840.566] (-1843.438) (-1842.371) -- 0:03:33
Average standard deviation of split frequencies: 0.004447
105500 -- (-1840.630) (-1853.760) (-1844.284) [-1843.931] * [-1838.660] (-1847.266) (-1847.960) (-1856.041) -- 0:03:31
106000 -- (-1845.615) (-1845.555) [-1843.589] (-1854.235) * [-1842.224] (-1843.104) (-1842.830) (-1847.938) -- 0:03:30
106500 -- [-1840.245] (-1846.876) (-1844.559) (-1846.268) * [-1842.548] (-1849.061) (-1842.142) (-1853.759) -- 0:03:29
107000 -- (-1839.289) [-1844.362] (-1839.826) (-1847.324) * (-1842.596) [-1840.553] (-1842.961) (-1838.048) -- 0:03:28
107500 -- (-1840.600) [-1842.362] (-1844.848) (-1840.008) * [-1841.749] (-1843.439) (-1841.512) (-1844.546) -- 0:03:27
108000 -- (-1847.084) (-1841.752) (-1845.895) [-1845.178] * (-1849.307) (-1844.732) (-1840.698) [-1844.442] -- 0:03:26
108500 -- (-1847.522) (-1845.608) (-1844.783) [-1845.522] * [-1843.508] (-1842.942) (-1848.740) (-1840.976) -- 0:03:25
109000 -- (-1842.730) (-1848.938) [-1849.277] (-1847.427) * (-1853.113) (-1848.141) [-1845.293] (-1843.468) -- 0:03:32
109500 -- [-1840.672] (-1844.351) (-1843.790) (-1845.647) * [-1845.650] (-1848.433) (-1849.809) (-1842.998) -- 0:03:31
110000 -- [-1841.335] (-1846.936) (-1845.030) (-1844.343) * [-1843.638] (-1852.419) (-1851.140) (-1841.010) -- 0:03:30
Average standard deviation of split frequencies: 0.004260
110500 -- [-1841.327] (-1847.542) (-1848.755) (-1843.503) * (-1844.824) (-1844.349) (-1843.347) [-1842.575] -- 0:03:29
111000 -- (-1841.691) (-1852.313) [-1844.002] (-1842.624) * (-1844.996) [-1844.313] (-1846.955) (-1847.851) -- 0:03:28
111500 -- (-1848.300) [-1841.915] (-1846.488) (-1849.829) * [-1843.607] (-1843.246) (-1850.806) (-1844.825) -- 0:03:27
112000 -- (-1848.697) (-1851.264) [-1840.688] (-1847.914) * (-1846.386) [-1846.030] (-1850.901) (-1848.640) -- 0:03:26
112500 -- [-1848.458] (-1845.976) (-1848.993) (-1844.764) * (-1844.513) (-1843.018) (-1844.648) [-1845.772] -- 0:03:25
113000 -- (-1844.860) (-1847.568) (-1847.077) [-1843.542] * (-1849.921) (-1842.310) (-1847.332) [-1840.762] -- 0:03:31
113500 -- (-1840.550) (-1843.829) (-1857.870) [-1838.763] * (-1853.642) (-1846.105) (-1841.736) [-1846.213] -- 0:03:30
114000 -- (-1842.177) (-1841.114) (-1838.040) [-1844.419] * [-1860.709] (-1844.052) (-1841.658) (-1839.737) -- 0:03:29
114500 -- (-1844.213) (-1845.481) [-1842.033] (-1840.459) * [-1846.409] (-1842.719) (-1841.575) (-1843.383) -- 0:03:28
115000 -- (-1849.959) (-1851.056) (-1843.710) [-1841.411] * (-1846.627) (-1842.932) (-1845.414) [-1840.819] -- 0:03:27
Average standard deviation of split frequencies: 0.004064
115500 -- (-1848.136) (-1844.620) [-1841.733] (-1844.525) * (-1847.089) (-1840.958) [-1847.311] (-1845.269) -- 0:03:26
116000 -- (-1850.754) [-1844.620] (-1845.460) (-1844.213) * (-1842.179) [-1845.638] (-1841.552) (-1841.993) -- 0:03:25
116500 -- (-1839.258) [-1846.292] (-1837.797) (-1843.739) * (-1842.192) (-1850.715) (-1844.039) [-1838.201] -- 0:03:24
117000 -- (-1847.233) (-1845.832) (-1841.530) [-1845.130] * (-1842.298) (-1850.303) (-1843.313) [-1845.329] -- 0:03:23
117500 -- (-1849.882) (-1845.696) [-1838.728] (-1847.073) * (-1847.319) (-1847.725) [-1845.580] (-1844.866) -- 0:03:30
118000 -- (-1847.769) (-1845.336) [-1839.172] (-1843.011) * [-1847.440] (-1848.030) (-1846.731) (-1841.889) -- 0:03:29
118500 -- (-1842.415) (-1845.736) [-1843.182] (-1843.298) * (-1845.744) (-1843.165) (-1848.942) [-1838.993] -- 0:03:28
119000 -- [-1840.227] (-1849.129) (-1843.306) (-1842.584) * (-1844.532) (-1838.702) (-1847.292) [-1838.566] -- 0:03:27
119500 -- (-1840.481) (-1853.957) (-1846.026) [-1847.733] * (-1845.392) (-1844.382) [-1839.288] (-1839.841) -- 0:03:26
120000 -- (-1843.702) [-1843.264] (-1847.255) (-1846.948) * (-1848.469) (-1844.549) [-1842.379] (-1844.223) -- 0:03:25
Average standard deviation of split frequencies: 0.003907
120500 -- [-1844.926] (-1840.744) (-1841.706) (-1845.956) * (-1846.173) (-1845.085) (-1839.453) [-1842.318] -- 0:03:24
121000 -- [-1840.637] (-1839.199) (-1839.444) (-1842.106) * (-1842.752) [-1846.963] (-1843.265) (-1846.019) -- 0:03:23
121500 -- [-1844.225] (-1838.998) (-1845.623) (-1849.106) * [-1844.504] (-1841.186) (-1843.501) (-1844.406) -- 0:03:22
122000 -- (-1846.880) [-1843.145] (-1843.896) (-1843.830) * (-1841.754) [-1842.176] (-1845.518) (-1845.801) -- 0:03:28
122500 -- (-1845.194) (-1842.442) (-1844.062) [-1847.246] * (-1844.429) (-1845.866) (-1853.578) [-1839.771] -- 0:03:27
123000 -- (-1846.227) [-1840.380] (-1846.568) (-1843.071) * (-1843.821) [-1842.002] (-1857.310) (-1843.289) -- 0:03:26
123500 -- (-1847.241) (-1847.041) [-1840.867] (-1844.841) * (-1845.730) (-1842.540) (-1848.947) [-1844.192] -- 0:03:25
124000 -- (-1847.826) (-1847.122) [-1841.078] (-1842.834) * (-1845.699) (-1850.955) (-1851.870) [-1839.990] -- 0:03:24
124500 -- (-1853.450) (-1845.355) [-1839.682] (-1841.303) * (-1845.593) (-1842.665) (-1847.483) [-1840.507] -- 0:03:23
125000 -- (-1844.560) (-1847.614) [-1845.754] (-1849.482) * (-1842.830) (-1846.046) [-1844.661] (-1847.910) -- 0:03:23
Average standard deviation of split frequencies: 0.003741
125500 -- [-1842.394] (-1845.277) (-1848.243) (-1845.557) * [-1846.871] (-1841.017) (-1848.647) (-1849.482) -- 0:03:22
126000 -- (-1842.145) [-1846.993] (-1845.245) (-1842.075) * [-1840.738] (-1843.096) (-1850.078) (-1848.723) -- 0:03:28
126500 -- [-1842.922] (-1847.295) (-1855.613) (-1843.612) * [-1845.060] (-1846.191) (-1850.702) (-1848.395) -- 0:03:27
127000 -- (-1843.598) [-1841.585] (-1846.436) (-1849.893) * (-1844.853) (-1840.866) [-1848.384] (-1845.615) -- 0:03:26
127500 -- [-1842.668] (-1840.980) (-1842.822) (-1851.659) * [-1849.417] (-1843.239) (-1845.420) (-1845.002) -- 0:03:25
128000 -- [-1851.435] (-1840.761) (-1839.870) (-1849.217) * [-1843.322] (-1838.626) (-1846.109) (-1841.077) -- 0:03:24
128500 -- (-1846.991) (-1839.401) [-1843.018] (-1846.507) * (-1850.221) (-1845.729) (-1847.990) [-1840.177] -- 0:03:23
129000 -- (-1845.598) [-1844.663] (-1846.640) (-1851.727) * (-1851.862) (-1842.143) [-1841.733] (-1846.430) -- 0:03:22
129500 -- (-1849.400) (-1847.993) [-1841.699] (-1850.649) * (-1844.836) [-1839.437] (-1842.786) (-1849.563) -- 0:03:21
130000 -- [-1849.805] (-1842.550) (-1842.414) (-1852.230) * [-1841.380] (-1849.725) (-1841.015) (-1846.997) -- 0:03:20
Average standard deviation of split frequencies: 0.003608
130500 -- (-1849.435) (-1839.887) (-1843.013) [-1843.726] * [-1839.276] (-1846.959) (-1842.476) (-1846.259) -- 0:03:26
131000 -- (-1849.018) [-1838.226] (-1842.574) (-1840.085) * [-1846.613] (-1843.648) (-1838.545) (-1851.389) -- 0:03:25
131500 -- (-1842.650) (-1850.494) [-1845.939] (-1845.385) * [-1847.425] (-1846.878) (-1843.481) (-1843.835) -- 0:03:24
132000 -- (-1848.437) (-1844.093) [-1846.349] (-1847.035) * (-1841.952) [-1844.268] (-1843.794) (-1848.112) -- 0:03:23
132500 -- (-1851.991) (-1851.864) [-1847.636] (-1848.318) * (-1842.024) [-1846.541] (-1848.583) (-1844.964) -- 0:03:22
133000 -- (-1847.035) [-1847.714] (-1840.073) (-1850.217) * (-1843.319) (-1842.150) (-1842.644) [-1840.809] -- 0:03:22
133500 -- [-1838.589] (-1847.968) (-1845.000) (-1843.705) * (-1845.553) [-1843.126] (-1845.091) (-1843.665) -- 0:03:21
134000 -- (-1841.947) (-1846.308) (-1849.557) [-1842.685] * (-1845.267) [-1840.270] (-1843.518) (-1840.365) -- 0:03:20
134500 -- (-1846.419) (-1845.191) (-1840.983) [-1840.439] * (-1840.726) [-1840.884] (-1848.350) (-1850.706) -- 0:03:19
135000 -- [-1843.663] (-1847.305) (-1845.737) (-1847.463) * [-1840.641] (-1846.064) (-1841.573) (-1843.823) -- 0:03:25
Average standard deviation of split frequencies: 0.003466
135500 -- (-1840.381) (-1847.662) [-1845.769] (-1844.484) * (-1842.000) (-1843.770) [-1844.910] (-1846.269) -- 0:03:24
136000 -- (-1840.443) (-1849.213) (-1843.049) [-1842.089] * [-1841.770] (-1844.412) (-1846.295) (-1851.385) -- 0:03:23
136500 -- (-1841.567) (-1840.652) (-1840.502) [-1840.124] * (-1841.366) (-1853.087) (-1844.134) [-1846.383] -- 0:03:22
137000 -- (-1842.670) [-1843.374] (-1842.610) (-1840.282) * (-1840.976) (-1849.586) [-1846.402] (-1841.258) -- 0:03:21
137500 -- (-1839.885) (-1844.420) [-1842.344] (-1843.036) * [-1838.902] (-1846.138) (-1851.909) (-1841.309) -- 0:03:20
138000 -- (-1846.841) (-1844.753) [-1846.230] (-1842.839) * (-1841.836) [-1841.109] (-1843.277) (-1843.713) -- 0:03:19
138500 -- (-1844.668) (-1845.016) (-1846.636) [-1847.288] * [-1842.492] (-1847.319) (-1845.001) (-1842.008) -- 0:03:19
139000 -- [-1845.758] (-1843.941) (-1843.858) (-1843.849) * [-1845.928] (-1841.582) (-1852.021) (-1839.909) -- 0:03:18
139500 -- (-1845.011) (-1847.469) [-1843.100] (-1850.239) * (-1846.165) (-1850.555) [-1842.285] (-1842.762) -- 0:03:23
140000 -- (-1844.533) [-1846.822] (-1844.119) (-1840.649) * (-1843.307) (-1857.170) (-1839.855) [-1842.883] -- 0:03:22
Average standard deviation of split frequencies: 0.003351
140500 -- (-1841.535) [-1839.762] (-1846.345) (-1852.969) * (-1841.158) (-1850.066) [-1840.625] (-1842.726) -- 0:03:21
141000 -- (-1850.229) (-1841.150) (-1851.126) [-1849.210] * [-1844.341] (-1844.670) (-1840.354) (-1840.448) -- 0:03:21
141500 -- (-1850.415) [-1845.994] (-1849.734) (-1857.660) * (-1839.381) [-1842.519] (-1841.152) (-1845.522) -- 0:03:20
142000 -- (-1848.497) (-1844.798) (-1845.098) [-1847.936] * (-1841.140) [-1842.555] (-1848.340) (-1842.374) -- 0:03:19
142500 -- (-1843.570) [-1842.108] (-1847.406) (-1846.220) * [-1845.114] (-1842.165) (-1844.739) (-1844.935) -- 0:03:18
143000 -- [-1841.318] (-1851.139) (-1843.715) (-1847.177) * (-1845.431) (-1841.449) (-1844.724) [-1842.488] -- 0:03:17
143500 -- (-1843.725) (-1847.822) [-1839.163] (-1844.162) * (-1843.020) (-1847.354) [-1843.150] (-1849.936) -- 0:03:22
144000 -- (-1841.512) (-1850.249) (-1846.086) [-1846.125] * (-1842.652) (-1847.978) [-1848.666] (-1847.476) -- 0:03:22
144500 -- (-1842.784) (-1845.233) (-1846.314) [-1837.808] * (-1842.794) (-1850.658) [-1839.218] (-1846.034) -- 0:03:21
145000 -- (-1852.503) [-1842.428] (-1845.797) (-1841.672) * [-1850.551] (-1848.691) (-1842.840) (-1851.112) -- 0:03:20
Average standard deviation of split frequencies: 0.003229
145500 -- (-1846.499) (-1846.426) [-1841.708] (-1842.524) * (-1842.347) (-1842.697) (-1841.259) [-1845.996] -- 0:03:19
146000 -- (-1846.869) [-1846.087] (-1841.449) (-1848.075) * [-1840.618] (-1844.579) (-1845.431) (-1849.510) -- 0:03:18
146500 -- (-1839.942) (-1846.604) [-1846.841] (-1844.274) * [-1843.736] (-1851.118) (-1844.799) (-1845.969) -- 0:03:18
147000 -- [-1843.603] (-1844.655) (-1842.509) (-1852.474) * (-1844.255) (-1843.525) (-1846.684) [-1846.557] -- 0:03:17
147500 -- (-1846.134) (-1845.990) [-1839.753] (-1849.257) * [-1843.598] (-1852.226) (-1847.503) (-1843.763) -- 0:03:16
148000 -- (-1846.882) (-1846.252) [-1844.641] (-1842.042) * [-1846.812] (-1852.236) (-1845.316) (-1845.925) -- 0:03:21
148500 -- (-1845.665) (-1844.837) (-1846.582) [-1848.526] * (-1848.190) (-1848.145) [-1842.139] (-1845.483) -- 0:03:20
149000 -- (-1842.943) (-1841.638) (-1848.549) [-1842.657] * (-1843.595) (-1846.452) [-1842.517] (-1845.449) -- 0:03:19
149500 -- (-1843.298) (-1847.741) (-1852.008) [-1842.278] * (-1840.240) (-1841.108) (-1844.835) [-1845.341] -- 0:03:19
150000 -- (-1843.946) (-1843.612) (-1842.729) [-1836.743] * (-1839.114) [-1844.335] (-1849.146) (-1844.538) -- 0:03:18
Average standard deviation of split frequencies: 0.003129
150500 -- (-1854.606) (-1851.789) (-1841.490) [-1846.837] * (-1842.385) [-1842.153] (-1851.139) (-1842.419) -- 0:03:17
151000 -- (-1845.213) (-1850.364) (-1842.710) [-1839.414] * (-1845.444) [-1843.071] (-1854.349) (-1845.763) -- 0:03:16
151500 -- (-1846.271) (-1846.402) [-1843.363] (-1848.086) * (-1842.261) (-1843.182) (-1839.247) [-1841.966] -- 0:03:16
152000 -- [-1838.980] (-1843.680) (-1845.678) (-1842.223) * [-1846.788] (-1843.026) (-1842.977) (-1844.205) -- 0:03:15
152500 -- (-1843.945) (-1848.095) [-1844.241] (-1848.842) * (-1846.494) (-1842.491) [-1842.119] (-1840.423) -- 0:03:20
153000 -- (-1845.215) [-1845.569] (-1840.877) (-1849.485) * [-1843.989] (-1847.428) (-1843.931) (-1842.834) -- 0:03:19
153500 -- [-1843.473] (-1842.439) (-1847.939) (-1846.132) * (-1845.321) [-1845.773] (-1841.785) (-1844.883) -- 0:03:18
154000 -- (-1846.868) (-1844.658) [-1843.072] (-1849.141) * (-1844.038) [-1840.404] (-1846.212) (-1852.335) -- 0:03:17
154500 -- (-1845.120) (-1847.231) (-1841.611) [-1847.021] * [-1839.007] (-1846.131) (-1844.554) (-1855.647) -- 0:03:17
155000 -- (-1842.990) (-1844.427) [-1841.604] (-1846.195) * (-1841.339) (-1841.193) (-1841.050) [-1842.578] -- 0:03:16
Average standard deviation of split frequencies: 0.003022
155500 -- (-1845.032) (-1844.199) [-1842.899] (-1840.685) * (-1841.526) (-1846.059) [-1841.527] (-1842.813) -- 0:03:15
156000 -- (-1841.547) (-1844.962) [-1844.951] (-1841.602) * (-1847.372) [-1851.125] (-1846.701) (-1840.192) -- 0:03:14
156500 -- (-1842.074) (-1843.680) [-1849.511] (-1847.276) * (-1842.688) [-1843.294] (-1847.348) (-1841.744) -- 0:03:19
157000 -- (-1846.220) (-1842.484) [-1841.857] (-1844.782) * (-1848.035) (-1840.480) [-1851.004] (-1846.741) -- 0:03:18
157500 -- [-1842.644] (-1850.674) (-1840.649) (-1842.150) * (-1840.871) (-1841.789) (-1845.825) [-1840.638] -- 0:03:17
158000 -- [-1841.904] (-1841.589) (-1853.296) (-1844.136) * (-1850.801) (-1846.130) [-1843.974] (-1840.956) -- 0:03:17
158500 -- (-1838.835) [-1843.222] (-1846.105) (-1847.233) * (-1849.760) (-1850.216) (-1845.606) [-1840.042] -- 0:03:16
159000 -- [-1838.736] (-1842.806) (-1848.175) (-1845.790) * (-1842.515) [-1841.847] (-1849.729) (-1848.877) -- 0:03:15
159500 -- (-1850.581) (-1842.387) (-1850.381) [-1841.623] * [-1842.137] (-1848.413) (-1845.652) (-1842.656) -- 0:03:14
160000 -- (-1845.088) (-1843.579) (-1842.751) [-1843.854] * (-1847.469) (-1840.524) (-1857.059) [-1844.039] -- 0:03:14
Average standard deviation of split frequencies: 0.002934
160500 -- (-1847.451) (-1846.270) (-1843.562) [-1840.733] * (-1840.821) [-1839.966] (-1842.319) (-1844.900) -- 0:03:13
161000 -- (-1850.487) [-1842.490] (-1847.252) (-1846.486) * (-1843.766) [-1843.869] (-1848.507) (-1840.514) -- 0:03:18
161500 -- (-1844.539) (-1852.488) [-1845.029] (-1843.824) * [-1848.315] (-1845.947) (-1840.107) (-1851.793) -- 0:03:17
162000 -- (-1844.089) (-1843.684) (-1848.819) [-1839.113] * (-1840.793) (-1844.460) [-1845.578] (-1851.528) -- 0:03:16
162500 -- (-1847.186) (-1845.574) [-1838.718] (-1847.705) * (-1843.256) (-1844.668) [-1842.969] (-1848.079) -- 0:03:15
163000 -- (-1845.763) (-1844.449) (-1850.141) [-1846.390] * (-1846.836) (-1844.232) (-1843.480) [-1845.154] -- 0:03:15
163500 -- (-1846.156) [-1838.450] (-1844.564) (-1841.517) * [-1841.573] (-1845.098) (-1846.168) (-1845.455) -- 0:03:14
164000 -- (-1845.854) (-1841.289) (-1844.725) [-1842.102] * (-1842.171) [-1840.880] (-1843.755) (-1844.290) -- 0:03:13
164500 -- (-1843.110) (-1849.637) [-1846.368] (-1842.319) * (-1844.504) (-1844.373) [-1845.264] (-1851.604) -- 0:03:13
165000 -- (-1844.656) [-1850.593] (-1840.418) (-1840.166) * (-1846.013) [-1845.008] (-1846.608) (-1847.265) -- 0:03:12
Average standard deviation of split frequencies: 0.002840
165500 -- (-1848.307) (-1847.567) (-1844.566) [-1842.415] * (-1849.687) [-1847.841] (-1844.582) (-1844.584) -- 0:03:16
166000 -- (-1849.884) (-1853.775) [-1844.908] (-1847.364) * (-1842.003) (-1846.007) (-1849.390) [-1841.558] -- 0:03:15
166500 -- [-1848.859] (-1849.903) (-1847.011) (-1841.673) * (-1840.979) [-1841.059] (-1848.359) (-1843.000) -- 0:03:15
167000 -- (-1842.700) [-1841.861] (-1842.074) (-1844.950) * (-1841.224) (-1844.021) (-1844.420) [-1846.235] -- 0:03:14
167500 -- (-1845.502) (-1845.131) (-1853.424) [-1845.761] * [-1839.440] (-1846.782) (-1848.440) (-1841.438) -- 0:03:13
168000 -- (-1847.730) (-1852.722) [-1847.519] (-1848.253) * [-1840.776] (-1844.334) (-1848.350) (-1841.206) -- 0:03:13
168500 -- [-1843.433] (-1847.444) (-1844.984) (-1852.342) * [-1846.284] (-1840.980) (-1849.899) (-1847.192) -- 0:03:12
169000 -- [-1839.125] (-1850.621) (-1839.716) (-1844.147) * (-1841.410) (-1843.188) [-1848.190] (-1848.665) -- 0:03:11
169500 -- [-1841.820] (-1847.567) (-1841.683) (-1841.186) * (-1849.060) [-1840.397] (-1847.099) (-1842.684) -- 0:03:11
170000 -- (-1842.770) [-1843.693] (-1841.289) (-1846.320) * (-1841.801) (-1845.293) [-1844.129] (-1840.626) -- 0:03:15
Average standard deviation of split frequencies: 0.002762
170500 -- (-1845.974) (-1851.910) (-1841.554) [-1840.715] * [-1843.611] (-1843.566) (-1851.024) (-1849.224) -- 0:03:14
171000 -- [-1845.544] (-1844.654) (-1841.616) (-1846.134) * (-1843.335) (-1843.323) [-1842.798] (-1845.974) -- 0:03:13
171500 -- (-1848.701) (-1844.322) [-1840.524] (-1842.123) * [-1847.590] (-1845.509) (-1840.336) (-1848.033) -- 0:03:13
172000 -- (-1842.404) [-1845.244] (-1840.461) (-1849.411) * (-1853.950) (-1843.845) [-1847.233] (-1855.282) -- 0:03:12
172500 -- (-1841.962) (-1850.400) [-1838.716] (-1843.890) * (-1847.833) (-1847.789) (-1843.683) [-1840.494] -- 0:03:11
173000 -- (-1840.626) [-1848.721] (-1848.031) (-1841.249) * (-1849.682) (-1847.178) [-1842.422] (-1846.762) -- 0:03:11
173500 -- [-1841.080] (-1843.180) (-1854.272) (-1843.201) * (-1843.052) (-1845.502) (-1848.659) [-1843.293] -- 0:03:10
174000 -- (-1848.812) [-1841.222] (-1851.598) (-1840.643) * (-1845.218) [-1844.545] (-1849.110) (-1844.234) -- 0:03:09
174500 -- (-1840.817) (-1840.384) [-1849.658] (-1842.693) * (-1847.840) (-1851.171) (-1844.800) [-1840.089] -- 0:03:13
175000 -- (-1845.290) (-1838.825) (-1844.546) [-1844.170] * (-1846.767) (-1855.985) [-1842.807] (-1847.300) -- 0:03:13
Average standard deviation of split frequencies: 0.002678
175500 -- (-1842.087) (-1840.108) (-1848.066) [-1846.173] * (-1849.182) (-1845.448) [-1840.134] (-1842.016) -- 0:03:12
176000 -- [-1838.721] (-1839.697) (-1853.218) (-1854.285) * (-1849.744) (-1843.572) [-1842.010] (-1842.963) -- 0:03:11
176500 -- (-1845.635) (-1839.622) [-1848.582] (-1841.813) * (-1838.083) (-1845.271) [-1840.384] (-1846.867) -- 0:03:11
177000 -- (-1845.697) [-1846.531] (-1842.726) (-1846.899) * [-1842.711] (-1848.397) (-1845.892) (-1845.940) -- 0:03:10
177500 -- (-1848.311) (-1843.740) (-1843.611) [-1843.665] * (-1849.396) (-1851.228) (-1842.331) [-1843.748] -- 0:03:09
178000 -- (-1844.142) (-1845.213) (-1847.497) [-1841.852] * [-1845.812] (-1847.256) (-1845.616) (-1839.982) -- 0:03:09
178500 -- (-1844.111) (-1843.177) (-1853.047) [-1845.459] * (-1841.212) (-1841.969) (-1851.462) [-1848.143] -- 0:03:13
179000 -- (-1845.249) [-1841.320] (-1841.185) (-1844.791) * (-1838.745) (-1840.309) [-1840.878] (-1841.039) -- 0:03:12
179500 -- (-1849.733) (-1842.822) (-1842.092) [-1842.161] * [-1838.179] (-1845.324) (-1846.482) (-1845.346) -- 0:03:11
180000 -- (-1848.014) [-1841.950] (-1844.341) (-1847.199) * [-1841.375] (-1843.948) (-1842.408) (-1842.627) -- 0:03:11
Average standard deviation of split frequencies: 0.002609
180500 -- (-1848.729) [-1843.454] (-1845.716) (-1844.782) * (-1843.672) (-1839.600) (-1845.830) [-1840.026] -- 0:03:10
181000 -- (-1845.212) (-1851.460) [-1846.623] (-1846.766) * [-1839.383] (-1846.704) (-1844.866) (-1841.458) -- 0:03:10
181500 -- (-1843.424) (-1847.334) [-1844.334] (-1846.178) * (-1849.144) (-1841.642) (-1851.201) [-1849.569] -- 0:03:09
182000 -- (-1842.622) [-1840.060] (-1852.115) (-1847.053) * [-1844.219] (-1839.728) (-1848.614) (-1844.763) -- 0:03:08
182500 -- (-1849.995) (-1841.427) [-1843.916] (-1845.039) * (-1844.893) (-1844.815) [-1841.270] (-1841.106) -- 0:03:12
183000 -- [-1847.045] (-1846.919) (-1850.826) (-1844.180) * (-1846.455) [-1840.040] (-1845.138) (-1846.787) -- 0:03:11
183500 -- (-1843.879) (-1846.932) (-1851.252) [-1841.831] * (-1847.010) (-1847.298) [-1842.999] (-1847.572) -- 0:03:11
184000 -- (-1843.334) (-1845.257) [-1841.576] (-1842.067) * [-1841.764] (-1851.947) (-1843.980) (-1843.311) -- 0:03:10
184500 -- [-1841.330] (-1843.142) (-1847.884) (-1837.552) * (-1846.377) [-1852.587] (-1844.393) (-1848.048) -- 0:03:10
185000 -- (-1842.531) [-1845.322] (-1844.592) (-1840.610) * (-1851.930) (-1848.121) [-1849.622] (-1844.687) -- 0:03:09
Average standard deviation of split frequencies: 0.001267
185500 -- [-1842.655] (-1844.480) (-1844.504) (-1841.806) * [-1848.834] (-1843.292) (-1847.123) (-1843.529) -- 0:03:08
186000 -- [-1849.847] (-1847.390) (-1847.305) (-1845.004) * (-1849.271) (-1847.381) [-1842.690] (-1844.956) -- 0:03:08
186500 -- [-1841.995] (-1849.512) (-1841.993) (-1840.920) * (-1848.595) [-1840.814] (-1846.979) (-1846.671) -- 0:03:07
187000 -- [-1844.572] (-1844.215) (-1839.530) (-1839.279) * (-1844.574) [-1839.030] (-1848.752) (-1848.612) -- 0:03:11
187500 -- (-1848.010) (-1846.104) (-1848.687) [-1841.431] * (-1842.353) (-1843.576) [-1842.862] (-1843.194) -- 0:03:10
188000 -- (-1842.581) (-1849.091) (-1844.762) [-1847.443] * (-1847.591) (-1843.915) [-1842.123] (-1841.207) -- 0:03:10
188500 -- (-1845.872) [-1844.501] (-1845.500) (-1845.069) * (-1841.237) (-1846.848) (-1842.573) [-1844.793] -- 0:03:09
189000 -- (-1851.068) (-1842.940) (-1843.344) [-1843.379] * [-1845.513] (-1841.743) (-1842.035) (-1853.328) -- 0:03:08
189500 -- (-1847.369) [-1845.191] (-1846.439) (-1843.115) * (-1847.812) [-1843.420] (-1841.800) (-1842.911) -- 0:03:08
190000 -- (-1848.155) [-1848.960] (-1845.387) (-1840.521) * (-1840.663) (-1841.707) (-1836.474) [-1842.906] -- 0:03:07
Average standard deviation of split frequencies: 0.001236
190500 -- (-1845.177) [-1850.543] (-1848.413) (-1842.379) * (-1843.860) [-1845.343] (-1839.515) (-1841.067) -- 0:03:06
191000 -- [-1845.753] (-1849.485) (-1847.976) (-1845.905) * (-1838.921) (-1845.623) (-1841.358) [-1841.046] -- 0:03:06
191500 -- [-1844.152] (-1847.303) (-1848.093) (-1842.010) * (-1849.538) [-1842.897] (-1838.997) (-1846.423) -- 0:03:09
192000 -- [-1844.723] (-1841.957) (-1849.534) (-1845.500) * [-1840.279] (-1855.830) (-1841.751) (-1843.126) -- 0:03:09
192500 -- (-1845.648) (-1845.177) (-1842.306) [-1847.684] * (-1849.665) (-1840.946) [-1846.333] (-1844.882) -- 0:03:08
193000 -- (-1846.170) [-1841.108] (-1842.548) (-1845.097) * (-1844.774) (-1841.479) (-1846.326) [-1841.411] -- 0:03:08
193500 -- (-1850.506) [-1842.690] (-1848.167) (-1846.413) * (-1851.917) [-1842.127] (-1844.641) (-1843.120) -- 0:03:07
194000 -- [-1849.653] (-1841.315) (-1845.164) (-1843.686) * (-1841.539) (-1839.763) (-1851.350) [-1848.676] -- 0:03:06
194500 -- (-1847.070) (-1843.157) [-1843.968] (-1847.833) * (-1846.727) (-1838.247) (-1846.207) [-1845.308] -- 0:03:06
195000 -- (-1845.397) (-1844.729) [-1840.443] (-1844.570) * (-1847.005) (-1845.076) [-1842.894] (-1843.933) -- 0:03:05
Average standard deviation of split frequencies: 0.001203
195500 -- (-1847.404) [-1844.959] (-1843.493) (-1839.777) * (-1843.745) (-1843.360) (-1849.366) [-1838.683] -- 0:03:05
196000 -- [-1840.526] (-1840.302) (-1844.055) (-1841.455) * (-1844.172) [-1845.302] (-1843.944) (-1846.592) -- 0:03:08
196500 -- [-1843.209] (-1838.794) (-1840.225) (-1838.976) * (-1853.285) [-1839.046] (-1842.564) (-1847.288) -- 0:03:08
197000 -- (-1841.849) (-1845.293) [-1840.271] (-1846.713) * (-1841.759) (-1844.348) (-1842.632) [-1843.896] -- 0:03:07
197500 -- (-1841.865) (-1842.981) [-1842.856] (-1843.011) * (-1845.637) (-1847.576) [-1841.877] (-1849.459) -- 0:03:06
198000 -- [-1841.774] (-1847.288) (-1842.200) (-1850.854) * (-1847.078) [-1839.897] (-1843.262) (-1844.005) -- 0:03:06
198500 -- [-1841.551] (-1846.348) (-1843.314) (-1841.761) * (-1844.978) [-1842.147] (-1843.208) (-1849.028) -- 0:03:05
199000 -- (-1846.422) (-1839.423) [-1844.405] (-1847.754) * [-1847.119] (-1841.455) (-1845.565) (-1839.707) -- 0:03:05
199500 -- (-1841.546) [-1842.177] (-1846.952) (-1846.536) * (-1844.041) [-1842.871] (-1849.488) (-1839.978) -- 0:03:04
200000 -- (-1841.707) (-1844.858) (-1851.633) [-1854.774] * [-1841.206] (-1845.321) (-1849.653) (-1849.273) -- 0:03:08
Average standard deviation of split frequencies: 0.001175
200500 -- (-1843.911) (-1846.177) (-1848.938) [-1844.672] * (-1841.883) (-1845.696) [-1840.827] (-1841.960) -- 0:03:07
201000 -- (-1845.568) [-1846.047] (-1842.201) (-1846.314) * [-1844.508] (-1843.821) (-1842.345) (-1840.810) -- 0:03:06
201500 -- (-1857.463) [-1848.038] (-1845.912) (-1846.936) * (-1841.159) (-1849.998) [-1842.622] (-1838.972) -- 0:03:06
202000 -- (-1848.988) [-1840.556] (-1844.975) (-1845.653) * (-1843.746) [-1844.146] (-1843.328) (-1839.829) -- 0:03:05
202500 -- [-1844.966] (-1841.555) (-1844.033) (-1844.458) * (-1839.396) (-1843.487) [-1840.017] (-1846.710) -- 0:03:05
203000 -- (-1844.312) (-1842.330) (-1852.601) [-1839.722] * (-1845.158) (-1847.995) [-1840.728] (-1842.975) -- 0:03:04
203500 -- (-1849.676) (-1845.474) (-1845.925) [-1842.417] * [-1844.361] (-1840.351) (-1846.711) (-1841.650) -- 0:03:03
204000 -- (-1845.561) (-1848.801) (-1845.578) [-1844.900] * (-1841.287) (-1841.623) (-1849.341) [-1844.433] -- 0:03:03
204500 -- (-1844.458) (-1846.773) [-1838.076] (-1840.364) * [-1844.301] (-1847.227) (-1843.420) (-1842.930) -- 0:03:06
205000 -- (-1841.129) (-1850.272) (-1842.607) [-1841.963] * (-1842.600) (-1840.848) (-1851.026) [-1844.722] -- 0:03:06
Average standard deviation of split frequencies: 0.001144
205500 -- (-1847.418) (-1850.509) (-1844.313) [-1839.933] * (-1850.106) [-1842.770] (-1849.011) (-1842.532) -- 0:03:05
206000 -- [-1843.891] (-1852.359) (-1842.550) (-1843.514) * (-1841.936) [-1837.760] (-1846.336) (-1840.704) -- 0:03:05
206500 -- (-1840.554) (-1850.101) [-1846.757] (-1843.804) * [-1849.031] (-1843.458) (-1848.526) (-1850.045) -- 0:03:04
207000 -- (-1838.656) (-1842.866) (-1843.951) [-1844.561] * [-1842.270] (-1850.895) (-1848.710) (-1842.915) -- 0:03:03
207500 -- (-1842.388) (-1846.536) (-1844.504) [-1846.516] * (-1844.525) (-1844.816) (-1854.727) [-1844.175] -- 0:03:03
208000 -- (-1841.045) (-1846.374) [-1839.137] (-1848.397) * (-1844.262) [-1842.416] (-1849.911) (-1841.936) -- 0:03:02
208500 -- (-1846.214) (-1843.159) (-1839.240) [-1844.466] * (-1845.759) (-1843.741) [-1842.189] (-1839.104) -- 0:03:02
209000 -- [-1844.368] (-1857.581) (-1839.145) (-1844.188) * (-1850.478) (-1845.061) (-1846.431) [-1841.025] -- 0:03:05
209500 -- [-1847.993] (-1846.454) (-1843.006) (-1846.086) * (-1845.460) (-1846.460) [-1848.785] (-1844.489) -- 0:03:04
210000 -- (-1845.707) (-1842.971) (-1842.855) [-1853.279] * (-1841.175) (-1841.511) [-1844.765] (-1840.608) -- 0:03:04
Average standard deviation of split frequencies: 0.001119
210500 -- (-1850.957) (-1842.990) (-1842.136) [-1845.960] * (-1840.538) (-1844.022) (-1853.020) [-1845.748] -- 0:03:03
211000 -- (-1846.236) (-1840.063) [-1845.068] (-1842.936) * (-1847.436) (-1852.413) [-1848.178] (-1842.058) -- 0:03:03
211500 -- (-1849.456) [-1849.241] (-1842.326) (-1845.158) * (-1841.633) (-1849.169) (-1846.970) [-1842.182] -- 0:03:02
212000 -- (-1851.524) (-1846.701) [-1840.187] (-1846.468) * (-1843.558) [-1844.234] (-1851.248) (-1853.968) -- 0:03:02
212500 -- (-1846.702) (-1845.885) [-1842.359] (-1844.098) * (-1841.976) (-1849.123) (-1847.564) [-1848.455] -- 0:03:01
213000 -- (-1842.260) (-1851.544) [-1841.428] (-1849.652) * (-1843.654) [-1843.172] (-1849.971) (-1849.542) -- 0:03:01
213500 -- (-1841.232) [-1850.037] (-1841.722) (-1848.591) * (-1838.640) (-1845.402) (-1843.717) [-1840.748] -- 0:03:04
214000 -- (-1842.817) (-1847.608) [-1841.609] (-1847.697) * (-1845.142) (-1845.845) (-1843.661) [-1840.130] -- 0:03:03
214500 -- (-1841.589) (-1843.361) (-1844.368) [-1849.500] * (-1852.519) [-1843.911] (-1839.949) (-1843.005) -- 0:03:03
215000 -- (-1845.783) (-1855.090) (-1842.227) [-1852.308] * [-1843.348] (-1843.954) (-1853.465) (-1844.657) -- 0:03:02
Average standard deviation of split frequencies: 0.001091
215500 -- [-1841.553] (-1843.915) (-1843.074) (-1844.488) * (-1843.286) (-1845.665) [-1840.313] (-1842.592) -- 0:03:02
216000 -- (-1844.274) (-1841.729) [-1839.085] (-1847.671) * (-1848.375) [-1843.208] (-1842.595) (-1856.293) -- 0:03:01
216500 -- [-1846.264] (-1842.215) (-1842.496) (-1847.620) * [-1844.272] (-1848.314) (-1851.781) (-1842.067) -- 0:03:00
217000 -- (-1843.554) (-1846.526) (-1842.221) [-1846.504] * (-1847.408) (-1850.004) (-1848.469) [-1841.232] -- 0:03:00
217500 -- [-1843.748] (-1852.343) (-1841.861) (-1844.730) * (-1852.827) (-1843.280) (-1852.765) [-1842.463] -- 0:02:59
218000 -- (-1845.813) (-1844.257) [-1842.761] (-1850.150) * (-1849.594) (-1842.982) (-1841.701) [-1842.493] -- 0:03:02
218500 -- (-1849.856) (-1850.062) [-1848.345] (-1846.799) * (-1843.525) (-1843.109) (-1844.235) [-1841.425] -- 0:03:02
219000 -- (-1842.971) (-1845.500) [-1842.823] (-1847.909) * (-1851.590) [-1840.093] (-1839.208) (-1841.519) -- 0:03:01
219500 -- (-1844.389) (-1839.810) (-1841.303) [-1850.025] * [-1852.160] (-1840.879) (-1843.197) (-1845.124) -- 0:03:01
220000 -- (-1859.068) (-1848.897) [-1842.693] (-1849.878) * (-1841.833) (-1850.275) (-1846.780) [-1846.810] -- 0:03:00
Average standard deviation of split frequencies: 0.000000
220500 -- (-1858.072) (-1844.224) [-1845.212] (-1843.519) * (-1845.479) (-1843.580) (-1849.916) [-1847.187] -- 0:03:00
221000 -- (-1855.097) [-1841.100] (-1843.804) (-1846.676) * (-1842.348) (-1843.630) (-1839.244) [-1844.688] -- 0:02:59
221500 -- (-1843.351) [-1843.682] (-1842.270) (-1848.358) * (-1839.564) (-1844.222) (-1841.321) [-1844.594] -- 0:02:59
222000 -- [-1853.272] (-1841.493) (-1842.314) (-1840.714) * (-1846.596) [-1847.399] (-1845.065) (-1849.965) -- 0:03:02
222500 -- (-1844.402) (-1845.509) (-1842.673) [-1839.683] * (-1846.306) (-1851.997) (-1842.827) [-1849.305] -- 0:03:01
223000 -- (-1842.118) (-1846.229) (-1847.382) [-1842.356] * [-1841.366] (-1843.579) (-1842.559) (-1844.770) -- 0:03:01
223500 -- (-1847.343) (-1845.041) (-1841.277) [-1841.855] * (-1844.903) (-1851.212) (-1844.277) [-1840.706] -- 0:03:00
224000 -- [-1842.028] (-1842.235) (-1841.971) (-1846.211) * [-1843.042] (-1848.682) (-1845.116) (-1848.008) -- 0:03:00
224500 -- (-1843.729) (-1846.185) [-1839.682] (-1843.273) * (-1846.663) (-1843.525) (-1851.696) [-1843.740] -- 0:02:59
225000 -- (-1848.379) [-1842.879] (-1843.551) (-1843.373) * (-1848.555) (-1851.518) (-1841.239) [-1842.725] -- 0:02:59
Average standard deviation of split frequencies: 0.000000
225500 -- (-1841.842) (-1850.164) [-1843.903] (-1849.290) * [-1853.305] (-1849.784) (-1852.419) (-1845.932) -- 0:02:58
226000 -- (-1844.793) [-1843.416] (-1845.352) (-1845.824) * (-1845.145) (-1844.649) [-1841.737] (-1845.090) -- 0:03:01
226500 -- (-1848.414) (-1847.487) [-1845.580] (-1847.383) * (-1844.152) (-1842.491) (-1842.856) [-1842.760] -- 0:03:00
227000 -- (-1846.359) [-1843.228] (-1844.290) (-1847.504) * (-1841.542) [-1838.313] (-1843.720) (-1842.962) -- 0:03:00
227500 -- (-1845.408) (-1844.278) (-1846.755) [-1843.792] * (-1841.944) (-1841.549) (-1843.296) [-1846.838] -- 0:02:59
228000 -- [-1849.910] (-1844.773) (-1847.820) (-1847.695) * (-1847.722) (-1850.583) [-1845.464] (-1839.262) -- 0:02:59
228500 -- (-1842.244) (-1842.980) [-1844.186] (-1849.316) * (-1845.202) (-1845.209) [-1845.227] (-1842.077) -- 0:02:58
229000 -- (-1842.501) (-1848.231) [-1843.279] (-1847.420) * (-1847.888) (-1843.585) [-1848.071] (-1848.077) -- 0:02:58
229500 -- [-1839.377] (-1846.654) (-1847.981) (-1844.553) * (-1844.559) (-1843.112) (-1844.166) [-1845.926] -- 0:02:57
230000 -- [-1842.708] (-1846.283) (-1847.764) (-1840.985) * (-1845.860) (-1847.132) (-1845.762) [-1845.960] -- 0:03:00
Average standard deviation of split frequencies: 0.001022
230500 -- (-1842.275) (-1842.867) [-1843.707] (-1840.375) * (-1842.697) (-1843.471) (-1849.620) [-1843.424] -- 0:03:00
231000 -- [-1843.049] (-1841.980) (-1841.574) (-1842.000) * (-1841.798) [-1848.990] (-1849.548) (-1839.514) -- 0:02:59
231500 -- (-1844.675) (-1845.532) (-1847.661) [-1840.365] * (-1850.078) [-1850.115] (-1845.458) (-1841.482) -- 0:02:59
232000 -- (-1848.215) (-1842.880) (-1852.636) [-1843.404] * [-1838.504] (-1844.037) (-1848.309) (-1844.181) -- 0:02:58
232500 -- (-1845.721) (-1847.998) (-1841.337) [-1842.318] * (-1840.108) [-1843.218] (-1851.569) (-1842.533) -- 0:02:58
233000 -- [-1844.458] (-1844.026) (-1841.800) (-1842.695) * (-1841.544) (-1847.732) [-1852.064] (-1846.906) -- 0:02:57
233500 -- (-1849.318) (-1843.647) [-1852.120] (-1848.058) * [-1840.072] (-1846.985) (-1848.130) (-1841.895) -- 0:02:57
234000 -- (-1847.444) [-1845.504] (-1846.610) (-1846.777) * (-1845.402) (-1842.404) (-1841.231) [-1847.736] -- 0:02:56
234500 -- (-1856.315) (-1843.827) (-1847.007) [-1847.035] * (-1843.167) (-1843.648) [-1847.827] (-1852.882) -- 0:02:59
235000 -- (-1845.339) [-1843.974] (-1846.644) (-1844.199) * (-1851.885) (-1848.677) [-1843.279] (-1847.552) -- 0:02:59
Average standard deviation of split frequencies: 0.001997
235500 -- (-1857.283) (-1849.101) (-1842.353) [-1843.035] * [-1844.326] (-1844.397) (-1849.833) (-1841.960) -- 0:02:58
236000 -- (-1850.922) [-1844.697] (-1844.637) (-1844.626) * (-1844.968) (-1841.211) (-1850.752) [-1843.193] -- 0:02:58
236500 -- [-1844.646] (-1845.060) (-1850.839) (-1847.136) * (-1843.458) [-1848.077] (-1856.680) (-1852.257) -- 0:02:57
237000 -- (-1840.124) (-1843.545) [-1844.628] (-1847.523) * (-1840.165) (-1842.751) (-1844.717) [-1838.131] -- 0:02:57
237500 -- [-1843.974] (-1847.608) (-1848.980) (-1840.380) * (-1848.286) [-1838.454] (-1851.281) (-1841.220) -- 0:02:56
238000 -- (-1840.900) (-1852.162) (-1844.419) [-1848.548] * (-1847.283) (-1850.721) [-1846.545] (-1843.617) -- 0:02:56
238500 -- (-1845.252) (-1855.241) [-1845.784] (-1848.192) * (-1839.436) (-1841.976) [-1846.007] (-1845.565) -- 0:02:55
239000 -- (-1840.907) [-1851.597] (-1845.002) (-1844.947) * (-1849.506) [-1846.364] (-1845.830) (-1848.796) -- 0:02:58
239500 -- (-1843.707) [-1843.830] (-1842.918) (-1857.802) * [-1839.718] (-1848.321) (-1848.718) (-1842.608) -- 0:02:57
240000 -- [-1846.543] (-1841.811) (-1847.808) (-1842.377) * [-1842.895] (-1839.937) (-1846.325) (-1848.088) -- 0:02:57
Average standard deviation of split frequencies: 0.001959
240500 -- (-1845.568) (-1841.342) (-1846.214) [-1849.836] * (-1840.979) (-1839.929) (-1847.823) [-1845.483] -- 0:02:56
241000 -- [-1842.394] (-1846.821) (-1845.382) (-1848.894) * (-1859.255) (-1843.638) (-1842.973) [-1840.301] -- 0:02:56
241500 -- (-1838.948) (-1845.651) (-1847.448) [-1844.771] * (-1858.483) (-1840.573) [-1844.731] (-1845.319) -- 0:02:55
242000 -- (-1844.446) [-1845.535] (-1846.422) (-1844.915) * (-1848.456) (-1842.549) (-1840.450) [-1842.326] -- 0:02:55
242500 -- (-1841.616) (-1846.837) [-1839.984] (-1846.043) * (-1846.327) (-1844.039) (-1843.039) [-1842.577] -- 0:02:54
243000 -- (-1843.353) [-1850.619] (-1846.831) (-1848.366) * (-1846.196) (-1848.783) (-1842.063) [-1844.159] -- 0:02:54
243500 -- [-1841.665] (-1849.353) (-1848.612) (-1843.264) * (-1852.145) (-1849.359) [-1841.694] (-1849.107) -- 0:02:57
244000 -- (-1840.909) (-1848.937) [-1843.896] (-1841.640) * (-1847.991) (-1855.998) [-1844.258] (-1840.720) -- 0:02:56
244500 -- (-1838.462) (-1842.805) [-1847.940] (-1849.314) * (-1848.292) (-1849.724) [-1844.220] (-1843.004) -- 0:02:56
245000 -- [-1843.717] (-1847.266) (-1846.110) (-1846.452) * (-1842.995) (-1856.294) (-1847.992) [-1838.003] -- 0:02:55
Average standard deviation of split frequencies: 0.001916
245500 -- (-1843.829) (-1845.432) (-1847.236) [-1843.400] * (-1845.222) (-1843.999) [-1845.277] (-1845.461) -- 0:02:55
246000 -- (-1843.262) (-1848.585) [-1841.065] (-1847.533) * [-1843.893] (-1848.174) (-1843.859) (-1847.330) -- 0:02:54
246500 -- (-1842.746) (-1846.498) [-1841.803] (-1840.329) * (-1847.637) (-1843.815) [-1841.564] (-1841.232) -- 0:02:54
247000 -- (-1850.398) [-1844.061] (-1838.811) (-1841.646) * (-1847.134) (-1847.229) [-1843.249] (-1846.963) -- 0:02:53
247500 -- (-1851.249) (-1842.932) (-1840.117) [-1841.093] * (-1845.147) [-1842.145] (-1843.935) (-1849.283) -- 0:02:56
248000 -- (-1845.087) (-1851.949) (-1839.178) [-1838.191] * [-1842.573] (-1842.151) (-1845.326) (-1850.482) -- 0:02:55
248500 -- (-1842.719) [-1845.643] (-1845.917) (-1844.732) * (-1845.587) (-1843.067) (-1841.309) [-1844.427] -- 0:02:55
249000 -- (-1838.111) [-1843.774] (-1850.762) (-1850.647) * [-1844.104] (-1848.774) (-1852.019) (-1841.516) -- 0:02:54
249500 -- (-1842.279) (-1842.539) [-1844.551] (-1847.098) * [-1846.002] (-1842.454) (-1848.333) (-1845.513) -- 0:02:54
250000 -- (-1839.514) [-1844.780] (-1844.192) (-1844.112) * [-1841.323] (-1843.547) (-1852.047) (-1840.548) -- 0:02:54
Average standard deviation of split frequencies: 0.001881
250500 -- (-1842.687) (-1842.830) (-1847.345) [-1843.250] * (-1842.086) (-1841.309) [-1851.950] (-1844.850) -- 0:02:53
251000 -- [-1842.378] (-1848.543) (-1850.699) (-1847.501) * (-1849.639) [-1840.997] (-1853.451) (-1845.123) -- 0:02:53
251500 -- [-1845.149] (-1845.124) (-1841.173) (-1841.357) * [-1844.456] (-1846.410) (-1848.067) (-1843.551) -- 0:02:52
252000 -- [-1840.793] (-1843.004) (-1850.222) (-1839.289) * (-1845.786) [-1846.243] (-1854.583) (-1844.216) -- 0:02:55
252500 -- (-1842.220) [-1840.176] (-1846.711) (-1846.365) * [-1845.058] (-1841.541) (-1844.799) (-1844.495) -- 0:02:54
253000 -- (-1854.584) (-1849.218) [-1848.837] (-1841.505) * (-1844.274) (-1847.366) [-1845.015] (-1838.638) -- 0:02:54
253500 -- (-1856.072) (-1842.727) (-1849.741) [-1842.817] * (-1848.804) [-1847.629] (-1842.146) (-1844.484) -- 0:02:53
254000 -- [-1843.010] (-1842.083) (-1841.991) (-1843.330) * (-1845.413) [-1844.074] (-1845.291) (-1841.939) -- 0:02:53
254500 -- [-1849.641] (-1843.601) (-1846.939) (-1844.354) * (-1844.107) [-1847.805] (-1846.696) (-1842.453) -- 0:02:52
255000 -- (-1844.735) (-1849.093) (-1843.343) [-1844.633] * (-1844.695) (-1845.237) (-1846.634) [-1845.413] -- 0:02:52
Average standard deviation of split frequencies: 0.001841
255500 -- (-1853.727) (-1845.690) (-1846.775) [-1845.925] * (-1843.056) (-1854.153) (-1848.191) [-1841.510] -- 0:02:51
256000 -- (-1851.818) [-1843.418] (-1842.948) (-1842.957) * (-1848.719) (-1847.867) (-1845.371) [-1840.740] -- 0:02:51
256500 -- (-1844.489) [-1851.953] (-1845.592) (-1841.936) * (-1841.144) (-1850.007) [-1840.988] (-1846.749) -- 0:02:53
257000 -- (-1839.086) (-1840.779) (-1840.936) [-1846.391] * (-1847.940) [-1845.423] (-1845.417) (-1850.210) -- 0:02:53
257500 -- (-1843.312) [-1841.713] (-1839.659) (-1850.501) * (-1845.640) (-1847.544) (-1840.324) [-1846.172] -- 0:02:53
258000 -- (-1852.708) (-1854.231) (-1844.417) [-1841.514] * (-1850.095) [-1841.745] (-1841.275) (-1839.595) -- 0:02:52
258500 -- (-1850.175) (-1851.355) [-1844.040] (-1860.143) * (-1838.333) [-1842.607] (-1842.807) (-1841.881) -- 0:02:52
259000 -- (-1846.560) (-1846.312) [-1843.405] (-1847.044) * (-1840.718) [-1839.910] (-1838.751) (-1841.010) -- 0:02:51
259500 -- (-1851.038) [-1838.410] (-1844.058) (-1849.462) * (-1840.470) (-1844.998) [-1839.125] (-1840.455) -- 0:02:51
260000 -- [-1848.439] (-1844.386) (-1842.489) (-1848.568) * [-1845.129] (-1839.865) (-1853.810) (-1845.268) -- 0:02:50
Average standard deviation of split frequencies: 0.001808
260500 -- [-1844.178] (-1846.422) (-1852.931) (-1844.205) * (-1848.469) (-1841.233) [-1848.690] (-1842.223) -- 0:02:50
261000 -- (-1846.176) (-1840.857) [-1841.736] (-1840.875) * (-1843.332) [-1843.168] (-1846.309) (-1844.378) -- 0:02:52
261500 -- (-1847.601) [-1845.943] (-1844.977) (-1846.420) * (-1845.586) (-1840.431) [-1840.597] (-1847.375) -- 0:02:52
262000 -- [-1847.968] (-1850.304) (-1847.808) (-1842.587) * (-1843.972) (-1846.933) [-1850.148] (-1845.327) -- 0:02:51
262500 -- (-1848.002) (-1847.291) (-1842.253) [-1839.704] * (-1848.959) [-1839.818] (-1843.704) (-1841.476) -- 0:02:51
263000 -- (-1847.167) (-1843.491) [-1841.333] (-1842.135) * (-1842.948) [-1842.778] (-1844.128) (-1842.707) -- 0:02:50
263500 -- (-1839.964) [-1838.758] (-1839.192) (-1844.382) * (-1841.365) (-1848.868) [-1844.621] (-1844.058) -- 0:02:50
264000 -- (-1844.596) (-1841.966) [-1838.920] (-1844.726) * [-1839.898] (-1843.338) (-1847.117) (-1843.715) -- 0:02:50
264500 -- [-1841.549] (-1847.147) (-1846.371) (-1849.548) * (-1839.571) (-1844.823) [-1844.892] (-1838.481) -- 0:02:49
265000 -- [-1841.464] (-1846.612) (-1847.828) (-1850.682) * (-1843.806) (-1840.690) [-1844.887] (-1843.077) -- 0:02:51
Average standard deviation of split frequencies: 0.001772
265500 -- (-1839.976) (-1843.404) (-1844.308) [-1844.927] * [-1840.485] (-1846.030) (-1845.753) (-1843.856) -- 0:02:51
266000 -- (-1844.846) (-1851.947) (-1840.005) [-1840.654] * (-1843.479) (-1843.848) [-1847.385] (-1842.977) -- 0:02:51
266500 -- (-1845.257) (-1840.275) [-1840.087] (-1838.801) * (-1843.501) (-1845.179) (-1846.893) [-1841.340] -- 0:02:50
267000 -- [-1841.547] (-1840.209) (-1839.586) (-1841.455) * (-1842.370) [-1840.043] (-1841.739) (-1851.560) -- 0:02:50
267500 -- (-1842.693) (-1844.748) (-1853.686) [-1845.756] * (-1841.656) (-1845.720) [-1842.280] (-1842.055) -- 0:02:49
268000 -- (-1849.831) (-1844.126) (-1848.330) [-1847.823] * [-1838.285] (-1845.743) (-1841.096) (-1851.860) -- 0:02:49
268500 -- (-1843.198) [-1841.643] (-1853.940) (-1847.112) * (-1845.644) (-1844.898) [-1839.250] (-1856.839) -- 0:02:48
269000 -- [-1848.667] (-1844.381) (-1841.636) (-1845.086) * (-1841.973) [-1840.130] (-1842.155) (-1852.928) -- 0:02:51
269500 -- (-1849.264) (-1846.749) (-1840.513) [-1844.630] * (-1842.012) [-1838.580] (-1847.121) (-1843.211) -- 0:02:50
270000 -- (-1848.956) [-1843.233] (-1846.078) (-1843.426) * (-1844.443) (-1846.360) (-1848.697) [-1838.383] -- 0:02:50
Average standard deviation of split frequencies: 0.001742
270500 -- [-1841.849] (-1840.069) (-1845.373) (-1844.834) * (-1842.347) (-1841.323) (-1838.794) [-1843.816] -- 0:02:49
271000 -- [-1848.102] (-1843.569) (-1842.691) (-1842.765) * [-1843.412] (-1840.623) (-1843.517) (-1843.412) -- 0:02:49
271500 -- [-1843.823] (-1846.781) (-1849.281) (-1844.759) * (-1842.209) [-1842.179] (-1843.262) (-1843.838) -- 0:02:49
272000 -- (-1843.099) [-1840.766] (-1842.890) (-1851.093) * (-1848.237) (-1846.946) (-1840.472) [-1842.576] -- 0:02:48
272500 -- (-1845.724) (-1848.938) [-1843.330] (-1847.799) * (-1845.071) (-1845.099) (-1846.645) [-1842.944] -- 0:02:48
273000 -- (-1847.800) (-1850.024) (-1840.390) [-1849.020] * (-1854.752) (-1850.102) (-1848.253) [-1853.992] -- 0:02:47
273500 -- (-1856.678) [-1857.836] (-1848.976) (-1847.073) * (-1845.159) (-1850.126) [-1841.382] (-1841.520) -- 0:02:50
274000 -- (-1847.970) [-1843.992] (-1843.388) (-1851.173) * [-1845.167] (-1849.128) (-1842.242) (-1843.040) -- 0:02:49
274500 -- (-1852.655) (-1842.167) [-1840.250] (-1845.798) * (-1845.730) [-1847.243] (-1849.085) (-1839.148) -- 0:02:49
275000 -- (-1853.193) [-1840.321] (-1845.728) (-1842.661) * (-1842.814) [-1846.357] (-1843.210) (-1844.117) -- 0:02:48
Average standard deviation of split frequencies: 0.001708
275500 -- (-1847.684) (-1840.268) (-1843.372) [-1842.100] * [-1841.521] (-1851.362) (-1848.157) (-1842.905) -- 0:02:48
276000 -- (-1849.286) (-1845.677) [-1842.168] (-1844.988) * (-1845.898) (-1851.011) (-1844.641) [-1843.635] -- 0:02:47
276500 -- (-1843.097) [-1845.162] (-1844.816) (-1843.388) * (-1842.869) (-1853.363) (-1842.002) [-1843.876] -- 0:02:47
277000 -- (-1846.782) [-1843.911] (-1848.170) (-1846.797) * (-1845.709) (-1848.322) (-1844.705) [-1840.798] -- 0:02:47
277500 -- [-1840.853] (-1841.702) (-1845.834) (-1846.450) * (-1843.251) (-1850.854) [-1843.539] (-1837.958) -- 0:02:46
278000 -- (-1841.711) (-1838.940) [-1847.958] (-1848.131) * (-1845.129) (-1851.797) [-1842.472] (-1847.532) -- 0:02:48
278500 -- (-1845.142) (-1840.993) (-1842.371) [-1838.918] * (-1843.008) (-1846.105) (-1839.264) [-1838.822] -- 0:02:48
279000 -- [-1839.923] (-1845.817) (-1842.103) (-1851.214) * (-1849.838) (-1847.623) [-1840.875] (-1843.084) -- 0:02:47
279500 -- (-1843.926) (-1852.813) (-1849.666) [-1841.764] * (-1843.852) (-1847.376) [-1840.561] (-1850.153) -- 0:02:47
280000 -- [-1841.431] (-1847.804) (-1844.450) (-1841.782) * [-1837.883] (-1848.858) (-1857.641) (-1847.038) -- 0:02:47
Average standard deviation of split frequencies: 0.001680
280500 -- [-1842.767] (-1854.032) (-1843.641) (-1846.952) * (-1842.390) (-1848.741) (-1847.083) [-1839.024] -- 0:02:46
281000 -- (-1848.640) [-1842.758] (-1846.231) (-1845.241) * [-1856.460] (-1839.192) (-1841.831) (-1838.958) -- 0:02:46
281500 -- (-1848.282) [-1841.633] (-1842.570) (-1841.477) * (-1851.658) (-1847.179) (-1845.877) [-1840.171] -- 0:02:45
282000 -- (-1843.250) (-1840.878) [-1845.287] (-1848.638) * (-1853.075) (-1844.078) [-1842.066] (-1840.713) -- 0:02:45
282500 -- (-1851.427) (-1849.492) [-1846.450] (-1846.816) * (-1854.973) (-1845.614) (-1846.089) [-1851.245] -- 0:02:47
283000 -- (-1847.021) (-1844.321) (-1851.461) [-1844.217] * [-1844.184] (-1846.257) (-1843.926) (-1841.774) -- 0:02:47
283500 -- (-1847.113) (-1851.006) [-1840.781] (-1847.585) * [-1843.621] (-1845.531) (-1844.355) (-1840.412) -- 0:02:46
284000 -- (-1846.216) (-1853.704) [-1844.386] (-1847.315) * [-1843.731] (-1843.595) (-1840.472) (-1842.415) -- 0:02:46
284500 -- (-1844.353) (-1845.672) [-1843.768] (-1846.654) * (-1845.596) [-1841.686] (-1843.958) (-1844.783) -- 0:02:45
285000 -- [-1840.041] (-1841.170) (-1843.019) (-1844.688) * [-1844.238] (-1840.827) (-1851.839) (-1844.210) -- 0:02:45
Average standard deviation of split frequencies: 0.001648
285500 -- (-1844.832) (-1843.172) [-1841.185] (-1847.637) * [-1843.156] (-1839.837) (-1841.773) (-1844.075) -- 0:02:45
286000 -- [-1844.823] (-1847.193) (-1842.919) (-1848.054) * (-1842.141) (-1848.005) [-1851.594] (-1844.012) -- 0:02:44
286500 -- [-1849.399] (-1841.897) (-1842.414) (-1845.894) * (-1839.303) [-1842.693] (-1849.159) (-1844.065) -- 0:02:46
287000 -- [-1844.360] (-1845.378) (-1844.828) (-1847.767) * (-1840.360) [-1841.054] (-1849.812) (-1840.709) -- 0:02:46
287500 -- [-1840.581] (-1842.164) (-1852.521) (-1844.206) * (-1841.238) [-1844.557] (-1844.295) (-1844.004) -- 0:02:46
288000 -- (-1843.912) (-1841.909) (-1847.666) [-1842.625] * (-1848.854) [-1841.382] (-1847.457) (-1841.133) -- 0:02:45
288500 -- [-1840.277] (-1846.325) (-1844.612) (-1850.173) * [-1845.336] (-1845.918) (-1844.405) (-1849.554) -- 0:02:45
289000 -- [-1844.691] (-1840.009) (-1843.752) (-1839.974) * [-1848.010] (-1841.233) (-1843.724) (-1843.610) -- 0:02:44
289500 -- (-1851.668) (-1846.634) (-1842.742) [-1843.784] * (-1847.502) (-1842.143) [-1844.577] (-1842.336) -- 0:02:44
290000 -- (-1853.715) (-1843.786) [-1841.837] (-1854.005) * [-1842.144] (-1848.551) (-1848.668) (-1846.869) -- 0:02:44
Average standard deviation of split frequencies: 0.001622
290500 -- (-1843.061) (-1841.125) [-1843.147] (-1844.346) * (-1848.115) (-1844.800) (-1846.026) [-1839.636] -- 0:02:43
291000 -- (-1848.308) (-1845.263) [-1845.796] (-1844.123) * (-1847.145) (-1852.843) (-1850.481) [-1841.832] -- 0:02:45
291500 -- (-1843.997) [-1842.809] (-1844.731) (-1847.806) * (-1844.924) (-1843.063) (-1846.787) [-1845.678] -- 0:02:45
292000 -- (-1849.867) [-1837.637] (-1847.431) (-1846.362) * (-1845.105) [-1846.351] (-1848.987) (-1839.462) -- 0:02:44
292500 -- (-1850.700) [-1842.026] (-1843.104) (-1847.516) * (-1844.127) [-1843.110] (-1844.320) (-1840.148) -- 0:02:44
293000 -- (-1843.325) [-1851.011] (-1844.084) (-1848.817) * (-1841.850) (-1847.297) [-1842.789] (-1844.518) -- 0:02:44
293500 -- (-1843.673) (-1850.490) (-1847.739) [-1841.726] * (-1844.677) (-1842.773) [-1843.846] (-1842.972) -- 0:02:43
294000 -- (-1844.928) [-1843.774] (-1846.279) (-1847.166) * (-1845.170) (-1848.119) [-1842.282] (-1845.703) -- 0:02:43
294500 -- (-1849.857) (-1844.973) (-1845.204) [-1844.100] * (-1843.712) (-1844.771) [-1843.834] (-1845.050) -- 0:02:42
295000 -- (-1856.038) (-1841.333) (-1845.916) [-1842.325] * [-1841.453] (-1845.435) (-1848.665) (-1843.792) -- 0:02:42
Average standard deviation of split frequencies: 0.001593
295500 -- (-1847.202) (-1844.820) [-1841.107] (-1846.252) * (-1841.932) (-1843.005) (-1843.069) [-1844.299] -- 0:02:44
296000 -- (-1855.473) (-1846.642) [-1843.707] (-1842.223) * (-1843.137) (-1845.414) [-1846.689] (-1846.065) -- 0:02:44
296500 -- (-1843.944) (-1845.442) (-1846.011) [-1846.697] * (-1849.532) [-1843.502] (-1850.155) (-1847.842) -- 0:02:43
297000 -- (-1849.502) (-1841.879) [-1843.414] (-1844.489) * (-1850.998) (-1843.760) [-1847.958] (-1845.284) -- 0:02:43
297500 -- (-1847.468) [-1842.177] (-1842.800) (-1846.153) * [-1843.493] (-1853.125) (-1847.030) (-1845.208) -- 0:02:42
298000 -- (-1848.422) (-1844.000) [-1848.724] (-1859.179) * [-1841.827] (-1845.577) (-1846.258) (-1843.623) -- 0:02:42
298500 -- (-1851.392) (-1841.500) [-1846.021] (-1840.759) * (-1847.616) [-1850.705] (-1848.426) (-1851.286) -- 0:02:42
299000 -- (-1850.860) [-1843.464] (-1843.332) (-1853.909) * [-1844.683] (-1840.897) (-1844.718) (-1844.353) -- 0:02:41
299500 -- (-1850.774) [-1840.582] (-1840.780) (-1851.857) * (-1850.022) (-1844.188) (-1850.979) [-1846.947] -- 0:02:41
300000 -- [-1846.456] (-1841.808) (-1845.900) (-1841.755) * (-1846.689) [-1843.880] (-1850.262) (-1847.332) -- 0:02:43
Average standard deviation of split frequencies: 0.002352
300500 -- (-1847.888) (-1840.152) [-1845.328] (-1845.625) * (-1840.977) [-1849.527] (-1842.068) (-1847.615) -- 0:02:42
301000 -- [-1841.406] (-1840.689) (-1844.320) (-1846.866) * [-1845.037] (-1843.797) (-1845.063) (-1851.910) -- 0:02:42
301500 -- (-1846.753) [-1846.148] (-1850.511) (-1842.934) * [-1845.896] (-1854.061) (-1840.117) (-1848.345) -- 0:02:42
302000 -- (-1850.615) (-1844.960) (-1847.204) [-1843.294] * (-1853.687) (-1853.462) [-1841.885] (-1843.274) -- 0:02:41
302500 -- (-1851.985) (-1848.334) [-1843.993] (-1847.888) * (-1845.861) (-1842.885) (-1842.958) [-1841.609] -- 0:02:41
303000 -- (-1852.289) (-1841.454) (-1854.694) [-1844.502] * (-1844.272) (-1846.686) (-1844.226) [-1840.863] -- 0:02:41
303500 -- (-1847.797) [-1843.978] (-1848.017) (-1844.489) * (-1843.646) (-1850.419) [-1843.128] (-1847.414) -- 0:02:40
304000 -- (-1848.998) (-1848.410) (-1845.784) [-1838.523] * [-1841.678] (-1852.399) (-1842.944) (-1847.526) -- 0:02:40
304500 -- (-1848.181) [-1844.512] (-1845.704) (-1843.808) * (-1849.644) (-1844.269) [-1848.875] (-1840.026) -- 0:02:42
305000 -- [-1844.823] (-1848.215) (-1842.849) (-1847.825) * (-1850.170) (-1847.824) (-1839.219) [-1844.049] -- 0:02:41
Average standard deviation of split frequencies: 0.002311
305500 -- [-1843.994] (-1844.518) (-1852.238) (-1843.517) * (-1843.768) (-1844.893) (-1845.256) [-1849.191] -- 0:02:41
306000 -- (-1847.735) [-1842.700] (-1850.888) (-1858.455) * (-1844.598) (-1849.664) (-1840.928) [-1841.428] -- 0:02:41
306500 -- (-1842.174) (-1844.058) [-1843.653] (-1848.107) * (-1838.219) [-1844.356] (-1842.294) (-1841.580) -- 0:02:40
307000 -- (-1846.308) [-1840.850] (-1847.452) (-1847.390) * (-1842.335) (-1848.697) [-1839.418] (-1843.894) -- 0:02:40
307500 -- [-1843.902] (-1845.742) (-1839.911) (-1842.026) * [-1844.604] (-1847.399) (-1846.072) (-1853.363) -- 0:02:39
308000 -- (-1843.332) (-1847.780) [-1845.440] (-1848.218) * [-1841.552] (-1844.858) (-1846.294) (-1841.435) -- 0:02:39
308500 -- [-1844.527] (-1844.329) (-1839.019) (-1840.239) * [-1844.544] (-1846.132) (-1839.634) (-1843.874) -- 0:02:39
309000 -- (-1848.180) [-1848.769] (-1849.951) (-1843.832) * (-1842.163) (-1848.703) [-1843.526] (-1845.607) -- 0:02:41
309500 -- (-1843.817) (-1843.277) [-1855.955] (-1841.622) * (-1836.717) (-1846.151) [-1845.116] (-1844.343) -- 0:02:40
310000 -- (-1843.077) (-1842.944) [-1842.854] (-1842.391) * (-1848.714) (-1844.317) [-1846.784] (-1845.932) -- 0:02:40
Average standard deviation of split frequencies: 0.002276
310500 -- (-1840.081) (-1842.207) [-1841.663] (-1843.672) * (-1849.432) [-1840.648] (-1850.833) (-1848.591) -- 0:02:39
311000 -- [-1839.002] (-1842.329) (-1846.332) (-1837.890) * [-1848.440] (-1849.322) (-1845.124) (-1844.814) -- 0:02:39
311500 -- (-1847.053) [-1839.163] (-1843.144) (-1847.193) * (-1845.144) (-1842.595) [-1843.760] (-1848.271) -- 0:02:39
312000 -- (-1846.137) [-1840.422] (-1843.026) (-1843.542) * (-1860.143) (-1844.932) (-1842.056) [-1845.536] -- 0:02:38
312500 -- (-1842.838) (-1849.321) (-1848.168) [-1844.333] * (-1842.092) (-1843.758) (-1841.256) [-1849.287] -- 0:02:38
313000 -- (-1838.261) [-1841.513] (-1842.665) (-1845.631) * (-1846.581) [-1843.993] (-1846.958) (-1842.756) -- 0:02:40
313500 -- (-1843.630) (-1847.152) (-1846.059) [-1845.220] * (-1853.914) [-1841.806] (-1841.207) (-1840.732) -- 0:02:39
314000 -- [-1843.262] (-1847.259) (-1844.760) (-1847.101) * (-1850.869) (-1843.479) (-1846.769) [-1842.647] -- 0:02:39
314500 -- (-1839.313) (-1846.848) [-1849.164] (-1842.680) * (-1858.306) (-1843.918) (-1839.069) [-1854.997] -- 0:02:39
315000 -- (-1841.886) (-1846.788) [-1845.900] (-1844.434) * [-1846.033] (-1843.147) (-1839.969) (-1854.875) -- 0:02:38
Average standard deviation of split frequencies: 0.002238
315500 -- (-1852.266) (-1844.318) (-1847.233) [-1839.957] * (-1848.912) (-1845.383) [-1842.837] (-1845.065) -- 0:02:38
316000 -- [-1839.373] (-1843.422) (-1850.285) (-1843.550) * (-1849.897) (-1847.359) (-1846.449) [-1843.182] -- 0:02:38
316500 -- (-1847.235) (-1859.797) (-1847.203) [-1838.800] * (-1846.058) (-1847.391) (-1844.932) [-1843.957] -- 0:02:37
317000 -- (-1849.774) (-1844.800) [-1844.443] (-1841.113) * (-1841.722) (-1848.684) (-1843.810) [-1837.427] -- 0:02:37
317500 -- (-1844.249) (-1846.098) [-1846.564] (-1841.797) * (-1841.639) (-1847.207) [-1841.300] (-1850.201) -- 0:02:39
318000 -- (-1849.301) (-1844.844) [-1845.556] (-1848.503) * (-1845.100) (-1852.534) [-1839.905] (-1846.374) -- 0:02:38
318500 -- (-1843.589) [-1847.469] (-1842.357) (-1843.991) * (-1840.082) (-1854.740) [-1842.863] (-1848.020) -- 0:02:38
319000 -- [-1841.690] (-1842.648) (-1848.474) (-1843.808) * (-1843.262) (-1852.838) [-1845.159] (-1840.816) -- 0:02:37
319500 -- (-1839.018) (-1845.950) [-1840.498] (-1854.235) * (-1841.930) (-1849.886) [-1844.026] (-1841.810) -- 0:02:37
320000 -- (-1839.682) [-1849.715] (-1848.275) (-1844.197) * (-1839.189) (-1850.674) [-1844.333] (-1840.103) -- 0:02:37
Average standard deviation of split frequencies: 0.002205
320500 -- (-1842.315) (-1840.841) [-1846.409] (-1845.374) * (-1839.604) (-1851.845) [-1840.811] (-1838.772) -- 0:02:36
321000 -- [-1841.548] (-1839.340) (-1845.973) (-1841.240) * (-1841.335) (-1844.908) [-1838.220] (-1845.028) -- 0:02:36
321500 -- (-1845.965) (-1845.013) [-1842.872] (-1848.465) * [-1839.934] (-1848.436) (-1845.466) (-1844.749) -- 0:02:36
322000 -- (-1839.694) (-1842.943) (-1840.359) [-1843.071] * [-1849.067] (-1844.997) (-1844.453) (-1840.541) -- 0:02:37
322500 -- (-1850.092) (-1850.963) (-1846.902) [-1843.814] * (-1849.810) (-1844.137) (-1841.014) [-1844.600] -- 0:02:37
323000 -- [-1843.400] (-1846.156) (-1843.088) (-1842.609) * (-1843.379) (-1842.789) (-1848.252) [-1843.796] -- 0:02:37
323500 -- [-1842.465] (-1846.156) (-1841.219) (-1850.864) * (-1840.177) (-1849.334) [-1846.680] (-1844.958) -- 0:02:36
324000 -- (-1840.781) (-1848.796) [-1843.202] (-1843.582) * [-1840.082] (-1845.504) (-1842.199) (-1845.769) -- 0:02:36
324500 -- [-1841.778] (-1846.163) (-1845.309) (-1844.524) * [-1842.761] (-1847.677) (-1847.370) (-1845.495) -- 0:02:36
325000 -- (-1847.153) (-1853.228) [-1844.787] (-1842.604) * (-1843.349) (-1843.650) (-1846.590) [-1843.845] -- 0:02:35
Average standard deviation of split frequencies: 0.002169
325500 -- (-1843.789) [-1844.708] (-1845.282) (-1851.801) * [-1842.024] (-1846.673) (-1837.528) (-1843.763) -- 0:02:35
326000 -- (-1853.212) [-1843.236] (-1852.497) (-1849.488) * [-1844.919] (-1848.630) (-1843.483) (-1845.811) -- 0:02:35
326500 -- (-1849.003) (-1845.369) (-1845.731) [-1841.901] * (-1849.892) (-1846.429) [-1843.841] (-1845.003) -- 0:02:36
327000 -- (-1852.280) (-1841.379) (-1843.991) [-1845.259] * (-1854.568) (-1849.454) [-1842.319] (-1848.868) -- 0:02:36
327500 -- (-1855.352) [-1841.648] (-1854.358) (-1842.035) * (-1846.573) (-1840.688) (-1844.237) [-1845.863] -- 0:02:36
328000 -- (-1842.682) [-1842.590] (-1851.184) (-1846.419) * [-1839.782] (-1846.259) (-1839.366) (-1841.549) -- 0:02:35
328500 -- (-1847.995) (-1842.849) (-1849.435) [-1846.271] * (-1850.368) (-1845.042) [-1844.424] (-1842.797) -- 0:02:35
329000 -- (-1847.254) (-1843.337) (-1842.684) [-1849.542] * (-1847.660) [-1844.055] (-1842.529) (-1845.171) -- 0:02:35
329500 -- (-1846.671) (-1842.678) [-1845.386] (-1843.816) * (-1842.091) (-1843.230) [-1840.029] (-1843.651) -- 0:02:34
330000 -- (-1847.595) (-1845.740) (-1845.822) [-1840.667] * [-1839.279] (-1838.453) (-1841.953) (-1850.873) -- 0:02:34
Average standard deviation of split frequencies: 0.002138
330500 -- [-1845.515] (-1840.560) (-1840.663) (-1843.631) * [-1843.774] (-1850.805) (-1848.632) (-1843.221) -- 0:02:33
331000 -- (-1846.063) (-1842.823) [-1838.601] (-1851.764) * [-1844.730] (-1847.332) (-1847.626) (-1850.409) -- 0:02:35
331500 -- [-1842.496] (-1845.413) (-1850.813) (-1844.560) * (-1847.168) (-1840.461) (-1842.225) [-1845.633] -- 0:02:35
332000 -- [-1840.316] (-1838.008) (-1846.504) (-1845.157) * (-1844.043) (-1847.611) [-1840.673] (-1840.789) -- 0:02:34
332500 -- (-1847.505) (-1837.650) [-1845.197] (-1845.529) * [-1844.802] (-1847.780) (-1844.399) (-1841.682) -- 0:02:34
333000 -- (-1846.744) [-1840.130] (-1853.625) (-1850.495) * [-1839.663] (-1844.274) (-1852.936) (-1842.634) -- 0:02:34
333500 -- [-1842.434] (-1841.136) (-1844.169) (-1847.743) * (-1842.522) [-1844.992] (-1850.812) (-1843.721) -- 0:02:33
334000 -- (-1857.807) (-1843.660) [-1847.289] (-1846.859) * (-1837.312) [-1843.628] (-1845.594) (-1851.838) -- 0:02:33
334500 -- [-1843.927] (-1848.020) (-1844.176) (-1841.553) * [-1849.708] (-1847.641) (-1849.707) (-1846.145) -- 0:02:33
335000 -- (-1842.057) [-1839.778] (-1848.816) (-1840.648) * [-1846.624] (-1846.798) (-1849.259) (-1838.297) -- 0:02:32
Average standard deviation of split frequencies: 0.002104
335500 -- [-1845.151] (-1846.137) (-1847.575) (-1841.451) * (-1843.825) (-1847.256) (-1848.555) [-1841.042] -- 0:02:34
336000 -- [-1847.119] (-1844.140) (-1846.111) (-1841.716) * (-1849.197) (-1847.123) (-1852.180) [-1847.081] -- 0:02:34
336500 -- (-1845.276) [-1841.139] (-1848.186) (-1840.929) * (-1842.460) (-1838.255) [-1847.413] (-1842.947) -- 0:02:33
337000 -- [-1839.589] (-1845.465) (-1844.505) (-1847.987) * [-1844.795] (-1839.861) (-1846.674) (-1850.859) -- 0:02:33
337500 -- (-1845.150) [-1839.884] (-1842.100) (-1844.748) * (-1843.549) (-1847.083) (-1851.010) [-1843.888] -- 0:02:33
338000 -- [-1844.838] (-1842.119) (-1843.060) (-1845.761) * [-1846.150] (-1839.170) (-1842.243) (-1838.573) -- 0:02:32
338500 -- (-1852.178) (-1843.172) [-1842.923] (-1846.232) * [-1845.527] (-1844.903) (-1839.065) (-1845.973) -- 0:02:32
339000 -- (-1847.797) [-1839.939] (-1853.120) (-1847.789) * (-1856.965) (-1843.656) (-1840.261) [-1843.750] -- 0:02:32
339500 -- (-1846.561) (-1846.834) (-1845.841) [-1840.472] * (-1848.453) (-1841.615) [-1844.227] (-1846.500) -- 0:02:33
340000 -- [-1845.878] (-1838.687) (-1844.632) (-1848.280) * [-1848.682] (-1840.990) (-1842.376) (-1839.945) -- 0:02:33
Average standard deviation of split frequencies: 0.002076
340500 -- [-1844.757] (-1845.563) (-1845.372) (-1842.895) * (-1846.842) (-1845.259) (-1845.053) [-1842.872] -- 0:02:33
341000 -- (-1847.704) (-1839.983) (-1839.371) [-1846.493] * (-1848.691) [-1844.173] (-1843.069) (-1847.224) -- 0:02:32
341500 -- [-1844.272] (-1844.821) (-1844.584) (-1842.333) * [-1841.749] (-1847.646) (-1844.426) (-1837.657) -- 0:02:32
342000 -- (-1853.741) (-1841.933) [-1842.893] (-1844.231) * [-1849.984] (-1843.814) (-1842.684) (-1840.023) -- 0:02:31
342500 -- (-1842.158) (-1840.406) [-1846.468] (-1841.728) * (-1850.507) (-1849.989) (-1845.661) [-1840.313] -- 0:02:31
343000 -- [-1841.060] (-1855.997) (-1845.054) (-1847.000) * (-1841.582) (-1847.450) (-1851.673) [-1841.911] -- 0:02:31
343500 -- (-1848.396) (-1846.919) (-1852.375) [-1845.174] * (-1847.714) [-1842.756] (-1847.477) (-1847.561) -- 0:02:30
344000 -- (-1845.220) [-1848.817] (-1845.485) (-1846.020) * (-1842.469) (-1841.648) [-1845.415] (-1845.744) -- 0:02:32
344500 -- (-1851.574) [-1849.635] (-1845.243) (-1843.175) * (-1852.375) (-1842.764) (-1847.951) [-1843.918] -- 0:02:32
345000 -- (-1843.675) (-1845.187) (-1849.671) [-1846.241] * (-1846.702) (-1842.072) (-1844.400) [-1847.486] -- 0:02:31
Average standard deviation of split frequencies: 0.002044
345500 -- (-1842.599) (-1847.732) [-1846.658] (-1846.078) * (-1847.908) (-1849.083) (-1847.680) [-1842.407] -- 0:02:31
346000 -- (-1839.353) (-1843.162) [-1840.900] (-1847.377) * [-1846.383] (-1843.337) (-1846.523) (-1848.447) -- 0:02:31
346500 -- (-1850.049) (-1845.031) (-1844.050) [-1849.596] * [-1848.660] (-1845.772) (-1846.872) (-1851.558) -- 0:02:30
347000 -- (-1848.718) [-1846.272] (-1844.627) (-1841.907) * (-1841.459) [-1840.323] (-1845.368) (-1849.655) -- 0:02:30
347500 -- (-1845.142) (-1846.322) [-1841.686] (-1844.539) * (-1847.097) (-1850.858) [-1843.051] (-1844.808) -- 0:02:30
348000 -- [-1845.609] (-1848.116) (-1847.173) (-1851.593) * [-1846.145] (-1844.491) (-1847.140) (-1854.142) -- 0:02:29
348500 -- (-1849.020) [-1841.898] (-1854.781) (-1847.618) * (-1841.808) [-1845.255] (-1852.841) (-1850.937) -- 0:02:31
349000 -- (-1844.840) (-1843.506) [-1843.632] (-1852.469) * [-1851.697] (-1841.822) (-1839.233) (-1844.302) -- 0:02:31
349500 -- (-1842.713) (-1842.053) [-1846.161] (-1850.614) * [-1841.344] (-1838.878) (-1840.016) (-1840.528) -- 0:02:30
350000 -- (-1846.093) [-1844.587] (-1843.534) (-1849.458) * (-1850.587) (-1849.411) (-1841.677) [-1845.761] -- 0:02:30
Average standard deviation of split frequencies: 0.002016
350500 -- (-1849.898) (-1844.978) (-1851.174) [-1844.134] * [-1846.756] (-1845.778) (-1844.452) (-1842.463) -- 0:02:30
351000 -- [-1842.881] (-1843.739) (-1842.448) (-1842.347) * (-1846.065) (-1843.922) (-1846.084) [-1843.207] -- 0:02:29
351500 -- (-1846.189) (-1843.724) (-1847.004) [-1837.176] * [-1844.405] (-1847.540) (-1847.245) (-1840.581) -- 0:02:29
352000 -- (-1842.042) (-1842.011) [-1845.568] (-1839.766) * (-1841.746) (-1843.833) (-1849.928) [-1845.194] -- 0:02:29
352500 -- (-1841.873) [-1841.409] (-1845.732) (-1842.392) * (-1843.233) (-1844.149) (-1840.811) [-1844.834] -- 0:02:28
353000 -- (-1845.280) (-1842.725) (-1844.060) [-1841.342] * (-1844.655) (-1845.405) [-1842.053] (-1841.296) -- 0:02:30
353500 -- (-1842.774) (-1840.855) (-1845.954) [-1844.898] * (-1844.751) (-1843.688) (-1842.409) [-1843.551] -- 0:02:29
354000 -- (-1847.131) [-1840.564] (-1842.628) (-1847.178) * (-1838.903) (-1846.681) (-1845.713) [-1846.367] -- 0:02:29
354500 -- (-1847.023) (-1845.808) [-1843.813] (-1847.138) * (-1854.474) (-1847.208) (-1848.036) [-1844.995] -- 0:02:29
355000 -- (-1842.598) [-1846.304] (-1847.741) (-1848.523) * (-1846.122) (-1846.259) (-1845.194) [-1842.859] -- 0:02:28
Average standard deviation of split frequencies: 0.001986
355500 -- (-1841.132) (-1844.428) [-1849.610] (-1844.627) * [-1840.067] (-1842.004) (-1848.010) (-1843.528) -- 0:02:28
356000 -- (-1842.674) [-1836.700] (-1853.252) (-1847.072) * [-1848.627] (-1844.162) (-1845.369) (-1844.586) -- 0:02:28
356500 -- (-1845.746) (-1842.150) (-1849.732) [-1846.258] * (-1842.372) (-1845.437) [-1849.487] (-1844.480) -- 0:02:28
357000 -- (-1849.569) (-1842.848) (-1846.162) [-1850.425] * (-1843.072) [-1844.263] (-1844.529) (-1841.836) -- 0:02:29
357500 -- (-1839.987) (-1844.347) [-1841.485] (-1851.038) * (-1844.970) (-1840.184) (-1844.927) [-1844.282] -- 0:02:29
358000 -- (-1842.922) [-1840.720] (-1843.523) (-1851.289) * (-1848.455) (-1846.151) [-1840.544] (-1841.608) -- 0:02:28
358500 -- (-1843.925) (-1844.267) [-1841.368] (-1838.643) * (-1846.596) [-1841.334] (-1841.963) (-1844.146) -- 0:02:28
359000 -- (-1843.213) (-1842.750) (-1847.175) [-1839.714] * (-1845.114) (-1840.026) [-1846.070] (-1844.358) -- 0:02:28
359500 -- (-1844.770) (-1855.605) [-1845.513] (-1842.987) * [-1841.595] (-1845.368) (-1843.656) (-1841.492) -- 0:02:27
360000 -- (-1843.183) (-1845.002) (-1845.540) [-1842.919] * (-1846.745) (-1846.074) (-1852.561) [-1844.554] -- 0:02:27
Average standard deviation of split frequencies: 0.001961
360500 -- [-1846.469] (-1847.068) (-1841.888) (-1838.569) * (-1842.742) [-1841.989] (-1838.814) (-1839.683) -- 0:02:27
361000 -- (-1851.902) [-1844.843] (-1843.170) (-1838.830) * (-1836.489) (-1841.790) [-1840.559] (-1845.904) -- 0:02:26
361500 -- (-1841.866) (-1853.943) (-1847.466) [-1841.287] * (-1838.967) (-1850.345) [-1849.504] (-1844.631) -- 0:02:28
362000 -- [-1840.317] (-1849.711) (-1842.353) (-1841.240) * [-1847.990] (-1845.626) (-1847.267) (-1845.739) -- 0:02:28
362500 -- (-1847.325) (-1846.050) (-1843.121) [-1845.890] * [-1840.937] (-1850.755) (-1844.239) (-1846.071) -- 0:02:27
363000 -- (-1855.795) (-1841.920) (-1843.337) [-1844.739] * (-1842.641) [-1842.518] (-1851.416) (-1840.830) -- 0:02:27
363500 -- (-1848.933) (-1844.424) [-1842.260] (-1842.867) * [-1845.412] (-1837.253) (-1851.349) (-1847.241) -- 0:02:27
364000 -- (-1862.223) (-1843.214) [-1845.244] (-1849.790) * (-1851.693) (-1838.176) (-1843.889) [-1841.796] -- 0:02:26
364500 -- (-1856.460) (-1843.324) [-1842.126] (-1854.813) * (-1842.773) (-1839.125) [-1850.678] (-1844.904) -- 0:02:26
365000 -- [-1853.066] (-1843.439) (-1841.914) (-1846.920) * (-1846.675) (-1844.410) (-1849.417) [-1841.612] -- 0:02:26
Average standard deviation of split frequencies: 0.001932
365500 -- (-1847.748) [-1843.122] (-1846.107) (-1846.708) * (-1848.329) (-1847.363) (-1847.715) [-1843.934] -- 0:02:25
366000 -- [-1848.029] (-1846.781) (-1843.194) (-1850.265) * [-1843.968] (-1842.077) (-1840.765) (-1846.747) -- 0:02:27
366500 -- (-1842.142) [-1840.162] (-1848.174) (-1847.974) * (-1852.407) [-1840.636] (-1843.000) (-1843.900) -- 0:02:26
367000 -- [-1840.419] (-1840.750) (-1843.667) (-1849.814) * (-1839.665) [-1842.019] (-1844.887) (-1843.265) -- 0:02:26
367500 -- [-1841.007] (-1841.879) (-1839.931) (-1843.293) * (-1844.964) (-1845.023) (-1846.467) [-1839.426] -- 0:02:26
368000 -- [-1840.686] (-1843.850) (-1841.700) (-1847.839) * [-1841.902] (-1842.475) (-1840.018) (-1840.084) -- 0:02:25
368500 -- (-1842.614) (-1845.455) (-1842.089) [-1840.719] * (-1843.021) (-1842.096) (-1856.716) [-1843.579] -- 0:02:25
369000 -- [-1841.706] (-1847.726) (-1855.459) (-1847.362) * (-1843.380) [-1844.447] (-1841.261) (-1841.335) -- 0:02:25
369500 -- (-1848.874) (-1851.842) (-1846.533) [-1842.197] * (-1852.866) (-1848.762) [-1852.402] (-1842.541) -- 0:02:25
370000 -- (-1842.754) (-1842.055) [-1845.961] (-1845.805) * (-1848.289) (-1845.668) (-1841.344) [-1841.141] -- 0:02:24
Average standard deviation of split frequencies: 0.001908
370500 -- (-1846.816) (-1851.850) (-1844.306) [-1843.083] * (-1844.949) [-1849.023] (-1848.540) (-1845.922) -- 0:02:26
371000 -- (-1849.957) (-1846.316) (-1843.092) [-1842.256] * [-1844.242] (-1847.606) (-1845.753) (-1841.937) -- 0:02:25
371500 -- (-1847.134) (-1843.716) [-1842.712] (-1844.500) * (-1842.866) [-1841.129] (-1840.653) (-1839.885) -- 0:02:25
372000 -- (-1845.424) (-1852.889) [-1841.299] (-1841.823) * (-1840.522) [-1843.571] (-1845.647) (-1848.354) -- 0:02:25
372500 -- (-1848.184) (-1854.265) [-1845.091] (-1843.370) * [-1844.830] (-1844.280) (-1852.280) (-1844.643) -- 0:02:24
373000 -- (-1849.463) [-1843.443] (-1843.406) (-1841.533) * (-1848.342) [-1842.399] (-1842.827) (-1844.437) -- 0:02:24
373500 -- (-1850.993) (-1843.349) (-1846.583) [-1839.206] * [-1848.241] (-1846.083) (-1847.090) (-1849.910) -- 0:02:24
374000 -- (-1842.408) [-1846.558] (-1841.081) (-1844.279) * [-1849.222] (-1843.567) (-1846.286) (-1845.399) -- 0:02:23
374500 -- (-1839.189) (-1843.840) (-1844.178) [-1841.708] * (-1849.143) [-1838.954] (-1842.939) (-1840.677) -- 0:02:25
375000 -- (-1841.600) (-1846.489) (-1847.961) [-1844.683] * (-1847.347) (-1843.649) [-1843.417] (-1843.485) -- 0:02:25
Average standard deviation of split frequencies: 0.001881
375500 -- [-1846.588] (-1844.234) (-1841.085) (-1845.328) * (-1843.968) (-1843.439) [-1849.907] (-1851.987) -- 0:02:24
376000 -- (-1842.539) [-1841.326] (-1841.477) (-1848.741) * (-1841.282) (-1843.989) [-1845.209] (-1849.972) -- 0:02:24
376500 -- [-1840.291] (-1845.131) (-1848.591) (-1849.636) * (-1846.656) [-1842.675] (-1842.297) (-1845.587) -- 0:02:24
377000 -- (-1837.518) (-1844.988) [-1847.178] (-1844.239) * (-1849.058) (-1841.600) [-1839.522] (-1841.624) -- 0:02:23
377500 -- [-1844.249] (-1847.194) (-1845.660) (-1847.057) * [-1843.485] (-1843.919) (-1839.114) (-1844.157) -- 0:02:23
378000 -- (-1844.867) (-1851.977) (-1847.197) [-1842.222] * (-1845.807) [-1841.236] (-1845.071) (-1846.926) -- 0:02:23
378500 -- (-1842.565) (-1848.580) [-1842.506] (-1843.874) * (-1843.166) (-1845.715) [-1842.871] (-1853.671) -- 0:02:22
379000 -- (-1846.429) (-1842.382) [-1840.066] (-1849.052) * (-1856.525) (-1840.720) [-1844.280] (-1847.643) -- 0:02:24
379500 -- (-1843.445) (-1845.029) [-1843.471] (-1849.970) * (-1844.185) [-1842.099] (-1836.752) (-1843.253) -- 0:02:23
380000 -- [-1841.043] (-1846.428) (-1842.610) (-1841.498) * (-1844.782) (-1843.153) [-1846.255] (-1839.163) -- 0:02:23
Average standard deviation of split frequencies: 0.001238
380500 -- [-1841.432] (-1845.384) (-1839.970) (-1854.378) * [-1844.549] (-1840.144) (-1844.832) (-1845.875) -- 0:02:23
381000 -- (-1852.116) (-1842.332) [-1843.961] (-1843.940) * (-1844.804) [-1842.764] (-1841.998) (-1842.232) -- 0:02:22
381500 -- (-1841.259) (-1845.429) [-1837.944] (-1840.189) * (-1850.478) [-1844.570] (-1841.605) (-1848.519) -- 0:02:22
382000 -- (-1845.036) [-1842.387] (-1846.210) (-1843.242) * (-1842.210) (-1848.824) [-1845.008] (-1846.842) -- 0:02:22
382500 -- (-1841.434) (-1848.010) [-1843.630] (-1844.929) * (-1841.788) (-1844.893) (-1842.409) [-1844.170] -- 0:02:22
383000 -- (-1839.811) [-1843.253] (-1843.689) (-1845.388) * (-1846.565) [-1844.874] (-1847.157) (-1844.971) -- 0:02:21
383500 -- (-1839.684) (-1853.706) (-1844.249) [-1846.551] * (-1840.080) (-1840.859) (-1850.202) [-1848.390] -- 0:02:23
384000 -- (-1844.086) (-1844.290) (-1842.376) [-1841.544] * (-1844.802) (-1853.974) [-1848.541] (-1846.333) -- 0:02:22
384500 -- (-1847.070) [-1842.954] (-1843.156) (-1842.204) * [-1840.258] (-1845.010) (-1850.372) (-1842.618) -- 0:02:22
385000 -- (-1844.593) [-1843.721] (-1846.462) (-1849.408) * (-1846.305) (-1841.848) (-1845.262) [-1848.173] -- 0:02:22
Average standard deviation of split frequencies: 0.001221
385500 -- (-1845.590) (-1848.802) [-1848.048] (-1850.539) * [-1842.290] (-1842.638) (-1842.940) (-1850.370) -- 0:02:21
386000 -- [-1841.887] (-1848.560) (-1840.001) (-1837.646) * (-1849.019) [-1840.954] (-1842.860) (-1854.617) -- 0:02:21
386500 -- (-1844.291) (-1847.189) (-1845.433) [-1843.118] * (-1842.193) (-1840.793) [-1841.503] (-1845.354) -- 0:02:21
387000 -- [-1840.684] (-1843.701) (-1846.348) (-1849.474) * (-1844.687) (-1841.524) [-1843.096] (-1854.882) -- 0:02:20
387500 -- (-1845.185) (-1850.572) [-1845.940] (-1846.540) * (-1844.327) (-1841.691) (-1846.965) [-1845.576] -- 0:02:22
388000 -- (-1849.516) (-1847.229) [-1840.462] (-1843.866) * [-1841.757] (-1848.543) (-1843.461) (-1844.520) -- 0:02:21
388500 -- [-1841.461] (-1842.463) (-1848.229) (-1841.973) * [-1843.293] (-1846.818) (-1846.503) (-1846.146) -- 0:02:21
389000 -- (-1842.326) [-1839.410] (-1845.538) (-1844.712) * [-1842.892] (-1854.268) (-1846.692) (-1845.961) -- 0:02:21
389500 -- [-1840.816] (-1842.719) (-1845.054) (-1842.616) * (-1842.397) (-1852.848) [-1847.722] (-1848.351) -- 0:02:21
390000 -- (-1842.051) (-1845.149) [-1846.060] (-1847.271) * (-1843.119) (-1842.044) [-1842.732] (-1845.391) -- 0:02:20
Average standard deviation of split frequencies: 0.001207
390500 -- (-1846.783) [-1838.420] (-1846.840) (-1838.828) * [-1843.608] (-1841.628) (-1843.051) (-1847.851) -- 0:02:20
391000 -- (-1852.251) [-1838.180] (-1841.473) (-1839.593) * (-1846.229) (-1848.051) [-1840.657] (-1843.376) -- 0:02:20
391500 -- (-1845.315) [-1844.547] (-1846.445) (-1841.996) * (-1842.994) (-1845.917) (-1851.988) [-1842.410] -- 0:02:19
392000 -- [-1846.262] (-1849.892) (-1844.469) (-1842.804) * (-1846.803) (-1850.730) (-1840.780) [-1841.539] -- 0:02:21
392500 -- [-1841.948] (-1846.563) (-1842.171) (-1841.596) * (-1846.710) (-1855.149) [-1844.142] (-1843.603) -- 0:02:20
393000 -- [-1848.800] (-1848.403) (-1848.615) (-1841.623) * (-1840.845) [-1841.438] (-1839.828) (-1846.903) -- 0:02:20
393500 -- (-1843.059) (-1844.292) (-1855.570) [-1840.034] * [-1844.134] (-1845.455) (-1842.688) (-1849.693) -- 0:02:20
394000 -- (-1839.777) (-1846.723) (-1845.246) [-1839.277] * [-1840.757] (-1840.706) (-1845.933) (-1846.076) -- 0:02:19
394500 -- [-1842.116] (-1848.194) (-1847.881) (-1848.519) * [-1838.723] (-1850.162) (-1849.976) (-1850.975) -- 0:02:19
395000 -- [-1840.027] (-1846.244) (-1844.582) (-1849.557) * (-1843.895) [-1853.946] (-1842.838) (-1845.962) -- 0:02:19
Average standard deviation of split frequencies: 0.001190
395500 -- [-1842.787] (-1842.795) (-1845.630) (-1853.858) * [-1844.075] (-1848.358) (-1849.938) (-1844.994) -- 0:02:19
396000 -- (-1847.145) [-1842.399] (-1844.374) (-1851.907) * [-1842.828] (-1848.785) (-1845.911) (-1846.440) -- 0:02:18
396500 -- (-1849.828) [-1846.589] (-1840.901) (-1842.999) * (-1849.579) [-1847.723] (-1843.918) (-1841.763) -- 0:02:20
397000 -- (-1846.993) [-1846.350] (-1845.378) (-1842.296) * (-1858.971) [-1839.226] (-1844.282) (-1838.755) -- 0:02:19
397500 -- (-1845.116) (-1851.644) (-1851.615) [-1840.116] * (-1854.510) [-1846.835] (-1846.960) (-1842.792) -- 0:02:19
398000 -- (-1852.346) (-1849.733) (-1849.019) [-1848.906] * (-1849.717) [-1849.121] (-1847.968) (-1845.883) -- 0:02:19
398500 -- (-1850.675) (-1847.382) [-1843.646] (-1843.344) * (-1859.315) (-1840.762) (-1842.883) [-1840.749] -- 0:02:18
399000 -- [-1840.262] (-1851.435) (-1846.728) (-1844.357) * (-1855.227) (-1848.117) [-1843.420] (-1837.315) -- 0:02:18
399500 -- (-1841.428) (-1847.781) [-1846.214] (-1841.056) * [-1849.597] (-1845.250) (-1843.969) (-1848.926) -- 0:02:18
400000 -- (-1847.751) (-1858.016) (-1843.009) [-1841.115] * (-1847.404) (-1845.318) [-1839.975] (-1838.990) -- 0:02:18
Average standard deviation of split frequencies: 0.001177
400500 -- (-1849.555) (-1852.015) (-1846.530) [-1848.380] * (-1843.090) [-1842.760] (-1843.897) (-1843.948) -- 0:02:17
401000 -- (-1841.940) [-1847.885] (-1846.048) (-1839.987) * (-1844.376) [-1841.165] (-1851.848) (-1840.089) -- 0:02:18
401500 -- [-1844.693] (-1850.028) (-1838.502) (-1845.596) * (-1848.395) (-1853.035) [-1844.554] (-1846.688) -- 0:02:18
402000 -- (-1841.501) (-1842.994) (-1848.472) [-1843.187] * (-1849.295) (-1847.175) (-1846.620) [-1845.410] -- 0:02:18
402500 -- [-1844.858] (-1844.769) (-1843.258) (-1846.415) * (-1843.763) (-1844.684) [-1840.527] (-1845.187) -- 0:02:18
403000 -- (-1847.596) (-1845.186) [-1842.542] (-1841.017) * (-1844.983) [-1840.125] (-1844.264) (-1844.106) -- 0:02:17
403500 -- (-1848.078) (-1842.023) (-1845.990) [-1837.935] * (-1844.935) (-1842.657) [-1843.012] (-1839.878) -- 0:02:17
404000 -- (-1852.663) (-1840.952) (-1843.164) [-1842.462] * (-1846.830) (-1842.346) [-1852.654] (-1847.353) -- 0:02:17
404500 -- (-1851.705) (-1842.676) (-1848.676) [-1841.699] * (-1842.375) [-1845.030] (-1843.136) (-1844.648) -- 0:02:16
405000 -- (-1851.476) (-1843.956) (-1851.562) [-1840.569] * (-1843.704) (-1842.635) (-1847.126) [-1847.867] -- 0:02:16
Average standard deviation of split frequencies: 0.001161
405500 -- (-1847.862) (-1843.856) (-1840.085) [-1844.647] * (-1850.110) [-1842.244] (-1847.445) (-1838.959) -- 0:02:17
406000 -- (-1848.739) (-1846.001) [-1843.482] (-1846.494) * (-1841.302) (-1846.059) (-1839.584) [-1842.635] -- 0:02:17
406500 -- (-1847.609) [-1841.586] (-1847.709) (-1847.919) * (-1847.625) [-1842.740] (-1845.975) (-1845.630) -- 0:02:17
407000 -- [-1843.835] (-1841.516) (-1844.664) (-1847.870) * (-1848.406) [-1846.380] (-1848.185) (-1846.896) -- 0:02:16
407500 -- (-1839.809) (-1844.824) [-1838.697] (-1841.889) * [-1845.315] (-1841.553) (-1848.471) (-1845.950) -- 0:02:16
408000 -- (-1850.301) [-1851.215] (-1845.103) (-1842.366) * [-1842.030] (-1848.515) (-1842.873) (-1846.333) -- 0:02:16
408500 -- (-1844.739) (-1855.801) [-1843.373] (-1846.183) * (-1849.002) (-1849.850) [-1839.541] (-1851.571) -- 0:02:16
409000 -- (-1850.586) (-1843.047) [-1849.964] (-1845.213) * (-1844.873) (-1843.961) [-1843.989] (-1845.363) -- 0:02:15
409500 -- [-1843.256] (-1848.999) (-1843.652) (-1846.057) * (-1845.271) [-1839.923] (-1843.090) (-1844.138) -- 0:02:16
410000 -- [-1841.405] (-1839.206) (-1841.798) (-1842.441) * (-1847.510) (-1842.723) (-1845.847) [-1838.896] -- 0:02:16
Average standard deviation of split frequencies: 0.001148
410500 -- (-1843.210) (-1841.044) (-1843.538) [-1840.690] * [-1847.547] (-1847.365) (-1843.261) (-1841.833) -- 0:02:16
411000 -- (-1843.927) (-1841.585) [-1847.262] (-1842.679) * (-1841.344) (-1849.434) [-1843.846] (-1840.831) -- 0:02:16
411500 -- [-1845.602] (-1842.815) (-1850.965) (-1843.168) * [-1849.735] (-1851.697) (-1842.527) (-1845.128) -- 0:02:15
412000 -- (-1842.809) (-1854.135) (-1844.252) [-1839.701] * (-1850.274) (-1858.111) (-1848.158) [-1847.345] -- 0:02:15
412500 -- (-1848.497) (-1842.784) [-1842.862] (-1845.997) * [-1845.220] (-1855.293) (-1842.815) (-1844.359) -- 0:02:15
413000 -- (-1840.582) [-1845.661] (-1845.229) (-1845.496) * [-1845.246] (-1850.552) (-1843.613) (-1849.739) -- 0:02:15
413500 -- (-1841.170) [-1846.030] (-1847.034) (-1847.453) * (-1842.604) (-1847.924) (-1840.208) [-1844.224] -- 0:02:14
414000 -- [-1842.955] (-1846.823) (-1847.236) (-1846.731) * (-1843.165) (-1846.847) [-1843.478] (-1850.883) -- 0:02:15
414500 -- [-1843.250] (-1839.431) (-1845.978) (-1845.909) * (-1840.879) (-1843.061) [-1840.831] (-1855.047) -- 0:02:15
415000 -- [-1839.078] (-1847.129) (-1850.620) (-1852.596) * (-1847.119) [-1843.820] (-1842.292) (-1849.476) -- 0:02:15
Average standard deviation of split frequencies: 0.001133
415500 -- (-1843.597) (-1845.434) [-1848.450] (-1848.039) * (-1846.369) (-1844.042) [-1841.672] (-1849.705) -- 0:02:15
416000 -- (-1844.221) (-1847.301) (-1848.853) [-1845.994] * (-1840.833) [-1847.255] (-1845.711) (-1852.065) -- 0:02:14
416500 -- [-1844.662] (-1846.545) (-1852.031) (-1842.370) * [-1845.191] (-1843.529) (-1844.593) (-1849.345) -- 0:02:14
417000 -- (-1845.396) (-1841.531) [-1849.163] (-1848.832) * (-1844.374) (-1844.495) (-1842.934) [-1846.986] -- 0:02:14
417500 -- (-1844.249) (-1844.726) [-1847.665] (-1853.591) * (-1840.998) [-1846.990] (-1842.746) (-1852.780) -- 0:02:13
418000 -- (-1846.127) (-1841.977) [-1840.564] (-1841.175) * (-1842.630) [-1844.021] (-1842.726) (-1843.240) -- 0:02:13
418500 -- (-1844.907) [-1845.190] (-1843.449) (-1843.809) * (-1838.071) (-1840.505) [-1841.668] (-1846.824) -- 0:02:14
419000 -- [-1845.662] (-1841.824) (-1848.665) (-1845.336) * (-1851.002) (-1845.215) [-1848.195] (-1842.083) -- 0:02:14
419500 -- (-1843.238) (-1845.287) [-1841.517] (-1841.894) * [-1839.722] (-1852.343) (-1852.470) (-1843.959) -- 0:02:14
420000 -- (-1843.563) [-1840.864] (-1839.058) (-1849.580) * (-1843.012) (-1847.527) (-1841.716) [-1841.877] -- 0:02:13
Average standard deviation of split frequencies: 0.001681
420500 -- (-1845.771) (-1846.660) (-1849.714) [-1841.929] * [-1843.375] (-1843.947) (-1845.133) (-1847.649) -- 0:02:13
421000 -- [-1839.215] (-1843.647) (-1845.701) (-1847.258) * [-1839.005] (-1843.631) (-1845.596) (-1843.622) -- 0:02:13
421500 -- (-1845.459) (-1844.946) (-1847.788) [-1839.181] * [-1842.357] (-1847.050) (-1838.773) (-1844.624) -- 0:02:13
422000 -- (-1843.872) (-1844.102) (-1841.211) [-1844.822] * (-1842.598) (-1844.055) [-1844.452] (-1849.106) -- 0:02:12
422500 -- (-1844.153) (-1843.637) (-1843.061) [-1844.623] * (-1845.147) (-1842.133) (-1842.251) [-1842.795] -- 0:02:12
423000 -- [-1841.239] (-1846.688) (-1841.544) (-1848.855) * (-1849.609) [-1844.514] (-1844.292) (-1852.218) -- 0:02:13
423500 -- (-1842.337) (-1849.704) [-1843.624] (-1850.161) * (-1850.844) (-1842.935) [-1840.804] (-1846.900) -- 0:02:13
424000 -- (-1838.811) (-1851.021) (-1840.562) [-1850.280] * (-1844.406) (-1843.677) [-1843.326] (-1848.225) -- 0:02:13
424500 -- (-1843.160) (-1845.352) [-1842.244] (-1847.949) * (-1848.852) (-1848.654) (-1838.797) [-1848.801] -- 0:02:12
425000 -- (-1840.929) [-1852.186] (-1846.541) (-1848.776) * (-1853.244) (-1840.751) [-1841.807] (-1849.327) -- 0:02:12
Average standard deviation of split frequencies: 0.001660
425500 -- [-1842.414] (-1843.749) (-1838.318) (-1850.130) * [-1844.535] (-1844.591) (-1847.171) (-1847.508) -- 0:02:12
426000 -- (-1843.184) [-1843.043] (-1843.020) (-1843.038) * (-1841.569) (-1847.682) [-1839.830] (-1848.368) -- 0:02:12
426500 -- [-1844.157] (-1841.408) (-1846.415) (-1838.927) * (-1844.419) (-1849.735) [-1839.962] (-1843.776) -- 0:02:11
427000 -- (-1846.255) [-1846.829] (-1847.978) (-1843.210) * (-1844.274) (-1846.938) [-1847.101] (-1843.492) -- 0:02:11
427500 -- (-1853.740) (-1851.403) (-1845.582) [-1842.766] * [-1844.703] (-1842.878) (-1855.864) (-1843.822) -- 0:02:12
428000 -- (-1854.648) (-1845.723) [-1840.316] (-1848.627) * (-1842.741) [-1843.378] (-1849.187) (-1842.546) -- 0:02:12
428500 -- [-1845.108] (-1847.317) (-1846.327) (-1842.366) * [-1842.215] (-1845.029) (-1847.475) (-1844.812) -- 0:02:12
429000 -- (-1840.767) (-1843.068) (-1845.450) [-1843.874] * [-1841.690] (-1840.157) (-1844.941) (-1837.201) -- 0:02:11
429500 -- (-1841.856) (-1841.160) [-1844.541] (-1847.699) * (-1839.101) (-1843.018) (-1853.596) [-1840.720] -- 0:02:11
430000 -- (-1842.287) (-1843.924) (-1852.468) [-1840.259] * [-1836.888] (-1841.647) (-1846.064) (-1841.328) -- 0:02:11
Average standard deviation of split frequencies: 0.001642
430500 -- [-1843.823] (-1848.264) (-1845.878) (-1841.521) * (-1840.263) [-1849.148] (-1850.741) (-1847.535) -- 0:02:10
431000 -- [-1847.348] (-1840.104) (-1840.636) (-1844.384) * (-1845.863) [-1838.948] (-1845.060) (-1844.754) -- 0:02:10
431500 -- (-1838.451) [-1839.394] (-1840.125) (-1848.053) * (-1842.098) (-1841.209) [-1843.678] (-1840.328) -- 0:02:11
432000 -- (-1840.624) (-1850.653) (-1845.894) [-1842.738] * [-1842.255] (-1845.947) (-1852.560) (-1841.615) -- 0:02:11
432500 -- [-1845.539] (-1842.041) (-1843.370) (-1853.857) * (-1848.517) (-1843.152) [-1844.217] (-1848.577) -- 0:02:11
433000 -- [-1839.814] (-1838.771) (-1843.292) (-1844.850) * (-1848.259) [-1844.254] (-1841.296) (-1843.319) -- 0:02:10
433500 -- (-1844.379) (-1843.839) [-1847.396] (-1853.381) * [-1841.852] (-1841.233) (-1847.535) (-1846.543) -- 0:02:10
434000 -- (-1840.071) (-1843.756) [-1838.974] (-1852.998) * (-1839.108) (-1848.775) (-1846.802) [-1842.451] -- 0:02:10
434500 -- (-1846.607) (-1850.757) [-1841.314] (-1845.769) * (-1847.893) (-1842.782) (-1840.357) [-1843.570] -- 0:02:10
435000 -- (-1853.785) (-1845.746) (-1847.305) [-1843.618] * (-1847.884) (-1841.823) [-1842.711] (-1848.152) -- 0:02:09
Average standard deviation of split frequencies: 0.002162
435500 -- (-1856.040) [-1844.417] (-1843.149) (-1845.416) * (-1847.032) [-1841.847] (-1847.441) (-1845.888) -- 0:02:09
436000 -- (-1842.834) (-1843.413) (-1844.993) [-1845.485] * [-1845.512] (-1843.908) (-1844.775) (-1843.617) -- 0:02:10
436500 -- (-1851.919) [-1842.454] (-1846.426) (-1850.902) * (-1843.128) (-1847.834) (-1841.801) [-1843.363] -- 0:02:10
437000 -- [-1848.548] (-1849.488) (-1845.785) (-1848.312) * (-1843.611) [-1842.281] (-1849.074) (-1845.482) -- 0:02:10
437500 -- (-1841.962) (-1844.500) [-1845.443] (-1850.213) * (-1845.326) (-1854.540) (-1849.130) [-1840.426] -- 0:02:09
438000 -- [-1840.999] (-1845.832) (-1842.325) (-1850.943) * (-1843.953) (-1849.849) (-1845.485) [-1841.888] -- 0:02:09
438500 -- (-1845.997) (-1849.801) [-1841.949] (-1847.203) * (-1839.266) (-1851.179) (-1850.735) [-1841.406] -- 0:02:09
439000 -- (-1848.826) (-1849.321) [-1840.833] (-1847.252) * [-1846.103] (-1853.030) (-1844.302) (-1843.033) -- 0:02:09
439500 -- (-1849.554) [-1846.855] (-1848.291) (-1842.238) * [-1842.012] (-1852.817) (-1848.055) (-1841.728) -- 0:02:08
440000 -- (-1848.541) (-1842.605) (-1849.631) [-1845.605] * [-1846.149] (-1862.178) (-1843.109) (-1847.688) -- 0:02:08
Average standard deviation of split frequencies: 0.002140
440500 -- (-1842.602) [-1845.117] (-1845.040) (-1843.761) * [-1843.517] (-1852.522) (-1844.842) (-1840.829) -- 0:02:09
441000 -- (-1849.420) (-1846.567) [-1843.698] (-1846.164) * (-1844.970) (-1860.365) [-1840.126] (-1851.651) -- 0:02:09
441500 -- (-1840.549) [-1840.996] (-1851.126) (-1843.464) * (-1848.620) (-1854.228) [-1838.523] (-1846.584) -- 0:02:09
442000 -- (-1842.451) (-1848.521) [-1848.058] (-1844.276) * [-1847.697] (-1856.748) (-1845.679) (-1847.607) -- 0:02:08
442500 -- [-1843.339] (-1850.800) (-1844.329) (-1845.684) * (-1844.793) (-1849.108) (-1847.056) [-1844.070] -- 0:02:08
443000 -- (-1839.727) (-1855.606) (-1844.322) [-1844.191] * (-1843.643) (-1851.999) (-1845.312) [-1842.510] -- 0:02:08
443500 -- [-1842.478] (-1843.455) (-1844.656) (-1844.344) * (-1847.151) (-1849.072) [-1844.487] (-1851.024) -- 0:02:07
444000 -- [-1852.338] (-1841.763) (-1840.407) (-1850.782) * [-1845.121] (-1855.011) (-1846.630) (-1847.300) -- 0:02:07
444500 -- (-1843.587) (-1847.625) [-1844.312] (-1846.043) * (-1843.724) (-1853.817) [-1843.628] (-1846.654) -- 0:02:08
445000 -- (-1845.524) (-1841.683) (-1845.225) [-1846.299] * (-1843.174) (-1846.062) (-1844.608) [-1840.337] -- 0:02:08
Average standard deviation of split frequencies: 0.002114
445500 -- (-1847.963) (-1849.293) [-1843.541] (-1845.581) * (-1843.850) (-1849.311) [-1849.765] (-1842.989) -- 0:02:08
446000 -- (-1850.021) (-1841.974) [-1842.289] (-1852.244) * (-1841.953) (-1847.861) [-1847.118] (-1841.818) -- 0:02:07
446500 -- (-1846.392) (-1843.089) [-1840.659] (-1850.242) * (-1845.483) [-1840.116] (-1846.641) (-1847.706) -- 0:02:07
447000 -- (-1842.265) (-1844.982) [-1843.197] (-1841.392) * (-1847.357) [-1839.663] (-1847.630) (-1846.466) -- 0:02:07
447500 -- (-1844.412) (-1844.253) (-1846.047) [-1842.594] * (-1842.799) [-1840.912] (-1842.672) (-1848.513) -- 0:02:07
448000 -- (-1842.814) [-1844.270] (-1843.667) (-1843.961) * (-1842.891) [-1842.368] (-1844.450) (-1854.691) -- 0:02:06
448500 -- (-1850.752) [-1844.664] (-1844.522) (-1840.825) * [-1840.976] (-1850.296) (-1849.674) (-1848.633) -- 0:02:06
449000 -- [-1845.081] (-1846.001) (-1840.349) (-1841.630) * (-1843.213) (-1847.845) (-1851.290) [-1843.804] -- 0:02:07
449500 -- (-1843.949) (-1845.950) [-1849.502] (-1842.696) * (-1841.029) (-1843.482) (-1842.025) [-1842.767] -- 0:02:07
450000 -- [-1841.732] (-1840.991) (-1842.056) (-1843.336) * [-1844.403] (-1841.084) (-1842.852) (-1842.452) -- 0:02:07
Average standard deviation of split frequencies: 0.002092
450500 -- [-1846.384] (-1844.366) (-1843.077) (-1842.203) * (-1845.262) (-1839.719) (-1839.918) [-1849.078] -- 0:02:06
451000 -- (-1842.493) (-1850.611) (-1844.741) [-1845.622] * (-1842.837) [-1843.339] (-1845.310) (-1842.186) -- 0:02:06
451500 -- [-1843.186] (-1843.816) (-1842.869) (-1850.454) * (-1846.522) (-1843.132) [-1839.839] (-1844.992) -- 0:02:06
452000 -- (-1844.895) (-1852.201) [-1842.156] (-1845.093) * [-1839.231] (-1840.429) (-1854.866) (-1848.981) -- 0:02:06
452500 -- (-1841.350) (-1847.899) (-1845.763) [-1845.093] * [-1842.579] (-1851.643) (-1844.526) (-1846.495) -- 0:02:05
453000 -- [-1842.723] (-1844.625) (-1839.784) (-1846.357) * [-1850.668] (-1840.882) (-1847.771) (-1847.256) -- 0:02:05
453500 -- [-1846.825] (-1840.620) (-1844.059) (-1848.174) * (-1845.537) (-1852.700) (-1841.321) [-1840.889] -- 0:02:06
454000 -- (-1842.695) (-1846.045) [-1841.389] (-1845.754) * (-1848.187) (-1841.450) (-1846.630) [-1842.047] -- 0:02:06
454500 -- (-1845.075) [-1840.824] (-1840.933) (-1845.458) * (-1844.748) [-1842.915] (-1842.112) (-1841.377) -- 0:02:06
455000 -- (-1848.571) [-1845.058] (-1851.013) (-1843.658) * [-1841.504] (-1849.846) (-1848.671) (-1846.985) -- 0:02:05
Average standard deviation of split frequencies: 0.002068
455500 -- (-1845.141) (-1849.206) [-1842.713] (-1843.678) * (-1842.792) (-1849.784) [-1847.632] (-1843.075) -- 0:02:05
456000 -- [-1844.977] (-1848.009) (-1842.488) (-1841.414) * (-1854.021) (-1847.151) [-1845.370] (-1846.257) -- 0:02:05
456500 -- (-1841.815) (-1844.372) [-1849.337] (-1840.095) * (-1850.261) [-1850.030] (-1851.936) (-1847.932) -- 0:02:05
457000 -- (-1840.828) (-1848.959) (-1846.211) [-1841.922] * (-1847.854) (-1841.155) [-1845.613] (-1849.854) -- 0:02:04
457500 -- [-1842.724] (-1843.264) (-1844.059) (-1841.759) * (-1854.083) [-1850.834] (-1851.404) (-1845.919) -- 0:02:04
458000 -- [-1847.627] (-1842.352) (-1847.716) (-1840.251) * [-1845.061] (-1842.476) (-1844.270) (-1848.845) -- 0:02:05
458500 -- (-1843.494) (-1843.718) (-1841.814) [-1841.304] * (-1846.927) (-1846.453) [-1847.098] (-1846.493) -- 0:02:05
459000 -- (-1848.943) [-1846.414] (-1843.078) (-1846.064) * [-1846.973] (-1842.717) (-1845.269) (-1846.954) -- 0:02:04
459500 -- [-1845.973] (-1846.806) (-1846.901) (-1846.142) * (-1844.163) (-1843.915) [-1839.698] (-1847.221) -- 0:02:04
460000 -- [-1843.387] (-1841.914) (-1841.009) (-1844.741) * (-1843.508) (-1847.489) (-1839.284) [-1842.235] -- 0:02:04
Average standard deviation of split frequencies: 0.002047
460500 -- [-1845.566] (-1839.816) (-1844.913) (-1845.629) * (-1846.160) [-1844.632] (-1846.508) (-1844.483) -- 0:02:04
461000 -- (-1844.174) (-1844.302) (-1845.999) [-1846.347] * [-1843.997] (-1852.450) (-1840.948) (-1843.756) -- 0:02:03
461500 -- (-1839.107) [-1847.349] (-1843.889) (-1847.217) * [-1841.947] (-1845.382) (-1841.166) (-1843.499) -- 0:02:03
462000 -- (-1839.511) [-1838.553] (-1851.176) (-1843.852) * (-1841.586) (-1846.715) [-1854.890] (-1848.728) -- 0:02:04
462500 -- (-1838.399) [-1841.955] (-1846.809) (-1846.725) * (-1846.561) [-1840.153] (-1846.454) (-1848.270) -- 0:02:04
463000 -- (-1854.185) [-1856.110] (-1851.654) (-1848.364) * (-1844.763) (-1847.200) (-1844.405) [-1844.422] -- 0:02:04
463500 -- (-1841.058) (-1842.619) [-1841.247] (-1844.637) * [-1845.186] (-1850.719) (-1846.529) (-1841.888) -- 0:02:03
464000 -- (-1842.355) (-1844.978) [-1843.871] (-1849.058) * [-1840.683] (-1849.040) (-1841.252) (-1842.674) -- 0:02:03
464500 -- [-1849.686] (-1845.917) (-1853.122) (-1845.676) * (-1842.083) (-1845.095) [-1841.789] (-1845.913) -- 0:02:03
465000 -- [-1842.365] (-1844.030) (-1846.626) (-1846.213) * [-1841.557] (-1853.491) (-1844.781) (-1840.660) -- 0:02:03
Average standard deviation of split frequencies: 0.002023
465500 -- (-1843.794) (-1846.669) [-1846.732] (-1844.826) * (-1851.065) [-1842.134] (-1844.807) (-1842.585) -- 0:02:02
466000 -- [-1843.548] (-1845.294) (-1844.815) (-1844.016) * (-1841.456) (-1841.047) [-1842.521] (-1839.349) -- 0:02:02
466500 -- (-1847.191) (-1838.653) [-1840.333] (-1839.784) * (-1851.453) [-1843.399] (-1844.861) (-1851.854) -- 0:02:03
467000 -- (-1851.160) [-1844.773] (-1842.247) (-1842.228) * (-1842.919) (-1842.383) [-1844.332] (-1844.480) -- 0:02:03
467500 -- (-1847.507) (-1851.881) (-1843.392) [-1842.000] * (-1847.005) (-1840.942) [-1843.779] (-1845.678) -- 0:02:03
468000 -- (-1843.457) (-1847.290) (-1851.168) [-1838.297] * [-1842.315] (-1843.619) (-1854.861) (-1844.967) -- 0:02:02
468500 -- (-1851.710) (-1841.755) [-1844.619] (-1843.437) * (-1844.145) (-1842.449) [-1844.377] (-1841.059) -- 0:02:02
469000 -- (-1844.501) (-1840.167) (-1843.031) [-1845.519] * (-1847.595) [-1837.899] (-1841.018) (-1842.369) -- 0:02:02
469500 -- (-1839.052) (-1846.743) [-1842.615] (-1842.952) * (-1840.998) (-1851.123) (-1844.160) [-1843.327] -- 0:02:02
470000 -- (-1843.500) (-1846.587) (-1839.828) [-1842.322] * (-1845.740) (-1854.188) (-1848.540) [-1845.108] -- 0:02:01
Average standard deviation of split frequencies: 0.002003
470500 -- (-1841.446) (-1851.924) (-1839.508) [-1844.373] * (-1845.534) (-1847.331) [-1843.576] (-1840.766) -- 0:02:01
471000 -- (-1848.036) (-1844.482) [-1846.937] (-1852.073) * (-1847.779) (-1848.246) [-1845.503] (-1843.580) -- 0:02:02
471500 -- [-1844.757] (-1842.577) (-1843.673) (-1846.130) * (-1841.321) (-1841.858) [-1841.708] (-1846.135) -- 0:02:02
472000 -- (-1844.661) (-1845.953) [-1844.225] (-1849.242) * (-1846.936) (-1847.233) [-1843.103] (-1843.465) -- 0:02:01
472500 -- (-1844.303) (-1847.704) (-1841.420) [-1838.845] * [-1844.822] (-1848.185) (-1842.442) (-1843.029) -- 0:02:01
473000 -- [-1843.305] (-1845.079) (-1846.248) (-1851.096) * (-1846.305) (-1851.887) (-1851.769) [-1842.504] -- 0:02:01
473500 -- (-1845.642) (-1846.737) [-1844.971] (-1843.728) * (-1843.600) (-1853.839) [-1843.319] (-1837.787) -- 0:02:01
474000 -- (-1844.004) (-1846.910) (-1847.327) [-1844.861] * [-1841.224] (-1839.422) (-1848.555) (-1842.212) -- 0:02:00
474500 -- (-1843.285) (-1847.926) [-1841.271] (-1847.839) * (-1847.062) (-1844.197) (-1847.624) [-1845.779] -- 0:02:00
475000 -- (-1843.168) [-1841.370] (-1839.419) (-1847.169) * (-1837.529) [-1842.549] (-1846.405) (-1840.213) -- 0:02:00
Average standard deviation of split frequencies: 0.001981
475500 -- (-1846.665) (-1844.671) [-1846.025] (-1846.851) * (-1840.095) (-1846.702) (-1845.263) [-1841.831] -- 0:02:01
476000 -- [-1847.910] (-1846.448) (-1848.802) (-1849.386) * (-1845.264) [-1843.067] (-1852.837) (-1847.998) -- 0:02:01
476500 -- (-1847.069) (-1845.264) [-1846.488] (-1845.249) * [-1846.261] (-1840.452) (-1847.132) (-1839.342) -- 0:02:00
477000 -- (-1849.634) (-1842.147) (-1843.350) [-1844.735] * (-1849.235) [-1840.948] (-1839.408) (-1841.042) -- 0:02:00
477500 -- [-1843.446] (-1846.846) (-1847.409) (-1843.808) * (-1846.419) (-1844.463) [-1845.670] (-1844.446) -- 0:02:00
478000 -- (-1844.095) (-1838.555) [-1845.967] (-1846.928) * (-1856.094) (-1849.075) [-1843.034] (-1853.826) -- 0:02:00
478500 -- (-1838.379) (-1846.197) (-1844.913) [-1843.611] * [-1848.601] (-1850.036) (-1844.996) (-1840.091) -- 0:01:59
479000 -- (-1848.106) [-1841.648] (-1843.348) (-1844.496) * (-1846.680) (-1848.229) (-1846.460) [-1843.905] -- 0:01:59
479500 -- [-1845.883] (-1845.335) (-1850.158) (-1848.088) * (-1848.304) (-1845.291) (-1851.183) [-1846.604] -- 0:02:00
480000 -- [-1840.035] (-1844.837) (-1845.284) (-1844.693) * (-1843.419) (-1847.216) (-1850.724) [-1844.102] -- 0:02:00
Average standard deviation of split frequencies: 0.001471
480500 -- (-1841.380) (-1845.087) (-1843.326) [-1842.423] * (-1852.264) [-1845.107] (-1843.736) (-1845.556) -- 0:02:00
481000 -- (-1845.205) (-1850.109) [-1842.524] (-1841.456) * [-1844.137] (-1841.417) (-1840.992) (-1842.041) -- 0:01:59
481500 -- (-1837.919) (-1850.778) [-1841.919] (-1844.737) * (-1843.713) (-1844.449) (-1848.000) [-1846.515] -- 0:01:59
482000 -- (-1842.673) (-1847.658) (-1838.869) [-1844.385] * (-1844.984) [-1842.000] (-1851.330) (-1844.542) -- 0:01:59
482500 -- (-1847.165) (-1842.197) (-1839.762) [-1839.841] * (-1850.027) (-1846.695) (-1844.925) [-1847.353] -- 0:01:59
483000 -- (-1849.454) (-1845.156) [-1843.527] (-1840.478) * [-1844.039] (-1857.264) (-1842.648) (-1843.914) -- 0:01:58
483500 -- [-1841.855] (-1842.211) (-1840.063) (-1850.972) * (-1842.850) [-1844.403] (-1845.623) (-1846.712) -- 0:01:58
484000 -- (-1847.240) (-1842.014) [-1843.871] (-1843.965) * [-1846.583] (-1848.945) (-1837.977) (-1844.941) -- 0:01:59
484500 -- (-1841.851) (-1845.841) (-1844.039) [-1846.950] * (-1843.916) (-1847.483) (-1850.523) [-1843.799] -- 0:01:59
485000 -- (-1843.474) [-1844.262] (-1847.592) (-1848.106) * (-1840.489) (-1842.932) (-1850.827) [-1839.813] -- 0:01:58
Average standard deviation of split frequencies: 0.001455
485500 -- (-1851.618) (-1850.356) [-1842.418] (-1847.956) * (-1840.428) [-1846.039] (-1846.066) (-1848.043) -- 0:01:58
486000 -- (-1842.016) (-1853.455) (-1842.357) [-1840.427] * (-1844.342) [-1842.549] (-1844.798) (-1843.581) -- 0:01:58
486500 -- (-1843.801) [-1842.891] (-1847.802) (-1841.661) * (-1853.545) (-1853.868) [-1841.496] (-1839.513) -- 0:01:58
487000 -- (-1841.488) [-1843.324] (-1842.616) (-1841.985) * (-1842.599) (-1846.851) (-1851.512) [-1839.070] -- 0:01:57
487500 -- (-1844.902) [-1844.628] (-1848.129) (-1842.683) * (-1847.994) (-1843.731) (-1846.303) [-1841.052] -- 0:01:57
488000 -- (-1844.717) [-1842.193] (-1849.570) (-1843.056) * (-1845.442) [-1842.740] (-1848.359) (-1841.759) -- 0:01:57
488500 -- [-1843.980] (-1845.310) (-1844.784) (-1843.923) * (-1852.646) (-1846.819) (-1847.664) [-1841.452] -- 0:01:58
489000 -- (-1840.689) (-1841.732) [-1842.951] (-1840.880) * (-1851.448) (-1844.701) [-1845.776] (-1842.615) -- 0:01:58
489500 -- [-1841.627] (-1839.095) (-1846.905) (-1849.234) * (-1846.942) (-1840.943) (-1844.432) [-1842.007] -- 0:01:57
490000 -- [-1842.365] (-1840.833) (-1844.513) (-1850.458) * (-1845.903) (-1845.805) (-1844.050) [-1847.747] -- 0:01:57
Average standard deviation of split frequencies: 0.001441
490500 -- [-1843.422] (-1848.015) (-1839.909) (-1848.977) * (-1847.744) [-1841.810] (-1845.351) (-1844.139) -- 0:01:57
491000 -- [-1844.109] (-1841.202) (-1850.898) (-1843.749) * [-1841.226] (-1843.532) (-1843.661) (-1845.349) -- 0:01:57
491500 -- (-1849.442) (-1847.610) [-1845.083] (-1846.992) * (-1842.252) [-1844.804] (-1839.161) (-1841.522) -- 0:01:56
492000 -- (-1846.344) [-1842.274] (-1850.106) (-1840.996) * (-1845.957) (-1853.618) [-1842.620] (-1842.625) -- 0:01:56
492500 -- (-1852.395) [-1844.381] (-1845.637) (-1841.933) * (-1840.878) (-1849.468) [-1846.144] (-1844.209) -- 0:01:56
493000 -- (-1848.383) (-1848.144) (-1855.247) [-1843.717] * (-1841.443) (-1841.001) [-1845.650] (-1844.633) -- 0:01:57
493500 -- [-1841.079] (-1845.703) (-1846.743) (-1842.417) * (-1840.258) (-1844.467) [-1842.910] (-1846.511) -- 0:01:57
494000 -- (-1843.442) (-1851.463) [-1845.201] (-1839.691) * (-1842.863) (-1852.009) [-1843.637] (-1845.722) -- 0:01:56
494500 -- (-1841.411) (-1843.618) (-1844.994) [-1845.962] * [-1843.718] (-1848.371) (-1848.070) (-1847.747) -- 0:01:56
495000 -- (-1844.219) (-1845.670) (-1848.741) [-1845.125] * (-1842.017) (-1842.816) [-1846.225] (-1845.328) -- 0:01:56
Average standard deviation of split frequencies: 0.001426
495500 -- (-1852.577) (-1846.260) (-1840.392) [-1840.253] * (-1850.043) [-1842.112] (-1841.297) (-1844.836) -- 0:01:56
496000 -- (-1844.498) (-1842.422) [-1844.198] (-1842.545) * (-1848.337) (-1843.386) [-1841.426] (-1849.052) -- 0:01:55
496500 -- (-1848.757) [-1843.522] (-1842.597) (-1839.469) * (-1845.602) (-1843.615) (-1845.578) [-1847.168] -- 0:01:55
497000 -- (-1845.449) (-1841.011) (-1845.291) [-1849.272] * (-1843.480) (-1843.826) (-1839.994) [-1847.159] -- 0:01:55
497500 -- (-1844.659) (-1842.958) [-1842.112] (-1845.756) * (-1842.624) [-1844.671] (-1843.588) (-1845.405) -- 0:01:56
498000 -- (-1842.767) (-1843.917) (-1846.195) [-1845.959] * (-1846.326) [-1841.153] (-1839.643) (-1845.198) -- 0:01:55
498500 -- (-1847.992) (-1846.876) [-1842.308] (-1841.238) * (-1847.130) (-1844.672) [-1842.982] (-1854.591) -- 0:01:55
499000 -- (-1848.294) [-1845.302] (-1847.711) (-1844.162) * (-1850.471) [-1841.742] (-1845.359) (-1848.901) -- 0:01:55
499500 -- [-1845.776] (-1855.484) (-1849.280) (-1845.107) * (-1848.531) (-1847.947) [-1839.208] (-1846.352) -- 0:01:55
500000 -- (-1844.335) (-1847.855) [-1843.839] (-1841.621) * [-1850.523] (-1842.812) (-1848.380) (-1845.546) -- 0:01:55
Average standard deviation of split frequencies: 0.001412
500500 -- [-1839.198] (-1843.468) (-1842.831) (-1852.535) * (-1847.780) [-1840.240] (-1843.734) (-1845.464) -- 0:01:54
501000 -- (-1848.250) (-1849.366) (-1845.505) [-1846.415] * (-1843.852) (-1843.755) [-1839.111] (-1843.280) -- 0:01:54
501500 -- (-1845.978) (-1855.515) (-1859.826) [-1849.405] * (-1846.041) [-1845.167] (-1844.818) (-1847.574) -- 0:01:55
502000 -- (-1843.572) [-1844.422] (-1841.361) (-1842.849) * (-1844.330) (-1850.190) (-1846.775) [-1842.329] -- 0:01:55
502500 -- (-1850.288) (-1849.577) (-1845.158) [-1841.481] * [-1841.798] (-1848.185) (-1847.625) (-1844.060) -- 0:01:54
503000 -- (-1850.785) (-1846.337) (-1851.871) [-1847.090] * (-1852.769) [-1841.251] (-1849.061) (-1853.268) -- 0:01:54
503500 -- (-1846.761) (-1842.864) [-1845.398] (-1842.562) * (-1855.014) (-1847.501) [-1842.689] (-1846.240) -- 0:01:54
504000 -- (-1844.695) [-1847.475] (-1849.156) (-1857.221) * (-1843.945) [-1847.453] (-1848.305) (-1840.459) -- 0:01:54
504500 -- (-1852.617) [-1845.721] (-1844.576) (-1850.557) * [-1845.120] (-1849.833) (-1846.604) (-1843.872) -- 0:01:53
505000 -- (-1851.357) [-1841.688] (-1847.812) (-1854.906) * (-1843.854) [-1842.292] (-1850.697) (-1844.282) -- 0:01:53
Average standard deviation of split frequencies: 0.001397
505500 -- (-1848.754) (-1846.900) [-1843.895] (-1851.454) * (-1844.265) [-1842.650] (-1843.408) (-1845.192) -- 0:01:53
506000 -- [-1849.354] (-1847.109) (-1843.317) (-1845.531) * [-1842.394] (-1846.752) (-1845.365) (-1847.300) -- 0:01:54
506500 -- (-1846.947) [-1848.495] (-1850.003) (-1841.729) * (-1840.616) [-1839.894] (-1844.894) (-1843.359) -- 0:01:53
507000 -- (-1842.258) (-1843.450) (-1847.835) [-1840.509] * [-1841.331] (-1844.574) (-1846.973) (-1844.130) -- 0:01:53
507500 -- [-1847.228] (-1841.327) (-1845.790) (-1846.365) * (-1846.279) [-1843.073] (-1844.143) (-1843.135) -- 0:01:53
508000 -- (-1848.594) (-1840.244) [-1846.623] (-1843.039) * (-1843.157) [-1840.661] (-1850.010) (-1841.964) -- 0:01:53
508500 -- [-1842.911] (-1840.898) (-1854.628) (-1842.248) * [-1850.882] (-1836.658) (-1846.424) (-1844.575) -- 0:01:53
509000 -- (-1854.482) (-1845.207) [-1841.210] (-1839.926) * (-1848.080) (-1842.573) [-1844.676] (-1846.781) -- 0:01:52
509500 -- (-1845.733) (-1850.592) [-1845.294] (-1841.698) * (-1850.469) (-1842.223) [-1844.178] (-1842.766) -- 0:01:52
510000 -- [-1842.671] (-1844.688) (-1847.166) (-1839.077) * [-1841.025] (-1843.869) (-1843.819) (-1846.145) -- 0:01:52
Average standard deviation of split frequencies: 0.001385
510500 -- (-1848.554) [-1845.961] (-1851.540) (-1843.943) * (-1848.304) (-1845.554) [-1844.024] (-1845.711) -- 0:01:53
511000 -- [-1847.091] (-1844.716) (-1839.414) (-1848.576) * [-1851.548] (-1846.305) (-1844.015) (-1842.060) -- 0:01:52
511500 -- (-1844.772) (-1847.339) (-1846.747) [-1845.708] * [-1843.487] (-1843.306) (-1846.975) (-1842.268) -- 0:01:52
512000 -- (-1854.630) (-1856.013) (-1845.836) [-1845.615] * (-1844.415) [-1841.894] (-1840.099) (-1846.926) -- 0:01:52
512500 -- (-1848.359) (-1841.579) [-1841.554] (-1843.715) * [-1842.591] (-1848.830) (-1838.495) (-1840.734) -- 0:01:52
513000 -- (-1844.947) (-1844.967) [-1840.692] (-1845.259) * (-1849.911) (-1847.633) (-1848.337) [-1844.763] -- 0:01:52
513500 -- (-1846.816) (-1841.668) (-1843.543) [-1839.836] * (-1846.775) [-1845.199] (-1844.614) (-1847.623) -- 0:01:51
514000 -- (-1848.615) (-1842.906) (-1842.578) [-1842.727] * [-1847.370] (-1844.337) (-1842.555) (-1840.166) -- 0:01:51
514500 -- (-1840.299) (-1842.973) [-1840.011] (-1843.938) * (-1845.757) [-1838.999] (-1842.447) (-1841.722) -- 0:01:52
515000 -- (-1840.713) (-1847.549) [-1843.786] (-1848.394) * [-1843.610] (-1839.849) (-1850.257) (-1855.348) -- 0:01:52
Average standard deviation of split frequencies: 0.001370
515500 -- [-1843.283] (-1847.466) (-1852.581) (-1842.361) * (-1842.913) [-1841.718] (-1849.848) (-1843.564) -- 0:01:51
516000 -- (-1843.697) (-1847.711) (-1842.902) [-1844.734] * (-1844.472) (-1841.809) [-1841.807] (-1842.973) -- 0:01:51
516500 -- [-1847.867] (-1840.841) (-1842.919) (-1843.155) * (-1845.007) (-1844.757) [-1841.627] (-1839.336) -- 0:01:51
517000 -- (-1850.347) [-1842.632] (-1841.675) (-1846.352) * (-1844.699) (-1840.778) [-1840.668] (-1841.966) -- 0:01:51
517500 -- (-1842.999) (-1843.544) [-1844.910] (-1854.703) * [-1845.317] (-1848.645) (-1842.677) (-1849.038) -- 0:01:50
518000 -- (-1847.079) (-1844.765) (-1843.319) [-1846.409] * (-1841.965) (-1845.869) (-1844.434) [-1841.950] -- 0:01:50
518500 -- [-1846.803] (-1852.530) (-1848.172) (-1850.845) * (-1841.270) (-1844.451) [-1847.519] (-1839.291) -- 0:01:50
519000 -- (-1845.023) (-1850.370) (-1848.701) [-1842.967] * (-1840.518) (-1847.685) [-1843.623] (-1850.361) -- 0:01:51
519500 -- (-1845.125) [-1844.700] (-1843.215) (-1851.367) * (-1844.072) [-1840.612] (-1841.707) (-1845.437) -- 0:01:50
520000 -- (-1845.469) [-1848.960] (-1842.590) (-1845.515) * (-1850.467) (-1845.703) [-1844.188] (-1844.395) -- 0:01:50
Average standard deviation of split frequencies: 0.001358
520500 -- [-1845.986] (-1849.579) (-1841.529) (-1841.969) * (-1848.530) (-1848.229) (-1840.505) [-1846.511] -- 0:01:50
521000 -- [-1845.534] (-1848.289) (-1852.995) (-1845.969) * (-1858.198) (-1839.830) (-1840.844) [-1842.013] -- 0:01:50
521500 -- (-1857.683) [-1844.812] (-1837.642) (-1840.654) * (-1849.041) (-1841.914) [-1843.820] (-1841.351) -- 0:01:50
522000 -- (-1848.288) (-1851.033) (-1853.720) [-1847.320] * (-1844.374) (-1843.985) (-1841.766) [-1843.120] -- 0:01:49
522500 -- (-1839.564) (-1848.913) (-1851.130) [-1842.869] * (-1843.430) (-1843.987) [-1844.957] (-1840.917) -- 0:01:49
523000 -- (-1845.907) (-1849.307) (-1840.362) [-1843.091] * (-1848.209) (-1843.555) (-1841.572) [-1848.766] -- 0:01:49
523500 -- (-1844.156) (-1850.585) (-1844.601) [-1845.138] * (-1843.977) [-1841.230] (-1849.069) (-1843.831) -- 0:01:50
524000 -- (-1841.845) (-1854.319) [-1847.864] (-1842.575) * (-1841.141) (-1847.986) (-1842.164) [-1847.644] -- 0:01:49
524500 -- (-1844.267) [-1844.231] (-1844.051) (-1840.947) * (-1843.438) [-1844.663] (-1845.045) (-1846.989) -- 0:01:49
525000 -- [-1845.486] (-1842.344) (-1844.400) (-1843.632) * [-1841.161] (-1844.217) (-1844.342) (-1845.012) -- 0:01:49
Average standard deviation of split frequencies: 0.001344
525500 -- (-1845.368) [-1844.565] (-1842.005) (-1842.094) * (-1839.564) (-1839.737) (-1843.247) [-1844.835] -- 0:01:49
526000 -- (-1845.739) [-1837.621] (-1846.657) (-1843.032) * (-1844.350) (-1841.604) (-1843.847) [-1847.394] -- 0:01:49
526500 -- (-1846.664) [-1844.950] (-1849.867) (-1842.639) * [-1847.826] (-1845.664) (-1842.294) (-1848.532) -- 0:01:48
527000 -- (-1842.241) (-1844.228) (-1850.465) [-1841.035] * (-1842.412) (-1842.242) [-1842.040] (-1843.052) -- 0:01:48
527500 -- (-1846.708) [-1843.922] (-1865.388) (-1839.871) * [-1841.241] (-1839.415) (-1843.385) (-1842.513) -- 0:01:48
528000 -- (-1852.776) (-1842.118) (-1858.783) [-1844.118] * (-1847.567) (-1846.329) (-1841.145) [-1844.159] -- 0:01:49
528500 -- (-1841.505) [-1846.819] (-1852.396) (-1843.310) * (-1847.232) (-1840.620) (-1846.420) [-1842.978] -- 0:01:48
529000 -- (-1849.022) (-1845.460) (-1845.453) [-1846.236] * (-1847.783) (-1844.259) [-1839.972] (-1842.582) -- 0:01:48
529500 -- (-1847.364) [-1847.482] (-1843.439) (-1845.376) * (-1843.751) [-1842.937] (-1842.596) (-1842.731) -- 0:01:48
530000 -- (-1849.478) (-1841.427) (-1845.536) [-1841.793] * (-1842.223) (-1847.613) [-1839.179] (-1843.399) -- 0:01:48
Average standard deviation of split frequencies: 0.001332
530500 -- (-1845.169) (-1847.158) [-1842.783] (-1845.758) * (-1843.348) (-1850.333) (-1844.970) [-1843.724] -- 0:01:47
531000 -- (-1845.978) [-1838.810] (-1840.279) (-1853.176) * (-1848.108) (-1843.976) (-1841.845) [-1842.553] -- 0:01:47
531500 -- [-1842.427] (-1842.425) (-1846.063) (-1852.729) * (-1845.620) (-1846.547) (-1843.258) [-1843.375] -- 0:01:47
532000 -- (-1847.856) (-1847.595) (-1842.224) [-1844.152] * (-1854.666) [-1841.214] (-1848.296) (-1844.441) -- 0:01:48
532500 -- (-1844.803) (-1840.875) (-1848.489) [-1841.820] * (-1847.053) (-1850.306) (-1839.183) [-1839.147] -- 0:01:47
533000 -- (-1848.064) (-1841.394) (-1843.724) [-1841.479] * (-1848.042) [-1844.638] (-1849.644) (-1841.702) -- 0:01:47
533500 -- [-1838.719] (-1843.869) (-1844.006) (-1843.405) * (-1843.229) (-1842.028) (-1841.779) [-1843.313] -- 0:01:47
534000 -- (-1842.213) (-1850.828) [-1854.389] (-1850.892) * [-1841.486] (-1842.382) (-1841.904) (-1847.820) -- 0:01:47
534500 -- (-1846.347) (-1845.040) [-1841.289] (-1844.315) * (-1840.698) (-1848.156) [-1841.580] (-1853.266) -- 0:01:47
535000 -- (-1843.085) (-1850.866) (-1846.069) [-1841.291] * [-1845.046] (-1841.721) (-1843.725) (-1845.478) -- 0:01:46
Average standard deviation of split frequencies: 0.001319
535500 -- [-1841.421] (-1845.167) (-1843.804) (-1847.328) * (-1846.778) [-1839.809] (-1844.391) (-1850.039) -- 0:01:46
536000 -- (-1846.687) (-1853.298) [-1841.618] (-1850.437) * [-1841.747] (-1847.925) (-1848.759) (-1847.766) -- 0:01:46
536500 -- (-1840.022) (-1847.825) [-1842.894] (-1848.458) * (-1846.863) (-1843.189) (-1849.600) [-1838.374] -- 0:01:47
537000 -- (-1839.279) (-1846.518) [-1843.117] (-1841.005) * (-1854.326) [-1844.519] (-1844.465) (-1839.517) -- 0:01:46
537500 -- [-1842.703] (-1841.423) (-1841.763) (-1849.960) * (-1844.454) [-1842.329] (-1845.267) (-1844.477) -- 0:01:46
538000 -- (-1845.036) (-1842.237) [-1842.169] (-1858.906) * (-1843.641) [-1843.335] (-1842.530) (-1847.924) -- 0:01:46
538500 -- (-1842.852) (-1841.465) [-1847.534] (-1844.908) * [-1851.624] (-1852.004) (-1841.081) (-1849.622) -- 0:01:46
539000 -- (-1844.557) (-1847.675) [-1842.607] (-1846.042) * (-1843.595) (-1852.538) (-1845.867) [-1843.344] -- 0:01:46
539500 -- [-1846.148] (-1844.740) (-1851.604) (-1848.134) * [-1840.124] (-1846.520) (-1849.758) (-1841.699) -- 0:01:45
540000 -- (-1844.069) (-1845.372) [-1847.939] (-1844.128) * (-1848.165) (-1847.337) [-1843.898] (-1847.532) -- 0:01:45
Average standard deviation of split frequencies: 0.001308
540500 -- (-1844.135) [-1842.537] (-1851.376) (-1845.354) * [-1845.455] (-1845.550) (-1847.230) (-1853.460) -- 0:01:45
541000 -- (-1844.784) [-1843.501] (-1850.542) (-1843.527) * [-1841.200] (-1842.645) (-1842.381) (-1853.209) -- 0:01:46
541500 -- (-1843.424) [-1849.278] (-1844.502) (-1844.448) * (-1850.359) (-1842.119) [-1842.803] (-1842.422) -- 0:01:45
542000 -- (-1844.573) (-1844.343) (-1843.381) [-1841.349] * [-1849.713] (-1853.165) (-1839.398) (-1843.355) -- 0:01:45
542500 -- [-1847.090] (-1842.790) (-1840.903) (-1842.329) * (-1843.449) (-1847.771) (-1845.846) [-1841.472] -- 0:01:45
543000 -- [-1846.595] (-1845.784) (-1847.506) (-1853.833) * (-1847.759) (-1841.477) [-1844.204] (-1846.554) -- 0:01:45
543500 -- (-1848.965) [-1846.939] (-1844.629) (-1845.020) * (-1843.230) [-1846.339] (-1843.859) (-1845.365) -- 0:01:44
544000 -- (-1845.238) (-1844.065) (-1843.964) [-1839.136] * (-1843.207) [-1837.900] (-1849.547) (-1843.866) -- 0:01:44
544500 -- [-1841.072] (-1845.457) (-1842.378) (-1843.764) * (-1848.424) (-1844.357) (-1852.687) [-1845.888] -- 0:01:44
545000 -- (-1845.291) (-1851.310) (-1839.857) [-1843.828] * [-1844.621] (-1840.340) (-1847.279) (-1840.606) -- 0:01:45
Average standard deviation of split frequencies: 0.001295
545500 -- (-1842.890) [-1842.737] (-1841.999) (-1842.833) * (-1844.623) (-1845.907) (-1847.964) [-1839.231] -- 0:01:44
546000 -- [-1849.809] (-1841.500) (-1850.718) (-1840.298) * (-1852.936) (-1848.036) (-1843.446) [-1841.913] -- 0:01:44
546500 -- (-1847.106) (-1844.517) (-1841.776) [-1848.330] * (-1843.248) (-1846.104) [-1838.954] (-1844.796) -- 0:01:44
547000 -- [-1850.471] (-1845.556) (-1845.871) (-1840.833) * (-1842.656) (-1844.300) (-1849.926) [-1843.236] -- 0:01:44
547500 -- [-1844.383] (-1850.570) (-1841.404) (-1847.926) * (-1850.093) (-1841.787) [-1841.871] (-1847.326) -- 0:01:44
548000 -- (-1849.237) [-1842.607] (-1845.131) (-1838.386) * (-1848.020) (-1849.377) (-1843.609) [-1838.413] -- 0:01:43
548500 -- (-1845.395) [-1839.782] (-1848.706) (-1842.942) * [-1849.768] (-1849.421) (-1844.832) (-1842.598) -- 0:01:43
549000 -- [-1843.712] (-1841.984) (-1839.505) (-1843.244) * (-1846.232) (-1844.485) (-1843.130) [-1843.271] -- 0:01:43
549500 -- (-1848.733) (-1841.457) (-1843.095) [-1840.299] * (-1845.010) (-1846.785) (-1843.886) [-1844.690] -- 0:01:44
550000 -- (-1839.430) (-1847.049) (-1843.008) [-1842.563] * (-1844.413) [-1842.360] (-1840.760) (-1843.218) -- 0:01:43
Average standard deviation of split frequencies: 0.001712
550500 -- (-1846.625) [-1839.395] (-1840.335) (-1844.285) * (-1846.908) [-1842.223] (-1841.474) (-1848.107) -- 0:01:43
551000 -- (-1845.000) (-1842.293) [-1842.376] (-1844.701) * (-1845.779) [-1840.016] (-1840.088) (-1841.643) -- 0:01:43
551500 -- (-1844.908) [-1839.287] (-1840.337) (-1840.064) * (-1846.000) (-1846.801) [-1842.383] (-1842.046) -- 0:01:43
552000 -- (-1840.837) [-1848.773] (-1844.407) (-1843.668) * [-1841.703] (-1842.657) (-1850.493) (-1843.973) -- 0:01:43
552500 -- (-1842.662) (-1849.471) [-1843.788] (-1848.605) * (-1841.988) (-1850.598) (-1859.487) [-1840.960] -- 0:01:42
553000 -- [-1839.870] (-1846.158) (-1846.845) (-1849.881) * (-1850.783) (-1846.194) (-1857.369) [-1848.439] -- 0:01:42
553500 -- (-1844.488) (-1843.472) (-1843.691) [-1849.708] * [-1845.438] (-1841.507) (-1850.422) (-1848.331) -- 0:01:42
554000 -- [-1843.941] (-1843.654) (-1849.656) (-1845.990) * (-1846.921) (-1840.309) (-1855.657) [-1846.124] -- 0:01:43
554500 -- (-1846.994) (-1847.208) [-1847.684] (-1845.156) * (-1842.914) [-1840.277] (-1846.318) (-1840.917) -- 0:01:42
555000 -- [-1841.138] (-1847.716) (-1843.550) (-1844.467) * (-1844.758) (-1850.969) (-1849.504) [-1838.886] -- 0:01:42
Average standard deviation of split frequencies: 0.001696
555500 -- (-1842.532) [-1841.867] (-1844.166) (-1848.843) * (-1847.258) (-1844.169) (-1846.874) [-1842.479] -- 0:01:42
556000 -- (-1844.165) (-1849.600) (-1844.061) [-1846.566] * (-1846.635) [-1843.564] (-1847.373) (-1848.290) -- 0:01:42
556500 -- (-1847.157) [-1844.670] (-1843.095) (-1845.589) * [-1839.909] (-1842.544) (-1851.637) (-1842.076) -- 0:01:42
557000 -- (-1843.761) (-1846.224) [-1840.888] (-1848.121) * (-1849.232) (-1849.456) [-1843.343] (-1840.577) -- 0:01:41
557500 -- (-1849.967) (-1850.398) [-1846.361] (-1848.107) * (-1850.828) (-1842.098) [-1844.638] (-1840.160) -- 0:01:41
558000 -- (-1844.441) [-1845.859] (-1842.976) (-1845.479) * (-1846.869) (-1843.386) (-1847.251) [-1844.931] -- 0:01:42
558500 -- (-1843.518) (-1847.923) (-1841.863) [-1840.100] * (-1852.497) [-1840.389] (-1844.104) (-1844.203) -- 0:01:41
559000 -- (-1840.676) (-1845.867) [-1844.959] (-1850.915) * [-1844.177] (-1842.354) (-1850.297) (-1859.235) -- 0:01:41
559500 -- (-1844.146) (-1843.388) [-1847.120] (-1842.609) * (-1843.386) (-1837.219) (-1846.902) [-1845.153] -- 0:01:41
560000 -- (-1845.147) (-1842.181) [-1842.176] (-1842.380) * (-1846.331) (-1843.909) (-1841.474) [-1846.013] -- 0:01:41
Average standard deviation of split frequencies: 0.001682
560500 -- (-1845.536) (-1849.648) (-1848.169) [-1844.880] * [-1843.460] (-1846.695) (-1844.763) (-1840.448) -- 0:01:41
561000 -- (-1849.095) (-1844.849) [-1841.758] (-1842.035) * (-1847.551) [-1837.884] (-1846.285) (-1841.153) -- 0:01:40
561500 -- (-1847.709) [-1844.492] (-1842.527) (-1843.893) * [-1844.104] (-1843.048) (-1847.398) (-1843.439) -- 0:01:40
562000 -- [-1846.483] (-1842.735) (-1842.752) (-1847.337) * (-1842.874) [-1843.824] (-1846.367) (-1848.288) -- 0:01:40
562500 -- (-1847.595) (-1847.951) (-1842.621) [-1844.698] * [-1842.758] (-1841.435) (-1851.882) (-1839.604) -- 0:01:41
563000 -- (-1845.870) (-1844.756) (-1846.234) [-1846.833] * [-1843.142] (-1842.795) (-1858.498) (-1847.508) -- 0:01:40
563500 -- (-1845.169) (-1853.784) (-1847.618) [-1843.372] * (-1845.632) (-1842.516) (-1855.482) [-1843.764] -- 0:01:40
564000 -- [-1845.974] (-1842.235) (-1842.040) (-1844.075) * (-1843.630) (-1845.690) (-1854.560) [-1844.538] -- 0:01:40
564500 -- (-1845.457) (-1841.328) (-1843.318) [-1841.987] * [-1841.202] (-1848.544) (-1851.531) (-1842.615) -- 0:01:40
565000 -- (-1844.163) (-1844.593) [-1843.776] (-1842.960) * (-1855.181) (-1838.565) (-1847.974) [-1842.294] -- 0:01:40
Average standard deviation of split frequencies: 0.001666
565500 -- (-1850.490) (-1841.289) (-1841.570) [-1843.802] * (-1837.304) [-1843.002] (-1844.269) (-1851.837) -- 0:01:39
566000 -- (-1844.905) (-1839.494) (-1845.293) [-1841.439] * (-1841.911) (-1842.377) [-1842.567] (-1849.379) -- 0:01:39
566500 -- (-1846.250) [-1849.057] (-1841.277) (-1844.339) * (-1846.636) [-1845.395] (-1852.917) (-1845.678) -- 0:01:39
567000 -- (-1838.154) (-1843.022) (-1843.716) [-1843.962] * (-1843.866) [-1846.799] (-1844.785) (-1845.039) -- 0:01:40
567500 -- [-1845.403] (-1848.648) (-1843.391) (-1842.198) * (-1844.914) (-1845.691) [-1841.398] (-1849.786) -- 0:01:39
568000 -- (-1845.595) (-1842.752) [-1842.788] (-1845.876) * [-1841.462] (-1845.626) (-1845.014) (-1846.835) -- 0:01:39
568500 -- [-1838.799] (-1840.384) (-1852.579) (-1849.019) * (-1839.497) (-1849.120) (-1851.740) [-1841.015] -- 0:01:39
569000 -- (-1844.707) (-1844.288) (-1855.126) [-1848.756] * (-1842.256) [-1844.532] (-1847.151) (-1843.758) -- 0:01:39
569500 -- (-1843.163) (-1848.157) (-1842.670) [-1843.512] * (-1842.746) [-1845.612] (-1847.312) (-1841.841) -- 0:01:39
570000 -- (-1848.329) (-1853.929) [-1841.865] (-1846.145) * (-1844.297) (-1841.045) [-1845.725] (-1844.136) -- 0:01:38
Average standard deviation of split frequencies: 0.001652
570500 -- (-1851.710) (-1852.809) [-1848.952] (-1844.215) * (-1844.782) [-1842.205] (-1852.235) (-1847.419) -- 0:01:38
571000 -- [-1844.658] (-1848.187) (-1851.768) (-1846.361) * [-1846.139] (-1840.985) (-1852.340) (-1848.787) -- 0:01:38
571500 -- (-1844.861) (-1848.336) [-1841.534] (-1848.468) * (-1846.812) (-1842.382) (-1847.510) [-1844.298] -- 0:01:38
572000 -- (-1846.626) [-1842.382] (-1846.064) (-1842.416) * (-1849.920) (-1848.820) (-1847.284) [-1844.534] -- 0:01:38
572500 -- [-1845.267] (-1845.318) (-1850.493) (-1848.400) * (-1851.799) (-1844.794) [-1851.740] (-1844.720) -- 0:01:38
573000 -- (-1840.664) (-1847.081) (-1844.198) [-1841.656] * (-1845.870) (-1844.846) [-1840.492] (-1842.067) -- 0:01:38
573500 -- (-1845.601) [-1848.346] (-1843.602) (-1841.737) * (-1842.176) (-1841.754) [-1845.227] (-1841.204) -- 0:01:38
574000 -- (-1846.250) (-1842.466) (-1843.596) [-1837.483] * (-1845.079) [-1839.609] (-1843.438) (-1845.367) -- 0:01:37
574500 -- [-1843.214] (-1845.333) (-1850.307) (-1840.556) * [-1842.352] (-1840.009) (-1846.937) (-1845.858) -- 0:01:37
575000 -- [-1838.280] (-1847.230) (-1856.931) (-1844.575) * (-1839.898) [-1845.039] (-1841.210) (-1847.834) -- 0:01:37
Average standard deviation of split frequencies: 0.001637
575500 -- (-1853.731) (-1843.467) [-1843.642] (-1846.510) * [-1844.604] (-1844.147) (-1847.538) (-1845.894) -- 0:01:38
576000 -- (-1844.625) (-1837.702) [-1838.804] (-1842.760) * [-1847.211] (-1852.666) (-1842.834) (-1840.633) -- 0:01:37
576500 -- (-1842.991) [-1842.504] (-1844.375) (-1846.574) * (-1847.218) (-1842.074) [-1843.969] (-1848.456) -- 0:01:37
577000 -- (-1841.752) (-1847.093) (-1844.097) [-1840.334] * (-1843.662) (-1845.552) [-1843.281] (-1845.317) -- 0:01:37
577500 -- (-1841.409) (-1841.520) (-1851.428) [-1841.296] * (-1849.898) (-1847.389) [-1839.612] (-1843.959) -- 0:01:37
578000 -- (-1841.243) [-1841.117] (-1845.028) (-1842.575) * (-1842.204) (-1846.265) (-1840.692) [-1840.577] -- 0:01:37
578500 -- (-1846.278) [-1844.124] (-1842.917) (-1838.773) * [-1844.444] (-1855.189) (-1845.637) (-1842.535) -- 0:01:36
579000 -- [-1844.987] (-1845.234) (-1842.687) (-1850.829) * (-1847.716) (-1847.289) [-1842.892] (-1841.307) -- 0:01:36
579500 -- (-1847.415) (-1842.983) (-1843.434) [-1846.630] * (-1844.169) [-1845.495] (-1838.880) (-1843.118) -- 0:01:36
580000 -- (-1850.142) (-1843.543) [-1841.922] (-1844.842) * (-1852.811) [-1846.111] (-1842.290) (-1846.414) -- 0:01:37
Average standard deviation of split frequencies: 0.001624
580500 -- (-1839.422) (-1844.862) (-1851.238) [-1844.122] * [-1844.570] (-1845.237) (-1844.675) (-1851.857) -- 0:01:36
581000 -- (-1843.991) (-1846.114) [-1844.917] (-1839.436) * (-1847.506) (-1852.996) [-1840.043] (-1839.810) -- 0:01:36
581500 -- (-1846.998) (-1849.182) (-1846.735) [-1844.787] * (-1840.991) (-1851.478) [-1841.674] (-1845.535) -- 0:01:36
582000 -- (-1845.193) [-1845.665] (-1844.096) (-1839.211) * (-1842.271) [-1847.808] (-1847.765) (-1848.779) -- 0:01:36
582500 -- (-1843.538) (-1847.637) [-1850.966] (-1844.597) * (-1840.792) (-1845.403) [-1843.080] (-1843.481) -- 0:01:36
583000 -- (-1845.383) (-1850.688) (-1847.864) [-1845.391] * (-1847.114) (-1850.838) [-1842.883] (-1839.249) -- 0:01:35
583500 -- (-1840.835) [-1844.836] (-1843.704) (-1842.923) * (-1846.949) (-1847.442) (-1842.065) [-1846.618] -- 0:01:35
584000 -- (-1843.342) (-1843.347) (-1846.440) [-1849.881] * (-1841.865) (-1842.336) [-1842.800] (-1842.080) -- 0:01:35
584500 -- [-1843.258] (-1846.044) (-1845.890) (-1844.071) * (-1844.712) [-1845.172] (-1847.172) (-1842.989) -- 0:01:35
585000 -- (-1843.082) (-1845.111) (-1842.698) [-1846.559] * [-1838.026] (-1845.663) (-1841.687) (-1845.233) -- 0:01:35
Average standard deviation of split frequencies: 0.001207
585500 -- [-1839.148] (-1856.215) (-1844.915) (-1843.736) * (-1843.288) (-1846.388) (-1843.182) [-1852.013] -- 0:01:35
586000 -- (-1844.070) [-1849.182] (-1842.917) (-1842.817) * (-1843.050) (-1845.451) [-1839.435] (-1849.390) -- 0:01:35
586500 -- (-1840.339) (-1846.358) [-1842.195] (-1843.254) * [-1842.624] (-1838.047) (-1842.463) (-1842.420) -- 0:01:35
587000 -- (-1839.806) [-1843.555] (-1843.444) (-1845.255) * [-1842.555] (-1848.707) (-1847.469) (-1841.346) -- 0:01:34
587500 -- (-1839.547) (-1847.424) (-1845.083) [-1843.950] * [-1845.086] (-1842.067) (-1842.169) (-1840.059) -- 0:01:34
588000 -- (-1845.806) (-1843.251) (-1839.400) [-1846.588] * (-1851.130) (-1844.760) [-1843.459] (-1845.212) -- 0:01:34
588500 -- [-1842.662] (-1843.143) (-1845.678) (-1843.472) * [-1845.995] (-1846.320) (-1843.733) (-1843.083) -- 0:01:34
589000 -- (-1844.053) (-1847.358) [-1845.845] (-1847.085) * (-1841.035) [-1840.122] (-1846.531) (-1845.306) -- 0:01:34
589500 -- (-1858.487) [-1844.503] (-1839.166) (-1841.589) * (-1841.141) [-1844.607] (-1841.026) (-1843.987) -- 0:01:34
590000 -- (-1845.646) (-1843.356) [-1840.720] (-1850.080) * [-1841.211] (-1842.581) (-1844.326) (-1845.657) -- 0:01:34
Average standard deviation of split frequencies: 0.001197
590500 -- (-1844.635) [-1842.333] (-1842.283) (-1843.313) * (-1843.766) (-1850.671) [-1844.806] (-1845.966) -- 0:01:34
591000 -- (-1849.187) (-1846.818) (-1846.678) [-1842.973] * (-1841.279) [-1846.107] (-1849.592) (-1843.135) -- 0:01:34
591500 -- (-1843.140) [-1844.496] (-1840.831) (-1842.362) * (-1846.835) (-1843.107) [-1840.395] (-1845.296) -- 0:01:33
592000 -- [-1844.475] (-1843.849) (-1843.464) (-1846.344) * (-1842.338) [-1839.485] (-1843.285) (-1843.005) -- 0:01:33
592500 -- (-1839.186) (-1844.750) [-1842.357] (-1851.116) * (-1849.448) (-1840.935) [-1847.701] (-1842.397) -- 0:01:33
593000 -- (-1858.644) (-1843.811) [-1845.661] (-1844.781) * (-1850.244) [-1845.778] (-1849.471) (-1845.567) -- 0:01:34
593500 -- [-1850.470] (-1843.834) (-1852.287) (-1839.110) * [-1842.875] (-1845.996) (-1846.838) (-1845.127) -- 0:01:33
594000 -- (-1849.556) (-1843.964) (-1847.004) [-1842.955] * (-1843.911) (-1853.653) (-1849.637) [-1844.357] -- 0:01:33
594500 -- (-1846.136) [-1844.743] (-1844.025) (-1848.023) * (-1847.107) (-1848.632) [-1842.283] (-1845.475) -- 0:01:33
595000 -- (-1848.531) (-1847.289) (-1849.299) [-1843.927] * (-1850.264) (-1844.011) [-1840.690] (-1851.320) -- 0:01:33
Average standard deviation of split frequencies: 0.001186
595500 -- (-1845.206) [-1843.183] (-1841.940) (-1850.184) * (-1843.981) (-1863.604) (-1844.244) [-1841.274] -- 0:01:33
596000 -- (-1846.484) [-1842.544] (-1850.002) (-1847.980) * (-1842.801) (-1854.042) (-1847.795) [-1841.119] -- 0:01:32
596500 -- (-1843.723) (-1847.367) [-1845.683] (-1846.055) * [-1842.062] (-1848.515) (-1849.920) (-1848.384) -- 0:01:32
597000 -- [-1844.816] (-1845.527) (-1846.535) (-1847.167) * (-1849.274) (-1845.394) [-1843.957] (-1844.878) -- 0:01:33
597500 -- [-1840.656] (-1848.882) (-1846.675) (-1845.225) * (-1853.820) (-1847.506) (-1841.524) [-1844.529] -- 0:01:32
598000 -- (-1846.372) (-1845.946) (-1850.223) [-1843.960] * (-1846.105) (-1849.437) (-1846.448) [-1843.459] -- 0:01:32
598500 -- (-1841.313) (-1849.535) (-1848.903) [-1840.492] * (-1840.086) [-1841.171] (-1844.386) (-1848.337) -- 0:01:32
599000 -- (-1843.016) (-1846.290) [-1845.102] (-1847.443) * (-1850.188) (-1849.496) [-1852.368] (-1844.751) -- 0:01:32
599500 -- [-1846.808] (-1848.117) (-1847.870) (-1844.988) * (-1854.059) (-1842.787) (-1842.139) [-1844.652] -- 0:01:32
600000 -- [-1844.855] (-1847.110) (-1844.698) (-1839.997) * (-1846.438) [-1840.103] (-1847.949) (-1851.513) -- 0:01:32
Average standard deviation of split frequencies: 0.001177
600500 -- (-1851.056) [-1844.769] (-1849.252) (-1844.753) * (-1853.441) (-1849.302) [-1847.314] (-1853.587) -- 0:01:31
601000 -- [-1843.241] (-1839.623) (-1847.270) (-1844.379) * (-1853.641) (-1847.832) [-1844.093] (-1840.702) -- 0:01:31
601500 -- (-1841.976) (-1848.811) [-1844.180] (-1850.532) * (-1851.504) (-1843.519) [-1840.938] (-1842.638) -- 0:01:32
602000 -- (-1842.736) (-1850.954) (-1846.815) [-1838.666] * (-1843.393) [-1840.802] (-1844.095) (-1838.657) -- 0:01:31
602500 -- [-1844.538] (-1852.577) (-1844.437) (-1842.882) * (-1843.885) (-1842.758) [-1836.519] (-1848.377) -- 0:01:31
603000 -- (-1842.895) [-1840.708] (-1844.850) (-1842.302) * (-1846.622) (-1848.142) [-1840.978] (-1840.956) -- 0:01:31
603500 -- (-1847.196) (-1846.639) [-1847.649] (-1847.858) * (-1839.770) (-1852.025) [-1840.048] (-1842.590) -- 0:01:31
604000 -- [-1847.222] (-1852.938) (-1853.608) (-1841.275) * (-1844.476) [-1846.108] (-1849.249) (-1844.534) -- 0:01:31
604500 -- [-1848.700] (-1849.777) (-1843.195) (-1842.095) * (-1840.287) (-1849.381) (-1840.781) [-1843.359] -- 0:01:30
605000 -- [-1844.255] (-1842.808) (-1843.671) (-1846.513) * (-1844.589) (-1847.023) (-1842.415) [-1843.529] -- 0:01:30
Average standard deviation of split frequencies: 0.001167
605500 -- (-1845.811) [-1841.891] (-1844.968) (-1843.185) * (-1840.284) [-1840.798] (-1840.919) (-1843.507) -- 0:01:31
606000 -- [-1845.344] (-1846.415) (-1842.722) (-1846.818) * (-1842.658) [-1838.571] (-1846.177) (-1848.328) -- 0:01:31
606500 -- [-1843.449] (-1844.787) (-1857.787) (-1841.228) * [-1839.558] (-1857.844) (-1851.605) (-1851.832) -- 0:01:30
607000 -- (-1847.039) (-1844.758) (-1850.550) [-1841.427] * (-1840.635) [-1844.297] (-1844.193) (-1848.240) -- 0:01:30
607500 -- [-1849.418] (-1847.016) (-1839.602) (-1841.015) * (-1852.293) (-1841.467) (-1852.421) [-1850.735] -- 0:01:30
608000 -- (-1841.290) (-1841.727) [-1840.073] (-1845.569) * [-1842.970] (-1848.290) (-1840.319) (-1845.086) -- 0:01:30
608500 -- (-1844.445) [-1844.515] (-1843.138) (-1843.994) * (-1843.611) (-1848.225) [-1843.525] (-1847.647) -- 0:01:30
609000 -- [-1841.581] (-1844.127) (-1844.148) (-1838.014) * (-1847.768) [-1843.199] (-1848.713) (-1846.166) -- 0:01:29
609500 -- (-1842.881) [-1842.744] (-1841.568) (-1841.493) * (-1839.804) (-1843.569) (-1840.171) [-1850.605] -- 0:01:29
610000 -- [-1844.665] (-1847.686) (-1843.756) (-1841.656) * (-1845.355) [-1841.694] (-1841.009) (-1845.374) -- 0:01:30
Average standard deviation of split frequencies: 0.001544
610500 -- (-1846.213) (-1841.188) [-1845.783] (-1845.694) * (-1846.444) [-1849.775] (-1846.111) (-1844.137) -- 0:01:29
611000 -- (-1848.016) (-1844.416) (-1844.258) [-1846.758] * (-1842.875) [-1840.285] (-1841.326) (-1843.095) -- 0:01:29
611500 -- (-1850.947) (-1844.543) (-1848.171) [-1849.869] * (-1844.494) [-1841.643] (-1843.168) (-1846.376) -- 0:01:29
612000 -- [-1848.092] (-1842.542) (-1843.202) (-1850.387) * (-1845.182) [-1845.814] (-1844.867) (-1842.089) -- 0:01:29
612500 -- [-1845.418] (-1846.541) (-1848.569) (-1842.284) * (-1851.330) (-1843.030) [-1840.577] (-1845.696) -- 0:01:29
613000 -- (-1843.978) (-1849.270) [-1841.713] (-1842.440) * (-1847.191) (-1848.484) (-1848.987) [-1843.347] -- 0:01:29
613500 -- [-1849.279] (-1845.710) (-1845.716) (-1838.344) * [-1840.710] (-1843.246) (-1842.626) (-1848.088) -- 0:01:28
614000 -- (-1851.340) [-1842.335] (-1848.803) (-1841.083) * [-1845.950] (-1845.643) (-1844.918) (-1849.519) -- 0:01:28
614500 -- (-1847.772) [-1843.498] (-1852.071) (-1846.931) * (-1845.050) [-1842.871] (-1841.608) (-1846.745) -- 0:01:29
615000 -- (-1845.959) (-1845.843) [-1847.719] (-1839.935) * [-1843.949] (-1842.110) (-1846.565) (-1845.308) -- 0:01:28
Average standard deviation of split frequencies: 0.001531
615500 -- (-1843.082) (-1841.304) (-1852.415) [-1844.731] * [-1842.728] (-1843.352) (-1847.403) (-1846.603) -- 0:01:28
616000 -- (-1842.710) [-1843.106] (-1847.139) (-1842.754) * (-1850.238) (-1848.910) (-1845.232) [-1843.179] -- 0:01:28
616500 -- (-1837.377) (-1846.634) (-1845.414) [-1844.439] * (-1840.921) (-1845.075) [-1845.392] (-1845.317) -- 0:01:28
617000 -- (-1842.514) (-1854.486) (-1842.220) [-1847.386] * (-1845.440) (-1842.178) [-1843.206] (-1841.637) -- 0:01:28
617500 -- (-1842.056) (-1842.428) (-1840.807) [-1840.674] * (-1840.513) [-1841.679] (-1847.214) (-1841.136) -- 0:01:27
618000 -- (-1843.769) (-1856.764) [-1840.374] (-1843.919) * [-1842.962] (-1848.071) (-1855.318) (-1847.890) -- 0:01:27
618500 -- (-1853.955) [-1843.132] (-1844.440) (-1844.356) * (-1849.604) [-1850.495] (-1849.160) (-1843.957) -- 0:01:28
619000 -- (-1842.101) (-1849.753) [-1846.921] (-1840.737) * (-1851.534) (-1856.307) [-1844.496] (-1843.204) -- 0:01:28
619500 -- [-1843.563] (-1854.636) (-1854.044) (-1847.763) * (-1845.120) (-1845.521) [-1844.537] (-1844.941) -- 0:01:27
620000 -- (-1849.103) (-1843.801) [-1843.385] (-1845.393) * (-1850.877) [-1845.251] (-1845.770) (-1848.012) -- 0:01:27
Average standard deviation of split frequencies: 0.001519
620500 -- (-1844.147) (-1844.927) (-1841.536) [-1842.627] * (-1843.467) [-1849.087] (-1842.466) (-1842.333) -- 0:01:27
621000 -- (-1848.301) [-1842.448] (-1839.161) (-1842.590) * (-1848.069) (-1843.579) [-1842.829] (-1843.033) -- 0:01:27
621500 -- [-1842.754] (-1847.194) (-1844.181) (-1843.806) * [-1849.779] (-1851.826) (-1843.767) (-1846.966) -- 0:01:27
622000 -- (-1853.215) [-1846.330] (-1845.822) (-1845.486) * (-1842.692) [-1845.794] (-1854.081) (-1846.101) -- 0:01:26
622500 -- (-1838.943) (-1844.732) [-1849.515] (-1851.668) * [-1840.110] (-1844.375) (-1847.549) (-1844.884) -- 0:01:26
623000 -- (-1846.278) (-1839.998) (-1850.666) [-1849.145] * (-1841.579) [-1842.999] (-1845.078) (-1841.005) -- 0:01:27
623500 -- [-1841.495] (-1853.779) (-1847.160) (-1843.052) * (-1841.854) [-1841.972] (-1845.737) (-1842.206) -- 0:01:26
624000 -- (-1840.016) (-1848.474) [-1847.538] (-1851.488) * [-1842.204] (-1850.139) (-1844.326) (-1846.960) -- 0:01:26
624500 -- [-1847.412] (-1850.333) (-1839.760) (-1842.863) * (-1850.978) [-1841.708] (-1845.880) (-1844.328) -- 0:01:26
625000 -- [-1837.990] (-1852.577) (-1845.441) (-1841.326) * [-1842.360] (-1852.665) (-1840.706) (-1840.549) -- 0:01:26
Average standard deviation of split frequencies: 0.001506
625500 -- (-1844.877) [-1849.526] (-1840.921) (-1843.632) * (-1849.700) (-1840.325) (-1843.018) [-1841.470] -- 0:01:26
626000 -- (-1838.813) [-1844.831] (-1845.216) (-1845.063) * (-1848.044) (-1840.545) [-1844.607] (-1853.838) -- 0:01:26
626500 -- (-1840.684) (-1842.046) [-1846.515] (-1852.963) * (-1841.996) (-1842.491) (-1847.231) [-1850.396] -- 0:01:25
627000 -- (-1843.171) [-1842.682] (-1838.837) (-1851.359) * [-1842.438] (-1851.708) (-1850.194) (-1846.103) -- 0:01:25
627500 -- (-1845.112) (-1841.792) (-1842.918) [-1847.947] * [-1843.936] (-1849.776) (-1846.264) (-1849.158) -- 0:01:26
628000 -- (-1840.695) (-1850.582) (-1844.957) [-1841.790] * (-1857.170) (-1847.997) [-1841.591] (-1846.973) -- 0:01:25
628500 -- (-1839.555) (-1840.293) [-1842.087] (-1841.587) * (-1851.066) (-1841.159) (-1848.868) [-1843.093] -- 0:01:25
629000 -- (-1838.774) (-1844.592) (-1840.607) [-1843.920] * (-1852.509) (-1844.133) (-1841.115) [-1840.670] -- 0:01:25
629500 -- [-1843.973] (-1847.441) (-1845.063) (-1844.702) * (-1847.552) [-1842.240] (-1842.681) (-1844.740) -- 0:01:25
630000 -- (-1844.821) [-1846.905] (-1849.146) (-1846.166) * (-1843.780) [-1843.328] (-1842.282) (-1845.886) -- 0:01:25
Average standard deviation of split frequencies: 0.001495
630500 -- (-1848.445) (-1842.883) [-1845.739] (-1843.699) * [-1838.151] (-1850.348) (-1845.967) (-1843.075) -- 0:01:24
631000 -- (-1853.284) (-1843.998) (-1847.374) [-1841.763] * [-1841.850] (-1841.392) (-1854.017) (-1847.673) -- 0:01:24
631500 -- [-1843.297] (-1839.053) (-1843.414) (-1849.002) * (-1845.404) (-1844.700) (-1846.591) [-1842.690] -- 0:01:24
632000 -- (-1842.690) [-1848.119] (-1842.079) (-1850.087) * [-1845.163] (-1840.959) (-1847.365) (-1849.415) -- 0:01:25
632500 -- [-1842.563] (-1843.733) (-1841.547) (-1845.374) * (-1848.183) [-1842.427] (-1850.414) (-1842.994) -- 0:01:24
633000 -- (-1847.518) (-1842.707) (-1844.953) [-1846.071] * (-1852.396) [-1841.964] (-1847.837) (-1845.179) -- 0:01:24
633500 -- (-1842.573) (-1846.424) (-1842.293) [-1841.494] * (-1843.804) (-1843.442) (-1850.007) [-1841.847] -- 0:01:24
634000 -- (-1842.838) (-1848.187) [-1840.082] (-1838.365) * (-1849.507) [-1842.039] (-1848.520) (-1847.739) -- 0:01:24
634500 -- (-1844.146) (-1848.596) [-1844.132] (-1841.940) * [-1849.466] (-1840.000) (-1846.633) (-1847.813) -- 0:01:24
635000 -- (-1846.509) [-1858.272] (-1846.012) (-1844.558) * (-1842.139) (-1843.470) [-1844.640] (-1842.804) -- 0:01:23
Average standard deviation of split frequencies: 0.001112
635500 -- (-1852.303) [-1841.874] (-1841.802) (-1844.786) * [-1844.280] (-1847.530) (-1840.150) (-1842.780) -- 0:01:23
636000 -- (-1847.373) [-1841.454] (-1852.313) (-1844.591) * [-1837.449] (-1839.736) (-1845.311) (-1848.655) -- 0:01:24
636500 -- [-1844.130] (-1843.441) (-1846.350) (-1843.518) * (-1841.184) [-1839.868] (-1837.563) (-1844.075) -- 0:01:23
637000 -- [-1843.122] (-1842.351) (-1846.429) (-1845.387) * (-1843.681) [-1842.475] (-1852.743) (-1842.412) -- 0:01:23
637500 -- [-1846.184] (-1851.455) (-1842.807) (-1843.118) * (-1846.463) (-1852.100) [-1842.384] (-1858.636) -- 0:01:23
638000 -- (-1844.030) (-1847.138) (-1840.179) [-1846.987] * (-1844.091) [-1845.752] (-1841.202) (-1849.161) -- 0:01:23
638500 -- [-1841.852] (-1845.798) (-1856.037) (-1847.623) * (-1846.644) (-1849.887) (-1844.056) [-1844.921] -- 0:01:23
639000 -- [-1841.864] (-1851.608) (-1846.905) (-1838.929) * (-1846.732) (-1845.723) (-1843.163) [-1839.628] -- 0:01:23
639500 -- (-1842.487) (-1847.611) [-1843.398] (-1844.448) * (-1848.353) (-1842.998) (-1841.172) [-1839.330] -- 0:01:22
640000 -- (-1847.335) (-1841.682) [-1843.793] (-1851.978) * [-1840.410] (-1840.797) (-1846.365) (-1843.679) -- 0:01:22
Average standard deviation of split frequencies: 0.001104
640500 -- (-1839.460) [-1843.974] (-1839.364) (-1846.545) * [-1842.479] (-1846.587) (-1842.619) (-1840.883) -- 0:01:23
641000 -- (-1846.401) (-1845.737) [-1844.885] (-1846.960) * [-1843.746] (-1842.803) (-1844.801) (-1842.379) -- 0:01:22
641500 -- [-1842.247] (-1839.764) (-1845.603) (-1846.799) * [-1845.638] (-1849.213) (-1839.159) (-1843.230) -- 0:01:22
642000 -- (-1844.403) (-1843.596) [-1843.289] (-1850.794) * (-1846.072) (-1850.201) (-1842.393) [-1841.886] -- 0:01:22
642500 -- (-1844.432) (-1844.245) [-1841.020] (-1845.734) * (-1851.990) (-1844.609) [-1848.749] (-1840.386) -- 0:01:22
643000 -- (-1856.648) (-1841.757) (-1845.191) [-1842.295] * (-1840.542) (-1845.394) (-1841.973) [-1840.118] -- 0:01:22
643500 -- (-1851.735) (-1844.618) (-1841.299) [-1841.515] * (-1844.277) (-1842.014) (-1842.174) [-1839.755] -- 0:01:21
644000 -- (-1853.089) (-1849.639) [-1840.337] (-1843.294) * [-1848.394] (-1847.684) (-1844.510) (-1840.894) -- 0:01:21
644500 -- (-1844.368) (-1841.592) [-1840.926] (-1841.837) * [-1847.118] (-1841.010) (-1842.213) (-1842.651) -- 0:01:21
645000 -- (-1840.452) [-1843.952] (-1843.311) (-1841.964) * (-1844.091) (-1839.438) (-1842.722) [-1842.899] -- 0:01:22
Average standard deviation of split frequencies: 0.001095
645500 -- (-1840.059) [-1847.454] (-1852.974) (-1844.616) * (-1847.448) (-1846.617) (-1850.552) [-1844.103] -- 0:01:21
646000 -- [-1840.916] (-1843.355) (-1852.163) (-1855.333) * (-1842.961) (-1851.293) (-1846.190) [-1848.247] -- 0:01:21
646500 -- (-1853.202) (-1841.326) [-1840.499] (-1841.792) * [-1850.347] (-1840.292) (-1846.611) (-1850.820) -- 0:01:21
647000 -- (-1847.428) (-1843.273) [-1839.995] (-1840.695) * (-1840.988) (-1844.956) [-1845.036] (-1853.333) -- 0:01:21
647500 -- (-1842.915) (-1842.454) [-1842.451] (-1843.876) * (-1843.364) (-1844.608) (-1842.676) [-1846.895] -- 0:01:21
648000 -- (-1843.736) [-1840.419] (-1843.639) (-1845.565) * [-1841.815] (-1848.378) (-1845.209) (-1842.590) -- 0:01:20
648500 -- [-1847.948] (-1840.088) (-1847.139) (-1842.573) * (-1851.220) [-1849.995] (-1845.938) (-1846.390) -- 0:01:20
649000 -- [-1845.245] (-1842.302) (-1841.854) (-1847.085) * (-1842.816) [-1846.059] (-1840.891) (-1845.661) -- 0:01:20
649500 -- (-1842.398) (-1840.520) (-1849.960) [-1843.616] * (-1842.288) (-1851.729) (-1843.973) [-1845.693] -- 0:01:20
650000 -- (-1841.731) (-1841.789) [-1842.461] (-1844.815) * (-1839.877) (-1843.145) [-1849.044] (-1843.961) -- 0:01:20
Average standard deviation of split frequencies: 0.001087
650500 -- (-1843.319) [-1839.320] (-1841.291) (-1842.592) * (-1845.431) (-1846.555) (-1847.046) [-1844.769] -- 0:01:20
651000 -- [-1838.575] (-1847.682) (-1840.060) (-1846.035) * [-1839.840] (-1842.056) (-1847.769) (-1845.943) -- 0:01:20
651500 -- (-1846.290) (-1852.198) (-1841.241) [-1841.842] * (-1845.937) (-1846.877) (-1845.122) [-1844.107] -- 0:01:20
652000 -- (-1844.466) (-1843.979) [-1853.647] (-1849.738) * (-1851.512) (-1844.451) [-1841.179] (-1842.953) -- 0:01:20
652500 -- (-1845.429) [-1843.866] (-1845.633) (-1847.574) * (-1846.741) (-1845.898) (-1840.555) [-1848.558] -- 0:01:19
653000 -- (-1847.282) (-1845.023) [-1843.714] (-1846.761) * (-1846.595) (-1842.117) (-1840.698) [-1839.516] -- 0:01:19
653500 -- (-1848.720) [-1841.573] (-1847.108) (-1845.231) * (-1846.575) (-1842.239) (-1847.097) [-1838.103] -- 0:01:19
654000 -- (-1845.216) (-1849.694) [-1842.113] (-1844.440) * (-1848.825) (-1843.165) [-1843.042] (-1843.850) -- 0:01:19
654500 -- [-1838.565] (-1839.317) (-1849.026) (-1846.780) * [-1844.780] (-1840.989) (-1846.224) (-1842.459) -- 0:01:19
655000 -- (-1841.663) (-1844.085) (-1844.672) [-1847.501] * [-1847.663] (-1843.507) (-1848.290) (-1862.454) -- 0:01:19
Average standard deviation of split frequencies: 0.001078
655500 -- (-1838.890) (-1845.275) [-1847.386] (-1844.324) * (-1849.583) [-1847.387] (-1847.516) (-1844.555) -- 0:01:19
656000 -- [-1842.346] (-1842.438) (-1850.980) (-1843.090) * (-1845.993) [-1845.500] (-1844.744) (-1846.024) -- 0:01:19
656500 -- [-1841.981] (-1843.999) (-1850.188) (-1840.792) * (-1843.070) (-1844.061) (-1848.341) [-1847.060] -- 0:01:19
657000 -- (-1859.553) [-1841.174] (-1842.542) (-1839.710) * (-1845.152) (-1843.162) [-1839.299] (-1845.714) -- 0:01:18
657500 -- (-1842.749) [-1845.996] (-1846.976) (-1843.204) * (-1844.586) (-1845.158) [-1843.379] (-1844.430) -- 0:01:18
658000 -- [-1845.038] (-1843.254) (-1846.895) (-1839.342) * [-1838.748] (-1844.811) (-1850.368) (-1850.717) -- 0:01:19
658500 -- (-1839.812) [-1850.220] (-1841.537) (-1847.815) * [-1843.240] (-1849.440) (-1840.335) (-1841.511) -- 0:01:18
659000 -- (-1844.505) [-1841.893] (-1850.831) (-1844.476) * (-1840.937) (-1849.118) (-1846.980) [-1843.513] -- 0:01:18
659500 -- (-1847.396) [-1841.966] (-1854.061) (-1840.398) * (-1844.323) (-1849.826) [-1841.532] (-1844.379) -- 0:01:18
660000 -- (-1843.348) (-1841.589) [-1848.214] (-1848.334) * [-1846.657] (-1851.334) (-1842.611) (-1852.700) -- 0:01:18
Average standard deviation of split frequencies: 0.001070
660500 -- (-1846.183) (-1849.867) [-1839.260] (-1841.658) * (-1845.078) (-1856.068) [-1846.616] (-1847.358) -- 0:01:18
661000 -- (-1844.602) [-1846.244] (-1847.844) (-1842.472) * [-1842.437] (-1852.017) (-1847.813) (-1849.468) -- 0:01:17
661500 -- (-1843.152) (-1844.439) [-1847.533] (-1842.748) * [-1843.212] (-1841.388) (-1844.661) (-1852.518) -- 0:01:17
662000 -- (-1846.443) [-1840.372] (-1844.314) (-1841.805) * (-1850.508) [-1843.581] (-1845.318) (-1856.273) -- 0:01:17
662500 -- (-1839.865) [-1838.866] (-1845.748) (-1844.952) * (-1844.692) (-1843.754) (-1843.855) [-1846.823] -- 0:01:17
663000 -- (-1840.205) (-1847.996) (-1850.098) [-1839.451] * (-1840.658) (-1846.128) (-1843.084) [-1841.644] -- 0:01:17
663500 -- [-1842.946] (-1840.343) (-1843.508) (-1841.942) * (-1846.430) [-1841.791] (-1839.446) (-1850.594) -- 0:01:17
664000 -- (-1841.300) [-1839.881] (-1846.846) (-1844.090) * (-1846.619) (-1841.132) (-1841.615) [-1840.726] -- 0:01:17
664500 -- (-1842.406) (-1844.886) (-1844.988) [-1842.635] * (-1840.298) [-1842.526] (-1841.935) (-1846.219) -- 0:01:17
665000 -- (-1849.270) (-1843.923) (-1847.350) [-1841.941] * (-1844.889) [-1843.404] (-1850.287) (-1841.871) -- 0:01:17
Average standard deviation of split frequencies: 0.001062
665500 -- (-1846.986) [-1849.630] (-1848.160) (-1849.965) * (-1844.230) [-1844.167] (-1846.112) (-1846.335) -- 0:01:16
666000 -- [-1840.330] (-1847.919) (-1841.599) (-1847.022) * (-1845.530) [-1839.120] (-1845.450) (-1847.740) -- 0:01:16
666500 -- (-1844.213) (-1849.530) [-1848.065] (-1839.396) * [-1846.381] (-1838.569) (-1844.847) (-1841.054) -- 0:01:16
667000 -- (-1842.214) (-1845.552) [-1846.155] (-1844.162) * (-1844.822) (-1847.502) [-1842.380] (-1840.949) -- 0:01:16
667500 -- [-1840.797] (-1843.104) (-1843.263) (-1847.357) * (-1848.297) (-1844.659) [-1848.324] (-1850.848) -- 0:01:16
668000 -- (-1842.292) [-1841.682] (-1846.925) (-1845.414) * (-1848.201) (-1841.472) (-1849.512) [-1845.941] -- 0:01:16
668500 -- (-1841.147) [-1848.257] (-1848.718) (-1848.416) * (-1852.116) (-1843.357) (-1843.350) [-1843.594] -- 0:01:16
669000 -- (-1847.064) [-1843.505] (-1845.214) (-1847.108) * (-1847.742) (-1846.228) [-1844.335] (-1845.971) -- 0:01:16
669500 -- (-1845.721) [-1842.359] (-1839.858) (-1842.194) * (-1846.874) [-1845.443] (-1845.015) (-1846.063) -- 0:01:16
670000 -- (-1844.937) (-1842.239) [-1843.126] (-1840.542) * (-1845.526) (-1841.660) [-1847.257] (-1849.388) -- 0:01:15
Average standard deviation of split frequencies: 0.001054
670500 -- (-1846.293) [-1842.147] (-1846.190) (-1846.545) * (-1848.667) (-1844.195) [-1845.561] (-1848.033) -- 0:01:15
671000 -- (-1841.904) (-1841.335) [-1843.535] (-1848.911) * (-1842.742) (-1839.806) [-1844.561] (-1849.417) -- 0:01:15
671500 -- (-1840.656) [-1848.608] (-1854.206) (-1843.643) * (-1849.882) [-1836.463] (-1846.770) (-1853.200) -- 0:01:15
672000 -- (-1849.909) (-1839.422) (-1845.848) [-1840.529] * (-1841.697) (-1852.319) [-1847.402] (-1842.745) -- 0:01:15
672500 -- (-1844.109) (-1844.174) (-1848.721) [-1846.788] * [-1848.937] (-1849.447) (-1845.437) (-1856.017) -- 0:01:15
673000 -- (-1838.811) (-1851.232) (-1843.076) [-1854.129] * (-1851.325) (-1838.562) [-1840.287] (-1841.802) -- 0:01:15
673500 -- [-1840.815] (-1860.028) (-1848.578) (-1844.985) * (-1845.987) [-1840.451] (-1841.775) (-1848.276) -- 0:01:15
674000 -- [-1844.485] (-1842.377) (-1847.527) (-1851.614) * (-1841.727) [-1844.481] (-1841.901) (-1846.181) -- 0:01:14
674500 -- (-1845.839) (-1855.225) [-1839.829] (-1848.143) * (-1847.605) (-1847.619) [-1843.683] (-1851.835) -- 0:01:14
675000 -- [-1845.313] (-1841.285) (-1840.304) (-1841.556) * [-1840.189] (-1850.164) (-1842.180) (-1843.652) -- 0:01:14
Average standard deviation of split frequencies: 0.001046
675500 -- (-1848.211) (-1841.512) (-1843.357) [-1843.654] * (-1845.579) (-1842.364) (-1846.811) [-1849.568] -- 0:01:14
676000 -- [-1842.871] (-1846.342) (-1846.452) (-1842.618) * [-1845.569] (-1851.953) (-1845.943) (-1847.293) -- 0:01:14
676500 -- (-1851.137) [-1851.446] (-1844.999) (-1853.473) * (-1845.556) (-1840.965) [-1845.444] (-1844.678) -- 0:01:14
677000 -- [-1840.473] (-1848.360) (-1855.148) (-1844.230) * [-1839.583] (-1845.305) (-1844.534) (-1847.401) -- 0:01:14
677500 -- (-1845.635) (-1849.463) (-1844.605) [-1841.716] * (-1839.978) (-1843.440) [-1837.594] (-1851.522) -- 0:01:14
678000 -- (-1849.541) (-1848.164) [-1845.602] (-1840.694) * [-1842.382] (-1845.367) (-1845.374) (-1842.352) -- 0:01:14
678500 -- [-1842.992] (-1848.847) (-1856.476) (-1839.200) * (-1848.791) [-1841.280] (-1848.971) (-1843.558) -- 0:01:13
679000 -- (-1843.378) (-1840.308) (-1842.466) [-1842.563] * (-1840.836) (-1844.628) (-1854.694) [-1841.400] -- 0:01:13
679500 -- (-1845.505) [-1844.368] (-1844.052) (-1845.932) * [-1844.112] (-1847.323) (-1847.132) (-1845.407) -- 0:01:13
680000 -- (-1842.986) [-1839.303] (-1841.084) (-1849.307) * (-1852.330) [-1845.552] (-1852.859) (-1850.641) -- 0:01:13
Average standard deviation of split frequencies: 0.000693
680500 -- [-1845.337] (-1845.053) (-1849.621) (-1853.565) * (-1845.850) (-1839.036) [-1848.840] (-1843.421) -- 0:01:13
681000 -- (-1850.561) (-1848.780) [-1838.987] (-1841.776) * (-1850.224) (-1844.415) (-1850.148) [-1845.979] -- 0:01:13
681500 -- (-1841.872) (-1848.849) [-1843.967] (-1844.053) * (-1844.993) [-1845.352] (-1845.354) (-1842.657) -- 0:01:13
682000 -- [-1843.652] (-1841.527) (-1851.548) (-1843.391) * (-1846.929) [-1839.034] (-1844.320) (-1842.876) -- 0:01:13
682500 -- (-1840.451) [-1842.567] (-1850.525) (-1845.808) * (-1843.669) [-1843.513] (-1839.783) (-1844.083) -- 0:01:13
683000 -- (-1844.037) [-1843.077] (-1840.644) (-1847.760) * (-1846.227) (-1847.854) (-1839.220) [-1844.248] -- 0:01:12
683500 -- (-1847.164) (-1862.864) [-1839.748] (-1848.168) * (-1845.724) [-1845.959] (-1843.126) (-1845.148) -- 0:01:12
684000 -- (-1848.660) [-1849.664] (-1843.888) (-1849.030) * (-1850.477) (-1849.630) (-1842.261) [-1841.678] -- 0:01:12
684500 -- (-1850.228) [-1847.615] (-1851.030) (-1845.929) * [-1846.908] (-1844.172) (-1843.484) (-1841.873) -- 0:01:12
685000 -- [-1842.308] (-1847.607) (-1844.962) (-1847.075) * [-1843.407] (-1844.616) (-1842.864) (-1843.487) -- 0:01:12
Average standard deviation of split frequencies: 0.000687
685500 -- [-1844.376] (-1847.577) (-1844.796) (-1847.052) * (-1843.964) (-1854.814) (-1853.080) [-1844.292] -- 0:01:12
686000 -- (-1842.382) (-1841.971) [-1843.428] (-1842.187) * [-1850.053] (-1851.581) (-1846.534) (-1848.875) -- 0:01:12
686500 -- (-1849.635) [-1842.663] (-1842.873) (-1844.538) * (-1847.375) (-1842.082) [-1845.705] (-1846.632) -- 0:01:12
687000 -- (-1850.859) [-1842.717] (-1842.189) (-1852.667) * (-1850.442) [-1844.084] (-1838.519) (-1845.603) -- 0:01:11
687500 -- (-1844.390) (-1843.221) [-1839.642] (-1847.008) * [-1843.434] (-1842.732) (-1844.080) (-1849.235) -- 0:01:11
688000 -- [-1840.885] (-1841.873) (-1839.458) (-1842.884) * [-1844.202] (-1845.519) (-1844.275) (-1854.754) -- 0:01:11
688500 -- (-1844.443) (-1842.709) (-1846.204) [-1841.667] * (-1847.594) (-1844.041) [-1843.938] (-1847.521) -- 0:01:11
689000 -- [-1841.273] (-1842.653) (-1844.495) (-1847.582) * (-1843.043) (-1842.338) (-1854.704) [-1845.997] -- 0:01:11
689500 -- (-1840.555) (-1844.124) [-1842.570] (-1851.054) * (-1849.564) (-1844.587) (-1846.276) [-1843.335] -- 0:01:11
690000 -- (-1852.236) (-1837.473) [-1838.599] (-1839.161) * (-1844.155) (-1846.944) (-1851.223) [-1846.533] -- 0:01:11
Average standard deviation of split frequencies: 0.000683
690500 -- (-1850.584) [-1840.247] (-1846.280) (-1844.132) * (-1853.930) [-1841.311] (-1844.090) (-1847.980) -- 0:01:11
691000 -- (-1847.903) (-1842.812) (-1842.774) [-1846.809] * (-1850.302) (-1842.750) [-1841.908] (-1848.441) -- 0:01:11
691500 -- [-1852.639] (-1841.531) (-1845.045) (-1844.371) * (-1846.682) (-1845.009) (-1851.957) [-1850.815] -- 0:01:10
692000 -- (-1848.642) (-1850.547) [-1841.837] (-1842.396) * [-1847.717] (-1843.618) (-1844.443) (-1847.289) -- 0:01:10
692500 -- (-1855.286) [-1845.172] (-1844.350) (-1840.234) * [-1844.384] (-1843.381) (-1845.220) (-1847.963) -- 0:01:10
693000 -- (-1845.085) (-1848.540) (-1845.234) [-1841.851] * (-1843.823) [-1846.770] (-1849.594) (-1855.349) -- 0:01:10
693500 -- (-1842.618) (-1847.644) (-1847.711) [-1845.500] * (-1844.876) [-1844.267] (-1846.859) (-1841.808) -- 0:01:10
694000 -- (-1847.202) (-1846.194) (-1847.749) [-1847.087] * (-1847.439) [-1843.033] (-1842.490) (-1841.235) -- 0:01:10
694500 -- (-1848.858) [-1849.937] (-1843.142) (-1848.942) * (-1846.703) (-1854.075) [-1843.329] (-1841.510) -- 0:01:10
695000 -- [-1844.349] (-1838.654) (-1845.444) (-1848.931) * [-1841.001] (-1838.984) (-1843.518) (-1850.582) -- 0:01:10
Average standard deviation of split frequencies: 0.000677
695500 -- (-1844.233) (-1840.864) [-1850.469] (-1852.517) * [-1840.089] (-1841.567) (-1844.696) (-1849.575) -- 0:01:10
696000 -- (-1845.099) (-1842.213) [-1853.081] (-1845.393) * [-1840.914] (-1842.914) (-1850.504) (-1845.421) -- 0:01:09
696500 -- [-1841.182] (-1841.137) (-1848.688) (-1842.865) * (-1845.800) [-1841.574] (-1841.621) (-1845.446) -- 0:01:09
697000 -- (-1841.011) (-1848.255) (-1844.219) [-1841.586] * (-1847.209) (-1841.714) (-1848.474) [-1849.337] -- 0:01:09
697500 -- (-1841.174) (-1843.698) (-1847.370) [-1839.112] * [-1844.976] (-1843.934) (-1848.320) (-1840.398) -- 0:01:09
698000 -- (-1845.938) (-1840.985) (-1847.212) [-1847.738] * (-1842.971) (-1849.120) (-1847.649) [-1846.390] -- 0:01:09
698500 -- (-1846.835) (-1841.533) [-1846.139] (-1839.495) * (-1843.873) (-1848.014) [-1843.617] (-1844.283) -- 0:01:09
699000 -- (-1841.207) (-1843.717) [-1844.648] (-1845.577) * (-1839.008) [-1838.412] (-1846.015) (-1847.179) -- 0:01:09
699500 -- [-1847.920] (-1844.402) (-1850.087) (-1851.634) * (-1843.490) [-1841.779] (-1853.492) (-1841.639) -- 0:01:09
700000 -- [-1842.471] (-1844.988) (-1844.177) (-1856.126) * (-1838.895) (-1843.263) (-1845.551) [-1840.947] -- 0:01:09
Average standard deviation of split frequencies: 0.000673
700500 -- [-1841.172] (-1839.868) (-1843.404) (-1843.936) * (-1839.767) [-1842.951] (-1848.649) (-1840.987) -- 0:01:08
701000 -- (-1846.851) (-1845.369) [-1848.803] (-1850.736) * (-1846.600) (-1842.438) (-1846.808) [-1842.084] -- 0:01:08
701500 -- [-1844.593] (-1847.334) (-1843.722) (-1839.776) * [-1848.091] (-1845.688) (-1845.839) (-1840.812) -- 0:01:08
702000 -- [-1844.473] (-1840.444) (-1841.431) (-1845.082) * (-1846.971) [-1851.334] (-1847.111) (-1842.157) -- 0:01:08
702500 -- (-1847.022) [-1844.157] (-1836.321) (-1845.770) * [-1845.519] (-1849.497) (-1842.726) (-1841.600) -- 0:01:08
703000 -- (-1838.063) [-1844.427] (-1844.393) (-1844.517) * [-1843.496] (-1848.235) (-1841.885) (-1842.438) -- 0:01:08
703500 -- (-1842.137) (-1844.092) [-1839.404] (-1844.741) * [-1839.241] (-1850.776) (-1840.161) (-1846.486) -- 0:01:08
704000 -- [-1840.098] (-1840.595) (-1840.430) (-1847.079) * (-1844.821) (-1841.169) (-1848.082) [-1841.124] -- 0:01:08
704500 -- (-1842.738) [-1840.564] (-1845.182) (-1847.363) * [-1846.364] (-1845.417) (-1843.509) (-1843.171) -- 0:01:07
705000 -- (-1846.196) (-1846.719) (-1847.685) [-1850.321] * (-1843.005) (-1846.661) [-1850.411] (-1842.346) -- 0:01:07
Average standard deviation of split frequencies: 0.000668
705500 -- (-1844.614) (-1847.700) (-1845.444) [-1845.410] * (-1842.928) (-1843.607) [-1841.741] (-1843.780) -- 0:01:07
706000 -- [-1840.238] (-1843.746) (-1845.199) (-1849.399) * (-1847.416) (-1849.123) [-1845.767] (-1843.352) -- 0:01:07
706500 -- (-1850.917) (-1842.957) [-1842.213] (-1845.771) * (-1843.945) (-1846.952) [-1844.951] (-1845.662) -- 0:01:07
707000 -- (-1849.405) [-1853.170] (-1849.476) (-1849.350) * (-1844.834) (-1851.006) (-1840.748) [-1844.989] -- 0:01:07
707500 -- (-1846.259) (-1843.465) (-1845.196) [-1848.897] * (-1845.013) [-1849.423] (-1843.878) (-1843.258) -- 0:01:07
708000 -- (-1849.909) [-1846.281] (-1846.229) (-1845.671) * (-1851.000) [-1846.602] (-1840.101) (-1848.614) -- 0:01:07
708500 -- (-1842.256) (-1843.828) [-1849.295] (-1840.422) * (-1847.696) [-1845.073] (-1846.370) (-1839.826) -- 0:01:07
709000 -- [-1844.036] (-1844.168) (-1842.983) (-1842.166) * (-1844.907) (-1845.893) [-1845.001] (-1846.583) -- 0:01:06
709500 -- (-1856.404) (-1844.813) (-1839.668) [-1845.450] * [-1843.709] (-1852.312) (-1844.507) (-1846.100) -- 0:01:06
710000 -- (-1844.075) (-1846.449) [-1840.727] (-1849.110) * (-1842.273) [-1838.917] (-1844.513) (-1850.650) -- 0:01:06
Average standard deviation of split frequencies: 0.000663
710500 -- [-1846.174] (-1846.605) (-1846.160) (-1844.926) * (-1846.076) (-1842.632) (-1847.784) [-1840.980] -- 0:01:06
711000 -- (-1841.974) (-1843.789) (-1844.208) [-1842.015] * (-1854.108) (-1843.515) [-1846.314] (-1840.155) -- 0:01:06
711500 -- [-1841.863] (-1842.196) (-1842.133) (-1850.360) * (-1846.895) (-1848.774) (-1848.285) [-1840.745] -- 0:01:06
712000 -- (-1843.454) (-1844.656) [-1846.578] (-1841.795) * (-1840.875) (-1855.558) (-1848.127) [-1838.703] -- 0:01:06
712500 -- (-1843.257) [-1844.999] (-1844.302) (-1847.534) * (-1848.116) (-1846.208) (-1850.582) [-1840.191] -- 0:01:06
713000 -- [-1844.221] (-1845.491) (-1845.627) (-1842.948) * [-1844.912] (-1843.334) (-1843.827) (-1848.412) -- 0:01:06
713500 -- (-1844.204) (-1846.801) (-1847.128) [-1840.029] * (-1842.252) (-1843.859) [-1839.656] (-1841.879) -- 0:01:05
714000 -- (-1844.418) (-1848.285) [-1846.979] (-1843.225) * (-1845.721) (-1846.710) (-1847.755) [-1850.173] -- 0:01:05
714500 -- [-1851.578] (-1844.753) (-1846.111) (-1841.406) * (-1844.875) [-1842.281] (-1847.777) (-1846.016) -- 0:01:05
715000 -- (-1848.972) [-1841.501] (-1844.014) (-1856.229) * [-1846.401] (-1845.508) (-1844.662) (-1842.536) -- 0:01:05
Average standard deviation of split frequencies: 0.000329
715500 -- [-1846.272] (-1843.369) (-1847.883) (-1846.979) * [-1846.541] (-1845.913) (-1845.471) (-1841.603) -- 0:01:05
716000 -- (-1853.726) [-1843.975] (-1847.556) (-1843.933) * (-1844.913) [-1847.610] (-1846.531) (-1844.479) -- 0:01:05
716500 -- (-1852.184) (-1841.649) (-1849.913) [-1843.659] * [-1846.011] (-1853.939) (-1843.735) (-1843.693) -- 0:01:05
717000 -- (-1846.238) (-1847.902) (-1843.470) [-1839.718] * (-1846.751) (-1842.690) (-1845.408) [-1842.474] -- 0:01:05
717500 -- [-1840.972] (-1842.816) (-1849.483) (-1855.154) * (-1840.859) [-1847.803] (-1843.496) (-1845.587) -- 0:01:04
718000 -- (-1843.723) [-1846.670] (-1851.780) (-1846.832) * (-1849.690) [-1844.021] (-1850.698) (-1845.548) -- 0:01:04
718500 -- [-1844.896] (-1841.430) (-1845.809) (-1848.218) * (-1845.853) (-1839.376) (-1843.104) [-1847.559] -- 0:01:04
719000 -- (-1840.260) (-1843.451) [-1840.829] (-1846.441) * [-1842.029] (-1846.366) (-1848.509) (-1840.205) -- 0:01:04
719500 -- (-1841.558) (-1842.347) (-1842.179) [-1845.197] * [-1843.421] (-1840.209) (-1846.298) (-1844.965) -- 0:01:04
720000 -- (-1853.955) (-1839.398) (-1846.023) [-1842.901] * (-1844.765) [-1839.331] (-1845.571) (-1850.246) -- 0:01:04
Average standard deviation of split frequencies: 0.000327
720500 -- [-1852.498] (-1845.346) (-1853.949) (-1843.059) * (-1847.273) [-1842.034] (-1852.569) (-1844.535) -- 0:01:04
721000 -- (-1854.421) [-1840.633] (-1847.045) (-1843.950) * [-1855.998] (-1847.822) (-1848.793) (-1842.517) -- 0:01:04
721500 -- [-1847.739] (-1848.598) (-1844.969) (-1846.712) * (-1856.367) (-1847.006) (-1847.631) [-1846.221] -- 0:01:04
722000 -- [-1853.485] (-1849.649) (-1841.350) (-1843.497) * (-1846.064) [-1848.215] (-1845.551) (-1841.324) -- 0:01:03
722500 -- [-1842.366] (-1854.108) (-1842.309) (-1844.825) * (-1846.222) (-1845.737) (-1840.026) [-1843.758] -- 0:01:03
723000 -- (-1847.231) (-1846.879) (-1844.276) [-1846.351] * (-1840.407) (-1848.345) (-1855.467) [-1849.173] -- 0:01:03
723500 -- (-1846.522) (-1843.667) (-1845.907) [-1845.415] * (-1848.161) (-1845.717) [-1846.359] (-1844.999) -- 0:01:03
724000 -- (-1844.523) [-1842.322] (-1844.061) (-1846.287) * [-1844.696] (-1843.052) (-1840.871) (-1845.974) -- 0:01:03
724500 -- (-1846.305) (-1845.221) [-1849.411] (-1854.677) * (-1843.808) [-1844.681] (-1842.371) (-1845.691) -- 0:01:03
725000 -- (-1844.205) (-1844.417) [-1844.395] (-1846.995) * (-1841.703) [-1841.421] (-1843.242) (-1845.220) -- 0:01:03
Average standard deviation of split frequencies: 0.000649
725500 -- [-1846.395] (-1840.871) (-1848.251) (-1843.643) * (-1843.390) (-1846.671) [-1843.647] (-1843.851) -- 0:01:03
726000 -- (-1854.275) (-1842.304) (-1847.183) [-1844.354] * (-1842.241) [-1843.349] (-1844.096) (-1842.325) -- 0:01:03
726500 -- (-1851.269) (-1843.220) [-1844.906] (-1851.642) * (-1843.445) [-1842.032] (-1849.241) (-1843.326) -- 0:01:02
727000 -- [-1840.266] (-1844.551) (-1854.028) (-1853.044) * (-1844.055) (-1850.238) [-1844.906] (-1847.941) -- 0:01:02
727500 -- (-1842.153) (-1839.603) (-1846.737) [-1840.673] * [-1842.537] (-1844.332) (-1843.735) (-1839.983) -- 0:01:02
728000 -- [-1843.937] (-1841.852) (-1850.659) (-1840.008) * (-1845.553) [-1842.369] (-1843.895) (-1845.477) -- 0:01:02
728500 -- (-1846.633) (-1843.316) (-1848.395) [-1840.570] * (-1839.145) [-1840.107] (-1846.486) (-1848.641) -- 0:01:02
729000 -- (-1843.713) [-1845.920] (-1847.687) (-1841.045) * [-1848.491] (-1841.153) (-1840.195) (-1841.817) -- 0:01:02
729500 -- (-1848.927) [-1847.138] (-1840.723) (-1846.165) * (-1841.586) (-1844.755) [-1844.227] (-1839.144) -- 0:01:02
730000 -- (-1848.307) (-1842.413) [-1844.806] (-1840.722) * (-1845.422) (-1843.997) [-1846.768] (-1844.680) -- 0:01:02
Average standard deviation of split frequencies: 0.000645
730500 -- (-1843.763) (-1849.547) [-1847.968] (-1849.456) * (-1846.158) [-1845.071] (-1842.197) (-1844.328) -- 0:01:01
731000 -- (-1844.588) (-1851.596) [-1840.333] (-1843.912) * [-1842.211] (-1845.587) (-1848.807) (-1840.426) -- 0:01:01
731500 -- [-1845.148] (-1844.859) (-1840.378) (-1843.799) * (-1843.825) [-1847.471] (-1846.824) (-1841.736) -- 0:01:01
732000 -- (-1845.944) (-1844.870) (-1845.057) [-1849.878] * (-1845.017) [-1843.099] (-1840.407) (-1839.040) -- 0:01:01
732500 -- (-1842.536) [-1844.056] (-1843.922) (-1849.434) * (-1842.842) (-1844.689) (-1843.011) [-1841.521] -- 0:01:01
733000 -- (-1841.680) [-1845.863] (-1841.784) (-1847.179) * (-1848.145) (-1845.362) [-1844.631] (-1846.276) -- 0:01:01
733500 -- (-1841.956) (-1847.431) [-1848.958] (-1844.763) * (-1846.940) [-1839.569] (-1850.640) (-1846.390) -- 0:01:01
734000 -- (-1843.165) (-1843.788) (-1850.314) [-1847.271] * (-1846.409) [-1846.611] (-1845.741) (-1842.897) -- 0:01:01
734500 -- (-1845.684) (-1845.276) [-1847.458] (-1846.240) * (-1845.668) (-1844.552) [-1849.495] (-1847.550) -- 0:01:01
735000 -- [-1839.299] (-1846.271) (-1844.762) (-1849.771) * (-1851.256) (-1847.460) (-1846.855) [-1847.932] -- 0:01:00
Average standard deviation of split frequencies: 0.000961
735500 -- (-1846.725) (-1850.322) (-1849.298) [-1844.264] * (-1846.594) (-1841.317) (-1843.420) [-1840.124] -- 0:01:00
736000 -- (-1840.846) (-1850.771) [-1846.144] (-1847.141) * (-1849.050) [-1840.294] (-1845.123) (-1842.558) -- 0:01:00
736500 -- [-1851.378] (-1843.045) (-1847.280) (-1848.775) * (-1847.816) [-1842.061] (-1846.854) (-1847.905) -- 0:01:00
737000 -- [-1842.628] (-1840.671) (-1847.451) (-1846.985) * (-1847.675) (-1840.014) (-1839.357) [-1844.921] -- 0:01:00
737500 -- (-1845.551) [-1850.196] (-1848.878) (-1848.546) * (-1851.997) [-1847.109] (-1840.691) (-1849.117) -- 0:01:00
738000 -- (-1847.948) (-1842.699) [-1848.310] (-1840.618) * (-1839.900) (-1854.586) (-1843.442) [-1843.878] -- 0:01:00
738500 -- (-1848.167) (-1845.047) [-1844.747] (-1844.285) * (-1840.151) (-1841.502) [-1842.726] (-1840.665) -- 0:01:00
739000 -- (-1840.931) (-1848.420) [-1840.374] (-1845.315) * (-1841.920) (-1843.417) (-1844.783) [-1843.974] -- 0:01:00
739500 -- (-1843.136) (-1840.407) (-1841.659) [-1847.184] * [-1844.909] (-1846.196) (-1842.425) (-1847.357) -- 0:00:59
740000 -- (-1846.374) [-1842.808] (-1850.101) (-1849.570) * (-1844.347) (-1847.455) (-1845.727) [-1839.996] -- 0:00:59
Average standard deviation of split frequencies: 0.000636
740500 -- (-1850.567) (-1842.568) [-1841.846] (-1845.394) * (-1844.616) [-1842.401] (-1847.156) (-1850.648) -- 0:00:59
741000 -- (-1843.044) (-1846.113) [-1848.550] (-1844.969) * (-1846.922) [-1840.138] (-1844.406) (-1846.937) -- 0:00:59
741500 -- (-1845.741) [-1849.303] (-1843.647) (-1842.552) * [-1846.332] (-1854.033) (-1843.263) (-1844.419) -- 0:00:59
742000 -- [-1842.996] (-1845.411) (-1843.233) (-1851.456) * (-1849.598) (-1844.080) (-1841.925) [-1844.026] -- 0:00:59
742500 -- (-1848.221) (-1838.510) (-1849.006) [-1842.434] * (-1842.256) [-1845.891] (-1851.850) (-1840.254) -- 0:00:59
743000 -- (-1850.388) (-1842.428) (-1847.153) [-1839.483] * [-1847.160] (-1842.685) (-1845.216) (-1840.154) -- 0:00:59
743500 -- (-1844.410) (-1842.585) (-1849.117) [-1843.024] * (-1849.103) [-1841.451] (-1846.585) (-1845.504) -- 0:00:58
744000 -- [-1841.623] (-1846.030) (-1853.120) (-1844.318) * (-1847.987) (-1847.548) [-1845.301] (-1844.327) -- 0:00:58
744500 -- (-1841.277) (-1844.081) (-1847.545) [-1841.514] * (-1848.458) (-1842.316) (-1845.271) [-1841.831] -- 0:00:58
745000 -- (-1854.901) (-1847.524) (-1850.797) [-1838.530] * [-1852.476] (-1842.711) (-1846.096) (-1843.358) -- 0:00:58
Average standard deviation of split frequencies: 0.000948
745500 -- (-1840.933) (-1850.159) (-1839.200) [-1842.834] * (-1845.859) (-1842.573) [-1844.002] (-1840.814) -- 0:00:58
746000 -- (-1843.290) (-1840.205) [-1843.852] (-1844.447) * (-1844.921) (-1848.334) [-1841.495] (-1842.594) -- 0:00:58
746500 -- [-1843.371] (-1845.402) (-1848.548) (-1848.872) * (-1847.539) [-1839.387] (-1840.154) (-1841.397) -- 0:00:58
747000 -- [-1843.030] (-1849.516) (-1841.665) (-1838.495) * (-1843.056) (-1841.792) (-1843.447) [-1843.062] -- 0:00:58
747500 -- (-1848.277) [-1847.094] (-1841.702) (-1840.060) * (-1849.570) (-1847.051) [-1842.653] (-1844.365) -- 0:00:58
748000 -- [-1844.995] (-1849.369) (-1849.223) (-1844.734) * (-1847.889) (-1840.263) [-1843.766] (-1843.855) -- 0:00:57
748500 -- (-1848.343) [-1846.408] (-1850.714) (-1844.707) * (-1845.833) (-1851.157) [-1845.651] (-1844.057) -- 0:00:57
749000 -- (-1846.394) (-1843.240) (-1852.069) [-1851.142] * (-1841.690) (-1842.542) [-1843.754] (-1844.282) -- 0:00:57
749500 -- (-1842.612) (-1843.493) (-1854.088) [-1845.694] * (-1841.699) (-1849.640) [-1842.496] (-1843.874) -- 0:00:57
750000 -- (-1844.972) [-1849.128] (-1846.252) (-1842.660) * [-1841.606] (-1847.874) (-1849.567) (-1845.138) -- 0:00:57
Average standard deviation of split frequencies: 0.001256
750500 -- (-1841.931) (-1843.405) (-1848.865) [-1842.780] * (-1854.178) (-1842.102) [-1840.146] (-1847.889) -- 0:00:57
751000 -- (-1843.370) (-1841.237) (-1848.799) [-1844.677] * (-1844.346) (-1846.155) [-1840.244] (-1850.388) -- 0:00:57
751500 -- (-1845.987) [-1841.949] (-1850.887) (-1849.606) * (-1842.837) (-1850.803) [-1840.898] (-1844.914) -- 0:00:57
752000 -- [-1839.175] (-1849.100) (-1848.526) (-1848.061) * (-1841.539) (-1848.549) (-1839.924) [-1839.961] -- 0:00:57
752500 -- (-1850.128) (-1844.256) [-1840.768] (-1848.356) * [-1842.670] (-1843.303) (-1841.677) (-1840.469) -- 0:00:56
753000 -- (-1842.978) (-1845.544) (-1851.864) [-1842.896] * (-1842.688) (-1840.042) [-1851.167] (-1847.354) -- 0:00:56
753500 -- [-1839.267] (-1844.345) (-1847.043) (-1846.675) * [-1845.112] (-1844.909) (-1843.735) (-1853.020) -- 0:00:56
754000 -- (-1845.169) (-1846.882) [-1848.758] (-1846.456) * (-1850.536) (-1848.429) [-1843.878] (-1845.916) -- 0:00:56
754500 -- [-1839.447] (-1848.473) (-1850.245) (-1846.283) * (-1843.186) (-1845.202) [-1843.032] (-1849.636) -- 0:00:56
755000 -- (-1843.855) [-1844.092] (-1843.957) (-1839.885) * (-1845.753) (-1845.340) [-1839.293] (-1851.059) -- 0:00:56
Average standard deviation of split frequencies: 0.001247
755500 -- (-1842.745) (-1843.528) [-1845.177] (-1845.541) * (-1841.788) (-1853.066) (-1839.369) [-1844.346] -- 0:00:56
756000 -- (-1844.008) (-1844.601) [-1843.247] (-1849.943) * (-1840.265) (-1848.985) [-1847.385] (-1842.997) -- 0:00:56
756500 -- (-1845.835) (-1851.725) (-1860.455) [-1850.090] * (-1842.628) (-1843.797) (-1843.607) [-1846.651] -- 0:00:56
757000 -- (-1848.180) [-1841.248] (-1851.941) (-1842.312) * (-1847.644) (-1841.114) [-1845.221] (-1845.450) -- 0:00:55
757500 -- (-1854.337) (-1847.494) [-1846.413] (-1847.989) * [-1838.794] (-1844.301) (-1843.597) (-1845.321) -- 0:00:55
758000 -- (-1838.877) (-1846.285) [-1844.391] (-1850.649) * [-1842.678] (-1839.051) (-1840.296) (-1846.503) -- 0:00:55
758500 -- (-1845.605) (-1844.955) (-1843.723) [-1847.331] * (-1844.684) (-1842.186) (-1842.097) [-1849.570] -- 0:00:55
759000 -- (-1841.143) (-1845.626) (-1849.016) [-1845.644] * (-1843.084) [-1846.173] (-1844.045) (-1839.456) -- 0:00:55
759500 -- (-1846.138) (-1845.125) (-1846.517) [-1848.415] * (-1842.412) (-1845.017) (-1846.888) [-1849.795] -- 0:00:55
760000 -- (-1846.932) [-1846.290] (-1845.443) (-1850.744) * (-1846.401) (-1849.229) [-1847.127] (-1841.502) -- 0:00:55
Average standard deviation of split frequencies: 0.001549
760500 -- (-1846.532) (-1846.926) [-1841.525] (-1843.375) * [-1842.062] (-1844.963) (-1844.023) (-1847.229) -- 0:00:55
761000 -- (-1843.626) [-1843.164] (-1842.742) (-1843.206) * [-1843.492] (-1846.792) (-1846.641) (-1842.778) -- 0:00:54
761500 -- [-1846.884] (-1852.552) (-1846.838) (-1850.661) * (-1844.286) [-1847.215] (-1849.244) (-1843.720) -- 0:00:54
762000 -- (-1843.228) [-1843.336] (-1846.831) (-1846.438) * [-1838.915] (-1842.968) (-1843.621) (-1845.825) -- 0:00:54
762500 -- [-1846.221] (-1840.700) (-1844.994) (-1840.760) * (-1840.721) [-1844.304] (-1843.122) (-1843.585) -- 0:00:54
763000 -- (-1842.119) [-1844.158] (-1842.890) (-1846.519) * (-1843.700) [-1842.117] (-1839.991) (-1841.157) -- 0:00:54
763500 -- (-1844.920) (-1841.949) [-1843.098] (-1843.434) * (-1844.997) [-1840.143] (-1845.121) (-1859.005) -- 0:00:54
764000 -- (-1840.307) (-1842.306) (-1841.156) [-1841.253] * (-1842.415) (-1840.580) (-1842.344) [-1842.644] -- 0:00:54
764500 -- [-1842.108] (-1844.560) (-1845.621) (-1861.403) * [-1842.162] (-1845.572) (-1840.652) (-1842.836) -- 0:00:54
765000 -- (-1845.669) [-1846.478] (-1848.132) (-1841.419) * (-1847.869) (-1847.301) [-1843.039] (-1841.914) -- 0:00:54
Average standard deviation of split frequencies: 0.001539
765500 -- (-1844.759) (-1841.860) [-1844.692] (-1848.063) * (-1845.396) (-1851.645) (-1845.951) [-1845.790] -- 0:00:53
766000 -- (-1844.793) [-1840.187] (-1839.687) (-1846.760) * (-1848.570) (-1844.202) [-1841.439] (-1843.857) -- 0:00:53
766500 -- (-1841.503) [-1840.570] (-1845.847) (-1844.217) * (-1845.340) (-1840.216) [-1838.238] (-1841.393) -- 0:00:53
767000 -- [-1846.651] (-1842.946) (-1843.976) (-1846.090) * (-1844.952) (-1856.853) [-1844.144] (-1847.797) -- 0:00:53
767500 -- [-1849.485] (-1855.818) (-1843.053) (-1843.709) * (-1843.931) (-1847.449) (-1854.304) [-1837.487] -- 0:00:53
768000 -- (-1848.716) [-1842.876] (-1837.857) (-1846.121) * [-1845.530] (-1853.809) (-1842.103) (-1846.321) -- 0:00:53
768500 -- (-1845.812) [-1841.596] (-1841.143) (-1849.508) * (-1846.431) (-1847.510) [-1843.060] (-1848.774) -- 0:00:53
769000 -- (-1842.865) [-1849.110] (-1839.100) (-1848.796) * (-1848.209) [-1843.714] (-1842.491) (-1843.689) -- 0:00:53
769500 -- (-1840.961) (-1842.234) [-1843.009] (-1843.682) * (-1842.607) (-1842.770) [-1846.729] (-1844.595) -- 0:00:53
770000 -- (-1844.030) (-1841.266) (-1843.842) [-1848.173] * (-1844.775) (-1844.114) (-1851.280) [-1841.858] -- 0:00:52
Average standard deviation of split frequencies: 0.001835
770500 -- (-1845.005) (-1846.091) [-1842.658] (-1846.149) * [-1842.893] (-1847.054) (-1841.267) (-1844.036) -- 0:00:52
771000 -- (-1846.383) [-1843.765] (-1840.791) (-1842.516) * (-1842.137) (-1849.172) (-1843.978) [-1844.170] -- 0:00:52
771500 -- (-1841.958) (-1845.730) [-1843.870] (-1841.769) * [-1845.027] (-1845.128) (-1846.285) (-1843.852) -- 0:00:52
772000 -- (-1840.918) (-1844.151) [-1843.725] (-1843.230) * (-1838.657) (-1848.956) (-1847.401) [-1842.510] -- 0:00:52
772500 -- (-1846.368) (-1841.198) (-1837.845) [-1840.911] * (-1843.184) [-1843.825] (-1844.868) (-1850.514) -- 0:00:52
773000 -- (-1844.220) [-1845.216] (-1845.398) (-1845.360) * [-1840.817] (-1848.901) (-1845.636) (-1847.857) -- 0:00:52
773500 -- [-1841.202] (-1843.467) (-1846.741) (-1853.748) * (-1841.328) (-1845.045) (-1842.510) [-1841.856] -- 0:00:52
774000 -- [-1846.191] (-1840.610) (-1847.038) (-1839.929) * [-1841.288] (-1839.550) (-1845.979) (-1851.855) -- 0:00:51
774500 -- (-1842.924) (-1847.006) (-1842.431) [-1844.578] * (-1839.120) [-1845.655] (-1847.657) (-1847.791) -- 0:00:51
775000 -- [-1837.898] (-1845.097) (-1844.195) (-1844.572) * [-1837.761] (-1841.009) (-1852.745) (-1848.508) -- 0:00:51
Average standard deviation of split frequencies: 0.001822
775500 -- (-1840.822) (-1840.609) (-1842.683) [-1838.308] * (-1842.407) [-1840.253] (-1850.106) (-1853.285) -- 0:00:51
776000 -- [-1842.561] (-1842.313) (-1842.004) (-1848.373) * [-1841.893] (-1851.129) (-1849.119) (-1850.966) -- 0:00:51
776500 -- (-1845.184) (-1837.377) (-1840.353) [-1840.132] * (-1848.225) (-1842.896) [-1843.853] (-1840.227) -- 0:00:51
777000 -- (-1841.913) (-1846.392) [-1843.046] (-1839.772) * (-1845.093) (-1842.803) [-1844.456] (-1849.546) -- 0:00:51
777500 -- (-1844.877) [-1840.332] (-1843.248) (-1847.019) * [-1841.594] (-1843.664) (-1846.215) (-1841.076) -- 0:00:51
778000 -- (-1844.011) (-1847.529) (-1846.890) [-1840.224] * [-1844.838] (-1838.583) (-1847.353) (-1840.902) -- 0:00:51
778500 -- (-1846.410) [-1841.669] (-1850.317) (-1841.567) * (-1843.359) (-1841.242) (-1842.842) [-1844.032] -- 0:00:50
779000 -- (-1845.374) (-1842.056) (-1841.526) [-1846.941] * [-1843.810] (-1841.224) (-1850.234) (-1844.695) -- 0:00:50
779500 -- [-1844.432] (-1849.863) (-1849.415) (-1843.048) * (-1845.744) [-1847.210] (-1847.527) (-1846.838) -- 0:00:50
780000 -- [-1841.487] (-1845.466) (-1849.958) (-1845.949) * (-1844.609) (-1848.808) [-1850.258] (-1846.711) -- 0:00:50
Average standard deviation of split frequencies: 0.001812
780500 -- (-1845.925) (-1844.451) (-1845.373) [-1846.220] * (-1844.986) (-1845.979) (-1843.701) [-1844.135] -- 0:00:50
781000 -- (-1839.432) (-1851.492) [-1842.353] (-1839.869) * (-1844.165) (-1843.868) [-1845.430] (-1844.699) -- 0:00:50
781500 -- (-1841.314) (-1846.126) (-1841.607) [-1846.994] * (-1845.485) (-1840.254) (-1845.228) [-1843.553] -- 0:00:50
782000 -- (-1844.736) (-1844.591) [-1847.455] (-1843.631) * (-1849.147) (-1842.821) [-1841.568] (-1846.362) -- 0:00:50
782500 -- (-1846.556) (-1845.094) (-1845.029) [-1839.573] * (-1838.616) (-1854.345) [-1838.810] (-1848.580) -- 0:00:50
783000 -- (-1847.118) [-1841.166] (-1843.310) (-1845.704) * (-1844.849) (-1851.156) [-1843.173] (-1840.884) -- 0:00:49
783500 -- (-1845.901) (-1843.441) [-1848.739] (-1844.179) * (-1842.331) [-1847.512] (-1856.557) (-1838.430) -- 0:00:49
784000 -- (-1847.416) (-1851.887) [-1847.673] (-1843.399) * [-1845.166] (-1844.078) (-1845.858) (-1842.423) -- 0:00:49
784500 -- (-1843.458) (-1844.381) [-1842.742] (-1843.963) * (-1838.773) (-1846.083) (-1844.847) [-1840.681] -- 0:00:49
785000 -- (-1845.997) (-1846.226) (-1840.011) [-1840.720] * (-1848.866) [-1841.660] (-1850.371) (-1844.620) -- 0:00:49
Average standard deviation of split frequencies: 0.002099
785500 -- (-1846.489) (-1848.233) [-1848.003] (-1846.522) * (-1847.713) [-1842.248] (-1843.234) (-1844.166) -- 0:00:49
786000 -- (-1846.591) [-1843.307] (-1842.921) (-1850.618) * [-1843.250] (-1840.424) (-1849.834) (-1840.449) -- 0:00:49
786500 -- (-1849.517) (-1845.075) [-1844.112] (-1848.741) * (-1844.525) (-1840.848) [-1844.233] (-1851.258) -- 0:00:49
787000 -- (-1842.468) (-1841.867) [-1850.084] (-1843.523) * (-1842.660) [-1844.268] (-1844.314) (-1848.672) -- 0:00:48
787500 -- [-1844.362] (-1843.906) (-1847.015) (-1841.029) * [-1841.022] (-1841.872) (-1843.563) (-1849.929) -- 0:00:48
788000 -- [-1841.635] (-1844.114) (-1841.714) (-1842.368) * [-1843.259] (-1838.931) (-1845.723) (-1840.905) -- 0:00:48
788500 -- [-1847.143] (-1849.882) (-1846.504) (-1847.101) * (-1842.033) (-1842.345) (-1848.908) [-1850.627] -- 0:00:48
789000 -- (-1846.355) (-1846.424) (-1845.893) [-1848.551] * [-1845.920] (-1841.416) (-1839.885) (-1846.245) -- 0:00:48
789500 -- (-1841.611) (-1849.169) [-1840.581] (-1856.384) * [-1840.035] (-1846.932) (-1840.588) (-1845.896) -- 0:00:48
790000 -- (-1846.193) (-1845.597) (-1844.267) [-1843.734] * [-1843.964] (-1849.365) (-1842.759) (-1841.650) -- 0:00:48
Average standard deviation of split frequencies: 0.002087
790500 -- (-1842.104) (-1839.447) [-1846.357] (-1850.225) * [-1840.155] (-1847.210) (-1843.663) (-1842.656) -- 0:00:48
791000 -- (-1838.540) (-1852.390) [-1844.933] (-1846.822) * [-1841.508] (-1847.464) (-1845.264) (-1840.845) -- 0:00:48
791500 -- (-1841.710) (-1843.980) (-1842.006) [-1841.725] * [-1842.962] (-1851.495) (-1843.822) (-1844.266) -- 0:00:47
792000 -- [-1842.305] (-1839.727) (-1846.857) (-1843.408) * (-1840.458) (-1842.105) [-1849.277] (-1842.869) -- 0:00:47
792500 -- [-1845.204] (-1843.289) (-1842.776) (-1848.050) * [-1843.198] (-1852.289) (-1844.045) (-1844.954) -- 0:00:47
793000 -- (-1844.515) (-1841.294) (-1844.945) [-1844.477] * [-1842.493] (-1847.092) (-1841.550) (-1846.795) -- 0:00:47
793500 -- [-1849.111] (-1845.058) (-1840.270) (-1848.516) * (-1844.285) (-1841.965) [-1846.924] (-1842.911) -- 0:00:47
794000 -- (-1856.246) [-1844.930] (-1839.985) (-1842.908) * (-1850.385) (-1842.128) [-1842.193] (-1843.612) -- 0:00:47
794500 -- (-1848.539) [-1840.958] (-1845.849) (-1844.922) * (-1842.704) (-1846.596) [-1842.801] (-1844.753) -- 0:00:47
795000 -- [-1847.030] (-1847.196) (-1843.233) (-1843.901) * [-1843.533] (-1849.594) (-1839.661) (-1845.775) -- 0:00:47
Average standard deviation of split frequencies: 0.002073
795500 -- (-1840.326) [-1842.643] (-1847.228) (-1848.126) * (-1844.022) (-1845.973) [-1847.313] (-1847.139) -- 0:00:47
796000 -- (-1841.871) (-1843.198) (-1844.460) [-1845.830] * (-1843.190) (-1843.946) [-1843.953] (-1837.445) -- 0:00:46
796500 -- (-1847.511) [-1845.001] (-1849.639) (-1849.123) * (-1842.575) (-1849.526) (-1849.191) [-1841.261] -- 0:00:46
797000 -- (-1845.556) [-1841.261] (-1845.532) (-1838.411) * (-1844.456) (-1847.365) (-1846.985) [-1842.056] -- 0:00:46
797500 -- (-1840.924) (-1847.586) [-1842.030] (-1838.176) * (-1843.327) (-1847.511) [-1845.182] (-1845.815) -- 0:00:46
798000 -- (-1841.588) (-1847.643) (-1846.969) [-1840.039] * (-1839.749) (-1843.523) (-1848.751) [-1839.778] -- 0:00:46
798500 -- (-1844.449) (-1850.283) [-1845.245] (-1843.101) * (-1840.901) (-1843.903) [-1841.555] (-1848.543) -- 0:00:46
799000 -- (-1843.073) [-1853.266] (-1845.623) (-1844.458) * [-1844.725] (-1842.892) (-1854.484) (-1847.007) -- 0:00:46
799500 -- [-1843.124] (-1846.109) (-1846.807) (-1840.793) * (-1839.158) (-1844.854) (-1847.194) [-1844.089] -- 0:00:46
800000 -- (-1840.145) (-1848.041) (-1848.467) [-1844.569] * [-1841.553] (-1846.723) (-1842.507) (-1845.691) -- 0:00:46
Average standard deviation of split frequencies: 0.002061
800500 -- (-1847.251) (-1843.942) (-1840.098) [-1847.677] * (-1842.810) (-1845.052) (-1845.777) [-1846.993] -- 0:00:45
801000 -- [-1840.623] (-1855.677) (-1839.325) (-1847.430) * (-1838.311) [-1843.684] (-1842.903) (-1843.309) -- 0:00:45
801500 -- (-1846.144) [-1841.280] (-1852.624) (-1840.188) * (-1855.695) (-1837.809) (-1845.199) [-1846.372] -- 0:00:45
802000 -- [-1838.847] (-1850.456) (-1848.158) (-1848.768) * (-1850.497) (-1841.816) [-1842.807] (-1841.563) -- 0:00:45
802500 -- (-1841.645) (-1841.597) (-1846.291) [-1842.492] * (-1840.459) [-1840.248] (-1850.524) (-1849.362) -- 0:00:45
803000 -- [-1839.579] (-1845.609) (-1841.667) (-1841.380) * (-1848.972) [-1841.538] (-1847.354) (-1849.442) -- 0:00:45
803500 -- (-1841.419) [-1846.978] (-1850.989) (-1842.343) * (-1845.159) [-1852.243] (-1846.165) (-1850.829) -- 0:00:45
804000 -- (-1847.505) (-1851.319) (-1848.339) [-1841.942] * [-1842.215] (-1846.285) (-1841.329) (-1847.552) -- 0:00:45
804500 -- [-1846.323] (-1850.058) (-1849.123) (-1840.737) * [-1839.964] (-1851.287) (-1850.572) (-1841.269) -- 0:00:44
805000 -- (-1843.209) (-1848.924) (-1843.371) [-1843.041] * [-1842.355] (-1843.959) (-1842.776) (-1843.273) -- 0:00:44
Average standard deviation of split frequencies: 0.002047
805500 -- (-1841.734) [-1848.471] (-1845.740) (-1845.376) * [-1841.445] (-1845.155) (-1850.811) (-1841.948) -- 0:00:44
806000 -- (-1847.928) (-1843.808) [-1845.007] (-1841.535) * (-1841.426) [-1842.405] (-1843.910) (-1841.679) -- 0:00:44
806500 -- (-1851.557) (-1840.070) (-1841.997) [-1841.365] * [-1844.838] (-1850.023) (-1843.773) (-1845.987) -- 0:00:44
807000 -- (-1847.113) (-1838.954) [-1850.143] (-1843.601) * (-1842.300) (-1851.976) [-1848.628] (-1849.759) -- 0:00:44
807500 -- (-1838.837) (-1847.799) (-1845.443) [-1848.839] * (-1858.228) (-1845.559) [-1841.750] (-1850.777) -- 0:00:44
808000 -- (-1841.353) (-1847.417) (-1843.174) [-1843.826] * (-1846.025) (-1849.689) (-1846.038) [-1842.425] -- 0:00:44
808500 -- (-1843.896) [-1841.094] (-1843.230) (-1848.205) * [-1845.173] (-1849.457) (-1847.717) (-1842.376) -- 0:00:44
809000 -- [-1847.585] (-1843.545) (-1839.563) (-1844.058) * (-1849.948) (-1842.911) (-1849.033) [-1842.151] -- 0:00:43
809500 -- (-1841.798) (-1843.750) (-1846.438) [-1844.741] * [-1841.674] (-1841.925) (-1843.341) (-1842.766) -- 0:00:43
810000 -- (-1843.217) [-1844.895] (-1843.906) (-1851.972) * [-1847.364] (-1842.487) (-1843.631) (-1853.189) -- 0:00:43
Average standard deviation of split frequencies: 0.002035
810500 -- (-1848.942) (-1846.340) (-1840.511) [-1838.993] * (-1855.361) (-1848.083) [-1843.274] (-1848.747) -- 0:00:43
811000 -- (-1842.321) (-1854.228) [-1841.162] (-1846.409) * (-1853.345) [-1842.385] (-1847.098) (-1845.960) -- 0:00:43
811500 -- [-1848.863] (-1847.398) (-1846.747) (-1848.633) * (-1848.267) (-1848.312) (-1845.658) [-1842.653] -- 0:00:43
812000 -- (-1843.597) (-1848.778) (-1846.097) [-1838.448] * [-1842.462] (-1843.086) (-1845.439) (-1844.620) -- 0:00:43
812500 -- (-1854.788) (-1844.134) [-1841.971] (-1846.384) * [-1841.991] (-1841.741) (-1849.716) (-1846.111) -- 0:00:43
813000 -- (-1850.523) [-1844.023] (-1844.838) (-1846.671) * (-1841.709) (-1851.186) (-1842.627) [-1840.218] -- 0:00:43
813500 -- (-1843.469) [-1845.464] (-1840.487) (-1843.397) * [-1840.427] (-1852.265) (-1843.153) (-1841.570) -- 0:00:42
814000 -- [-1845.818] (-1842.806) (-1841.099) (-1844.032) * (-1845.491) (-1844.187) [-1845.344] (-1846.025) -- 0:00:42
814500 -- (-1840.933) (-1843.329) (-1841.405) [-1839.999] * (-1844.057) [-1841.882] (-1850.557) (-1844.495) -- 0:00:42
815000 -- [-1846.548] (-1841.471) (-1849.592) (-1847.898) * (-1847.236) (-1842.761) (-1849.859) [-1848.000] -- 0:00:42
Average standard deviation of split frequencies: 0.002022
815500 -- (-1841.345) (-1843.197) [-1841.293] (-1851.769) * [-1845.973] (-1843.550) (-1845.166) (-1840.937) -- 0:00:42
816000 -- [-1843.977] (-1844.558) (-1848.347) (-1845.635) * [-1843.972] (-1840.367) (-1841.332) (-1845.903) -- 0:00:42
816500 -- [-1839.661] (-1842.569) (-1841.737) (-1843.007) * [-1841.932] (-1838.905) (-1847.794) (-1847.134) -- 0:00:42
817000 -- (-1841.541) [-1851.180] (-1842.333) (-1845.674) * (-1849.946) (-1850.508) [-1848.875] (-1852.611) -- 0:00:42
817500 -- [-1847.716] (-1848.731) (-1855.689) (-1847.896) * [-1849.055] (-1849.124) (-1859.163) (-1846.787) -- 0:00:41
818000 -- (-1848.891) (-1847.439) [-1846.247] (-1845.427) * [-1846.110] (-1846.106) (-1850.764) (-1844.718) -- 0:00:41
818500 -- (-1844.342) [-1844.465] (-1850.595) (-1848.181) * (-1851.454) [-1843.902] (-1850.930) (-1844.340) -- 0:00:41
819000 -- (-1849.977) (-1844.951) (-1847.726) [-1843.182] * (-1850.288) [-1840.734] (-1842.697) (-1848.453) -- 0:00:41
819500 -- [-1844.254] (-1839.630) (-1848.360) (-1849.661) * (-1849.919) [-1840.435] (-1846.862) (-1842.843) -- 0:00:41
820000 -- [-1846.220] (-1841.174) (-1840.717) (-1846.058) * (-1846.863) (-1845.542) (-1841.104) [-1845.488] -- 0:00:41
Average standard deviation of split frequencies: 0.002010
820500 -- [-1848.028] (-1851.265) (-1842.093) (-1847.949) * [-1845.073] (-1839.980) (-1844.124) (-1847.053) -- 0:00:41
821000 -- (-1844.295) (-1845.251) [-1843.792] (-1846.005) * [-1845.644] (-1847.373) (-1850.398) (-1844.571) -- 0:00:41
821500 -- [-1847.734] (-1854.138) (-1842.851) (-1846.144) * (-1847.800) (-1847.925) [-1847.374] (-1846.016) -- 0:00:41
822000 -- [-1840.937] (-1845.768) (-1849.243) (-1862.586) * (-1844.431) (-1845.079) [-1845.375] (-1847.502) -- 0:00:40
822500 -- [-1842.846] (-1842.879) (-1847.275) (-1851.162) * (-1846.424) [-1846.253] (-1843.747) (-1841.712) -- 0:00:40
823000 -- [-1840.358] (-1846.800) (-1842.224) (-1838.456) * [-1840.399] (-1846.966) (-1858.859) (-1847.455) -- 0:00:40
823500 -- (-1852.690) [-1840.624] (-1840.720) (-1844.666) * [-1838.590] (-1847.663) (-1850.196) (-1847.593) -- 0:00:40
824000 -- (-1850.001) (-1844.880) (-1841.612) [-1841.220] * (-1849.876) (-1842.869) [-1853.378] (-1844.027) -- 0:00:40
824500 -- (-1846.368) (-1845.394) (-1843.305) [-1845.463] * [-1842.136] (-1846.329) (-1850.436) (-1849.360) -- 0:00:40
825000 -- [-1843.418] (-1840.293) (-1842.575) (-1839.948) * (-1845.301) (-1846.904) [-1844.480] (-1847.659) -- 0:00:40
Average standard deviation of split frequencies: 0.001997
825500 -- (-1838.277) [-1846.690] (-1845.201) (-1844.799) * [-1838.717] (-1852.910) (-1849.696) (-1842.548) -- 0:00:40
826000 -- (-1843.490) (-1839.582) (-1848.615) [-1843.908] * [-1839.902] (-1848.938) (-1846.111) (-1842.514) -- 0:00:40
826500 -- (-1845.074) (-1847.695) (-1846.114) [-1842.211] * [-1847.660] (-1847.435) (-1849.687) (-1840.455) -- 0:00:39
827000 -- (-1850.459) [-1844.116] (-1845.837) (-1853.031) * [-1839.711] (-1843.701) (-1846.020) (-1849.909) -- 0:00:39
827500 -- (-1843.339) [-1844.912] (-1844.169) (-1851.485) * [-1841.722] (-1843.499) (-1847.206) (-1842.904) -- 0:00:39
828000 -- (-1845.022) (-1848.124) [-1847.605] (-1845.010) * (-1842.373) (-1843.191) [-1838.577] (-1850.882) -- 0:00:39
828500 -- (-1848.567) [-1844.803] (-1845.915) (-1844.445) * (-1841.918) [-1846.865] (-1842.850) (-1845.350) -- 0:00:39
829000 -- (-1850.991) [-1848.225] (-1845.055) (-1839.083) * [-1837.917] (-1846.613) (-1843.056) (-1847.940) -- 0:00:39
829500 -- (-1849.430) (-1845.011) (-1846.177) [-1837.940] * (-1844.357) [-1844.251] (-1843.044) (-1842.096) -- 0:00:39
830000 -- (-1843.713) (-1843.834) [-1842.289] (-1845.144) * [-1840.665] (-1856.037) (-1839.550) (-1846.205) -- 0:00:39
Average standard deviation of split frequencies: 0.001986
830500 -- (-1853.651) (-1847.064) (-1852.147) [-1838.257] * (-1847.151) (-1851.067) [-1849.256] (-1848.152) -- 0:00:38
831000 -- (-1848.576) (-1847.585) [-1839.135] (-1844.513) * [-1845.601] (-1847.431) (-1846.483) (-1844.053) -- 0:00:38
831500 -- (-1847.179) (-1843.654) (-1840.253) [-1842.119] * (-1848.522) [-1848.798] (-1843.359) (-1843.934) -- 0:00:38
832000 -- (-1847.343) (-1847.106) (-1839.252) [-1845.673] * (-1845.947) (-1850.968) [-1843.117] (-1851.330) -- 0:00:38
832500 -- (-1841.942) (-1839.803) (-1839.442) [-1840.680] * (-1842.905) (-1849.242) (-1846.932) [-1844.752] -- 0:00:38
833000 -- (-1841.641) (-1840.721) (-1851.959) [-1839.840] * (-1844.465) [-1846.916] (-1847.007) (-1843.768) -- 0:00:38
833500 -- [-1842.586] (-1840.764) (-1838.411) (-1843.067) * (-1841.609) (-1841.862) (-1848.112) [-1845.185] -- 0:00:38
834000 -- [-1839.970] (-1846.760) (-1840.308) (-1846.468) * (-1841.414) [-1844.325] (-1843.936) (-1847.014) -- 0:00:38
834500 -- (-1839.771) (-1846.854) (-1842.196) [-1842.831] * (-1845.767) (-1838.705) [-1840.673] (-1842.018) -- 0:00:38
835000 -- (-1844.584) (-1848.816) [-1847.460] (-1843.517) * (-1842.891) [-1842.869] (-1843.907) (-1843.647) -- 0:00:37
Average standard deviation of split frequencies: 0.001974
835500 -- [-1842.058] (-1844.698) (-1845.453) (-1844.670) * (-1848.180) (-1845.180) [-1842.409] (-1844.843) -- 0:00:37
836000 -- (-1848.969) [-1839.895] (-1848.594) (-1840.221) * (-1843.889) (-1844.339) [-1847.479] (-1843.135) -- 0:00:37
836500 -- (-1846.980) (-1839.603) (-1841.499) [-1841.180] * (-1844.605) [-1841.781] (-1846.770) (-1844.590) -- 0:00:37
837000 -- (-1840.766) [-1839.096] (-1845.999) (-1842.708) * (-1847.715) [-1846.693] (-1843.565) (-1856.808) -- 0:00:37
837500 -- (-1847.608) (-1840.549) (-1845.619) [-1840.766] * (-1841.731) [-1844.521] (-1848.709) (-1842.356) -- 0:00:37
838000 -- (-1845.752) (-1841.382) [-1843.528] (-1845.929) * (-1840.962) (-1848.220) (-1850.250) [-1846.502] -- 0:00:37
838500 -- (-1839.528) [-1847.274] (-1847.314) (-1842.480) * (-1840.333) [-1842.460] (-1844.296) (-1843.424) -- 0:00:37
839000 -- (-1847.590) [-1847.651] (-1843.652) (-1848.601) * [-1839.452] (-1840.313) (-1848.876) (-1846.350) -- 0:00:37
839500 -- (-1843.633) [-1849.393] (-1843.688) (-1845.458) * [-1842.738] (-1841.480) (-1846.676) (-1844.293) -- 0:00:36
840000 -- (-1850.505) [-1841.653] (-1845.792) (-1839.451) * (-1840.128) (-1844.379) (-1846.980) [-1840.108] -- 0:00:36
Average standard deviation of split frequencies: 0.001963
840500 -- (-1847.313) (-1846.410) (-1844.947) [-1846.100] * (-1839.238) (-1843.087) (-1854.336) [-1840.145] -- 0:00:36
841000 -- (-1852.164) (-1848.845) (-1846.704) [-1840.386] * [-1841.895] (-1843.865) (-1851.748) (-1839.763) -- 0:00:36
841500 -- (-1849.571) (-1851.459) [-1839.945] (-1848.849) * (-1844.971) [-1839.657] (-1841.523) (-1843.532) -- 0:00:36
842000 -- (-1850.895) (-1843.855) [-1843.945] (-1845.121) * [-1845.648] (-1840.362) (-1842.357) (-1840.976) -- 0:00:36
842500 -- [-1845.531] (-1840.432) (-1844.453) (-1843.991) * (-1847.724) (-1844.421) (-1843.341) [-1842.289] -- 0:00:36
843000 -- [-1845.955] (-1845.175) (-1842.404) (-1847.700) * (-1843.871) (-1841.301) [-1848.247] (-1843.786) -- 0:00:36
843500 -- (-1844.197) (-1842.737) (-1848.360) [-1847.111] * (-1844.503) (-1846.429) (-1849.383) [-1841.918] -- 0:00:35
844000 -- (-1845.602) [-1841.904] (-1841.251) (-1846.757) * (-1841.693) (-1844.354) [-1843.799] (-1854.139) -- 0:00:35
844500 -- [-1842.142] (-1843.281) (-1843.950) (-1851.622) * (-1843.743) (-1842.215) (-1847.184) [-1847.094] -- 0:00:35
845000 -- (-1846.101) (-1844.479) (-1849.272) [-1848.461] * [-1842.504] (-1841.222) (-1843.660) (-1845.390) -- 0:00:35
Average standard deviation of split frequencies: 0.001950
845500 -- [-1842.917] (-1844.393) (-1842.659) (-1842.403) * (-1840.816) [-1841.981] (-1846.421) (-1852.041) -- 0:00:35
846000 -- (-1844.244) (-1843.020) [-1841.394] (-1841.408) * (-1842.967) (-1841.730) (-1843.277) [-1840.946] -- 0:00:35
846500 -- (-1844.776) (-1849.451) [-1848.564] (-1839.438) * [-1843.300] (-1838.863) (-1843.688) (-1845.171) -- 0:00:35
847000 -- [-1840.903] (-1840.834) (-1851.115) (-1843.095) * [-1844.539] (-1858.368) (-1840.059) (-1846.210) -- 0:00:35
847500 -- (-1843.172) (-1844.588) [-1844.984] (-1840.925) * (-1843.973) (-1846.365) [-1840.869] (-1844.899) -- 0:00:35
848000 -- (-1846.862) (-1842.560) [-1841.162] (-1843.851) * [-1845.916] (-1841.164) (-1847.846) (-1844.455) -- 0:00:34
848500 -- (-1841.392) [-1848.463] (-1846.862) (-1847.513) * (-1846.050) [-1839.702] (-1848.976) (-1845.750) -- 0:00:34
849000 -- (-1853.189) [-1839.327] (-1847.951) (-1847.501) * (-1848.792) (-1844.049) (-1847.910) [-1847.337] -- 0:00:34
849500 -- (-1847.363) [-1839.342] (-1842.091) (-1837.774) * (-1842.162) (-1846.175) (-1844.774) [-1854.770] -- 0:00:34
850000 -- (-1839.587) [-1843.289] (-1847.498) (-1846.074) * (-1838.588) (-1848.859) (-1841.545) [-1845.064] -- 0:00:34
Average standard deviation of split frequencies: 0.001940
850500 -- (-1851.406) [-1842.286] (-1839.056) (-1840.315) * (-1843.566) (-1845.161) [-1845.762] (-1840.481) -- 0:00:34
851000 -- [-1843.785] (-1849.444) (-1847.689) (-1845.643) * (-1842.573) (-1845.811) (-1841.030) [-1841.138] -- 0:00:34
851500 -- (-1849.407) [-1841.554] (-1849.755) (-1847.063) * (-1847.201) (-1850.529) (-1841.782) [-1844.445] -- 0:00:34
852000 -- (-1841.810) (-1843.408) (-1848.212) [-1842.373] * (-1845.782) [-1850.759] (-1837.939) (-1840.644) -- 0:00:34
852500 -- (-1843.630) (-1842.396) (-1846.436) [-1846.866] * (-1846.790) [-1853.101] (-1845.762) (-1840.736) -- 0:00:33
853000 -- (-1849.789) [-1840.649] (-1846.214) (-1855.078) * (-1845.140) [-1846.157] (-1848.925) (-1842.713) -- 0:00:33
853500 -- (-1847.860) (-1845.763) (-1842.988) [-1849.140] * (-1843.557) (-1842.612) [-1839.401] (-1845.063) -- 0:00:33
854000 -- [-1841.074] (-1842.562) (-1847.052) (-1844.024) * (-1843.867) [-1840.214] (-1842.636) (-1847.679) -- 0:00:33
854500 -- [-1836.955] (-1852.097) (-1847.626) (-1843.794) * (-1848.112) (-1848.423) (-1842.730) [-1840.152] -- 0:00:33
855000 -- (-1843.371) [-1847.593] (-1848.153) (-1847.604) * (-1849.748) [-1838.587] (-1849.403) (-1852.624) -- 0:00:33
Average standard deviation of split frequencies: 0.001927
855500 -- (-1841.480) (-1844.671) (-1841.383) [-1844.818] * [-1843.094] (-1847.116) (-1846.109) (-1857.992) -- 0:00:33
856000 -- [-1844.344] (-1842.442) (-1842.575) (-1845.906) * (-1847.574) [-1844.660] (-1849.828) (-1845.909) -- 0:00:33
856500 -- (-1847.952) (-1850.299) (-1847.635) [-1848.240] * (-1846.902) [-1844.767] (-1846.311) (-1846.943) -- 0:00:33
857000 -- (-1842.161) (-1849.654) (-1843.081) [-1843.099] * (-1842.493) (-1846.626) [-1849.033] (-1852.771) -- 0:00:32
857500 -- (-1842.639) (-1844.928) (-1846.827) [-1840.417] * [-1841.788] (-1846.894) (-1847.128) (-1848.611) -- 0:00:32
858000 -- (-1846.730) [-1841.032] (-1856.936) (-1842.641) * [-1849.608] (-1844.831) (-1855.955) (-1842.004) -- 0:00:32
858500 -- (-1850.375) (-1842.244) (-1844.141) [-1839.305] * [-1842.413] (-1846.329) (-1849.208) (-1844.540) -- 0:00:32
859000 -- (-1857.653) [-1845.785] (-1852.884) (-1843.405) * (-1844.244) [-1839.991] (-1843.450) (-1845.179) -- 0:00:32
859500 -- (-1846.675) [-1851.032] (-1842.503) (-1848.033) * (-1839.947) [-1847.238] (-1842.748) (-1861.285) -- 0:00:32
860000 -- (-1850.983) (-1847.291) (-1846.619) [-1846.327] * (-1842.388) (-1847.348) (-1845.463) [-1846.841] -- 0:00:32
Average standard deviation of split frequencies: 0.001917
860500 -- [-1845.387] (-1839.567) (-1840.161) (-1843.591) * [-1844.311] (-1842.319) (-1847.653) (-1853.430) -- 0:00:32
861000 -- [-1845.260] (-1840.053) (-1845.503) (-1853.361) * (-1851.044) (-1841.019) (-1849.152) [-1846.046] -- 0:00:31
861500 -- (-1845.742) (-1840.587) (-1844.236) [-1841.145] * (-1849.446) (-1843.156) (-1845.267) [-1841.682] -- 0:00:31
862000 -- (-1846.210) (-1851.705) (-1846.162) [-1839.392] * (-1849.420) [-1849.710] (-1847.836) (-1841.978) -- 0:00:31
862500 -- (-1843.787) [-1843.409] (-1849.445) (-1843.631) * (-1844.768) (-1842.627) (-1841.920) [-1846.721] -- 0:00:31
863000 -- (-1845.570) [-1843.184] (-1848.581) (-1839.581) * (-1845.586) (-1843.112) [-1844.547] (-1845.663) -- 0:00:31
863500 -- [-1848.037] (-1845.038) (-1847.125) (-1843.094) * [-1846.072] (-1844.541) (-1843.171) (-1838.716) -- 0:00:31
864000 -- (-1841.870) [-1846.757] (-1843.852) (-1840.009) * (-1847.153) (-1841.691) [-1840.319] (-1845.638) -- 0:00:31
864500 -- [-1844.553] (-1848.756) (-1844.035) (-1841.686) * (-1844.332) (-1849.298) [-1842.265] (-1844.780) -- 0:00:31
865000 -- (-1844.682) [-1841.304] (-1841.655) (-1837.044) * [-1846.603] (-1840.278) (-1847.821) (-1843.800) -- 0:00:31
Average standard deviation of split frequencies: 0.001905
865500 -- (-1842.516) (-1847.819) (-1840.949) [-1840.183] * [-1842.555] (-1846.474) (-1846.529) (-1846.841) -- 0:00:30
866000 -- (-1842.324) [-1847.452] (-1845.690) (-1841.700) * [-1844.779] (-1841.798) (-1847.396) (-1845.836) -- 0:00:30
866500 -- (-1842.886) (-1848.245) [-1845.765] (-1844.468) * (-1846.205) [-1843.928] (-1841.382) (-1845.195) -- 0:00:30
867000 -- (-1846.633) (-1842.609) (-1843.675) [-1841.667] * (-1851.876) [-1846.330] (-1844.514) (-1845.138) -- 0:00:30
867500 -- (-1852.668) [-1845.240] (-1846.017) (-1845.479) * (-1838.043) (-1844.658) [-1842.806] (-1852.186) -- 0:00:30
868000 -- (-1849.650) [-1840.318] (-1847.162) (-1850.192) * [-1841.219] (-1840.699) (-1844.543) (-1853.020) -- 0:00:30
868500 -- (-1846.166) [-1843.012] (-1842.277) (-1841.834) * (-1841.990) [-1841.843] (-1843.006) (-1844.350) -- 0:00:30
869000 -- (-1854.203) [-1845.979] (-1838.579) (-1842.967) * [-1838.661] (-1836.914) (-1849.663) (-1840.668) -- 0:00:30
869500 -- (-1845.685) [-1843.044] (-1841.949) (-1847.833) * (-1840.206) [-1848.811] (-1841.907) (-1844.598) -- 0:00:30
870000 -- (-1848.784) [-1842.036] (-1847.399) (-1847.075) * [-1845.369] (-1841.750) (-1839.855) (-1840.855) -- 0:00:29
Average standard deviation of split frequencies: 0.001624
870500 -- (-1843.611) [-1840.700] (-1850.240) (-1847.538) * (-1850.729) [-1845.017] (-1853.672) (-1846.337) -- 0:00:29
871000 -- [-1840.716] (-1845.187) (-1847.465) (-1849.523) * (-1843.034) (-1841.073) [-1843.038] (-1844.642) -- 0:00:29
871500 -- [-1838.692] (-1845.963) (-1850.987) (-1848.333) * [-1841.600] (-1844.464) (-1843.374) (-1847.239) -- 0:00:29
872000 -- (-1840.330) (-1845.092) [-1848.243] (-1847.089) * (-1841.091) (-1843.333) (-1851.285) [-1847.867] -- 0:00:29
872500 -- (-1849.217) (-1843.237) (-1848.283) [-1840.763] * (-1845.997) [-1848.966] (-1848.645) (-1853.541) -- 0:00:29
873000 -- (-1843.870) (-1846.588) (-1854.879) [-1845.043] * (-1850.096) [-1843.691] (-1845.846) (-1847.785) -- 0:00:29
873500 -- (-1842.309) (-1845.225) (-1848.452) [-1842.072] * (-1843.360) [-1842.982] (-1847.416) (-1844.064) -- 0:00:29
874000 -- [-1839.978] (-1843.801) (-1856.121) (-1840.567) * (-1841.062) [-1841.809] (-1853.845) (-1849.339) -- 0:00:28
874500 -- (-1840.187) (-1849.372) (-1844.014) [-1845.558] * (-1842.516) [-1843.769] (-1847.157) (-1850.606) -- 0:00:28
875000 -- (-1845.066) (-1848.455) (-1841.608) [-1844.030] * [-1842.081] (-1843.488) (-1849.169) (-1843.802) -- 0:00:28
Average standard deviation of split frequencies: 0.001614
875500 -- [-1838.911] (-1848.990) (-1841.170) (-1852.999) * [-1853.373] (-1851.529) (-1842.056) (-1841.952) -- 0:00:28
876000 -- (-1845.609) [-1841.867] (-1847.124) (-1852.963) * (-1844.621) [-1840.412] (-1847.652) (-1848.204) -- 0:00:28
876500 -- (-1846.675) (-1842.319) (-1844.019) [-1842.444] * [-1845.075] (-1847.875) (-1839.744) (-1848.664) -- 0:00:28
877000 -- (-1844.522) (-1841.757) [-1841.507] (-1843.989) * (-1846.503) [-1848.836] (-1849.296) (-1845.640) -- 0:00:28
877500 -- (-1850.752) [-1844.283] (-1840.807) (-1843.587) * (-1843.864) [-1842.239] (-1844.775) (-1850.615) -- 0:00:28
878000 -- (-1845.005) (-1851.958) [-1844.332] (-1843.230) * (-1844.279) [-1846.179] (-1855.675) (-1851.267) -- 0:00:28
878500 -- (-1848.931) (-1853.224) (-1843.751) [-1843.251] * (-1844.545) (-1842.176) (-1842.519) [-1840.708] -- 0:00:27
879000 -- (-1845.647) (-1851.083) [-1844.223] (-1844.060) * [-1840.602] (-1841.501) (-1846.609) (-1847.200) -- 0:00:27
879500 -- [-1838.716] (-1843.573) (-1839.968) (-1843.403) * (-1843.815) (-1846.857) [-1841.822] (-1853.120) -- 0:00:27
880000 -- [-1842.334] (-1851.876) (-1845.641) (-1845.984) * (-1844.001) (-1845.804) [-1847.545] (-1846.473) -- 0:00:27
Average standard deviation of split frequencies: 0.001606
880500 -- (-1840.851) (-1839.043) (-1843.205) [-1838.796] * (-1838.607) (-1843.282) (-1840.052) [-1846.962] -- 0:00:27
881000 -- [-1845.956] (-1850.412) (-1844.050) (-1839.952) * [-1841.698] (-1848.260) (-1850.674) (-1848.910) -- 0:00:27
881500 -- (-1840.362) (-1843.055) [-1842.170] (-1841.211) * [-1843.149] (-1850.503) (-1847.358) (-1843.614) -- 0:00:27
882000 -- (-1841.422) [-1841.193] (-1839.928) (-1840.361) * (-1850.978) (-1847.914) [-1843.284] (-1845.068) -- 0:00:27
882500 -- (-1842.422) (-1845.809) [-1841.067] (-1842.771) * (-1845.357) (-1845.155) [-1850.601] (-1845.935) -- 0:00:27
883000 -- (-1843.979) [-1848.369] (-1844.225) (-1843.637) * (-1845.771) (-1842.526) (-1846.331) [-1843.687] -- 0:00:26
883500 -- (-1845.135) (-1844.498) [-1843.993] (-1840.290) * [-1845.237] (-1846.694) (-1850.298) (-1845.177) -- 0:00:26
884000 -- (-1849.382) [-1842.198] (-1842.445) (-1847.818) * (-1844.609) [-1849.960] (-1840.420) (-1856.988) -- 0:00:26
884500 -- [-1844.379] (-1845.201) (-1844.891) (-1844.437) * (-1846.197) (-1845.082) [-1844.038] (-1857.308) -- 0:00:26
885000 -- (-1846.347) (-1847.187) (-1852.315) [-1841.384] * (-1851.554) [-1845.784] (-1845.754) (-1851.475) -- 0:00:26
Average standard deviation of split frequencies: 0.001330
885500 -- (-1850.126) (-1843.513) [-1843.199] (-1850.052) * (-1843.521) (-1849.820) (-1847.662) [-1841.263] -- 0:00:26
886000 -- (-1846.755) (-1847.781) (-1856.475) [-1844.085] * (-1840.648) (-1841.658) [-1844.812] (-1845.727) -- 0:00:26
886500 -- [-1842.598] (-1843.222) (-1850.290) (-1845.050) * (-1843.191) (-1842.332) [-1843.517] (-1847.278) -- 0:00:26
887000 -- [-1845.901] (-1847.815) (-1842.203) (-1839.216) * (-1849.836) [-1845.166] (-1840.979) (-1840.751) -- 0:00:25
887500 -- (-1842.814) (-1849.082) (-1845.367) [-1850.734] * (-1848.870) [-1847.523] (-1839.061) (-1842.060) -- 0:00:25
888000 -- (-1843.480) (-1846.911) (-1846.500) [-1841.788] * (-1849.120) [-1842.968] (-1842.747) (-1848.130) -- 0:00:25
888500 -- (-1845.125) (-1849.972) (-1845.078) [-1843.429] * (-1842.683) (-1847.846) (-1847.192) [-1842.001] -- 0:00:25
889000 -- (-1844.801) (-1848.852) [-1845.386] (-1848.344) * (-1843.326) (-1846.781) [-1848.614] (-1839.595) -- 0:00:25
889500 -- [-1840.458] (-1840.112) (-1850.252) (-1844.094) * (-1843.826) (-1845.858) (-1839.686) [-1842.255] -- 0:00:25
890000 -- (-1837.275) (-1848.186) [-1840.705] (-1845.842) * (-1841.545) (-1846.054) (-1842.021) [-1846.501] -- 0:00:25
Average standard deviation of split frequencies: 0.001323
890500 -- [-1840.304] (-1841.966) (-1842.042) (-1845.171) * [-1845.625] (-1857.511) (-1841.892) (-1845.449) -- 0:00:25
891000 -- (-1849.853) (-1842.315) (-1845.268) [-1852.187] * (-1843.094) [-1843.109] (-1852.722) (-1838.548) -- 0:00:25
891500 -- (-1840.516) (-1844.659) (-1845.062) [-1851.022] * (-1847.077) (-1845.513) (-1844.737) [-1846.405] -- 0:00:24
892000 -- (-1841.717) [-1847.819] (-1846.482) (-1842.324) * (-1842.863) [-1842.551] (-1842.905) (-1849.860) -- 0:00:24
892500 -- (-1854.281) [-1845.707] (-1845.434) (-1842.825) * (-1843.568) [-1842.572] (-1845.205) (-1847.778) -- 0:00:24
893000 -- (-1847.341) (-1853.766) [-1843.280] (-1844.775) * (-1847.746) [-1842.500] (-1848.712) (-1847.425) -- 0:00:24
893500 -- (-1847.809) (-1846.647) [-1845.099] (-1847.338) * (-1847.005) (-1847.655) [-1842.595] (-1843.493) -- 0:00:24
894000 -- (-1850.737) (-1846.954) (-1841.937) [-1853.053] * [-1842.278] (-1845.078) (-1842.602) (-1841.539) -- 0:00:24
894500 -- (-1857.785) (-1843.329) [-1847.276] (-1841.722) * (-1841.764) [-1846.043] (-1840.506) (-1844.474) -- 0:00:24
895000 -- (-1845.562) (-1847.805) (-1850.620) [-1843.157] * (-1844.022) (-1840.140) (-1841.665) [-1841.550] -- 0:00:24
Average standard deviation of split frequencies: 0.001315
895500 -- (-1838.555) [-1837.253] (-1842.315) (-1843.178) * (-1839.519) (-1846.919) (-1846.750) [-1842.512] -- 0:00:24
896000 -- (-1841.183) (-1852.426) [-1843.296] (-1841.128) * (-1850.969) [-1853.527] (-1844.690) (-1841.423) -- 0:00:23
896500 -- (-1850.485) (-1842.152) [-1839.336] (-1842.313) * (-1858.833) [-1843.380] (-1853.667) (-1842.295) -- 0:00:23
897000 -- [-1839.069] (-1848.874) (-1849.753) (-1847.334) * (-1850.210) (-1845.095) [-1850.258] (-1851.467) -- 0:00:23
897500 -- [-1846.767] (-1851.947) (-1850.054) (-1846.031) * (-1846.110) (-1845.271) [-1849.360] (-1841.273) -- 0:00:23
898000 -- (-1843.729) (-1841.202) [-1846.421] (-1842.966) * (-1854.840) (-1845.199) (-1846.508) [-1846.898] -- 0:00:23
898500 -- (-1844.498) (-1844.582) [-1843.141] (-1845.084) * (-1847.332) [-1845.868] (-1844.493) (-1843.531) -- 0:00:23
899000 -- (-1844.496) (-1845.060) [-1849.618] (-1851.184) * [-1847.113] (-1847.175) (-1844.400) (-1845.059) -- 0:00:23
899500 -- (-1841.850) (-1841.260) (-1848.319) [-1849.568] * (-1846.168) [-1841.494] (-1852.501) (-1837.596) -- 0:00:23
900000 -- [-1843.073] (-1843.557) (-1843.305) (-1846.058) * (-1847.823) [-1841.454] (-1846.626) (-1843.671) -- 0:00:23
Average standard deviation of split frequencies: 0.001308
900500 -- (-1840.730) [-1841.367] (-1842.672) (-1843.361) * [-1847.730] (-1843.966) (-1839.314) (-1848.149) -- 0:00:22
901000 -- (-1844.487) (-1839.576) [-1841.080] (-1842.433) * (-1840.752) [-1845.004] (-1841.738) (-1840.502) -- 0:00:22
901500 -- [-1845.376] (-1841.019) (-1844.368) (-1855.538) * (-1843.741) (-1845.777) [-1846.896] (-1840.044) -- 0:00:22
902000 -- (-1844.794) [-1843.252] (-1849.586) (-1845.313) * [-1842.853] (-1841.114) (-1850.399) (-1843.489) -- 0:00:22
902500 -- (-1851.760) (-1842.520) (-1853.280) [-1843.323] * (-1847.356) [-1847.467] (-1847.225) (-1841.543) -- 0:00:22
903000 -- (-1848.344) [-1844.926] (-1848.357) (-1846.562) * (-1845.066) (-1844.126) (-1850.535) [-1845.117] -- 0:00:22
903500 -- (-1845.064) [-1840.495] (-1847.639) (-1845.551) * (-1843.168) (-1846.362) [-1849.572] (-1855.263) -- 0:00:22
904000 -- (-1841.464) (-1842.875) [-1849.231] (-1844.133) * (-1847.179) (-1844.866) (-1846.030) [-1846.809] -- 0:00:22
904500 -- (-1848.994) (-1843.752) (-1854.172) [-1846.942] * (-1846.906) (-1846.120) [-1845.972] (-1850.643) -- 0:00:21
905000 -- (-1844.926) (-1846.436) [-1845.033] (-1844.976) * (-1842.413) [-1845.974] (-1846.026) (-1841.524) -- 0:00:21
Average standard deviation of split frequencies: 0.001301
905500 -- [-1843.539] (-1846.241) (-1846.134) (-1841.844) * (-1838.744) [-1844.488] (-1846.737) (-1844.903) -- 0:00:21
906000 -- [-1843.246] (-1846.719) (-1843.790) (-1842.719) * (-1843.682) (-1846.151) (-1843.081) [-1849.273] -- 0:00:21
906500 -- (-1844.430) (-1846.198) [-1849.391] (-1840.663) * [-1846.431] (-1847.825) (-1844.042) (-1846.223) -- 0:00:21
907000 -- (-1845.940) (-1841.516) (-1845.255) [-1842.926] * (-1845.702) (-1842.290) (-1840.839) [-1840.554] -- 0:00:21
907500 -- (-1841.638) (-1848.978) [-1839.181] (-1845.222) * (-1849.957) [-1838.891] (-1845.423) (-1841.370) -- 0:00:21
908000 -- (-1838.967) (-1846.822) (-1840.849) [-1840.065] * (-1848.262) [-1840.105] (-1845.855) (-1842.713) -- 0:00:21
908500 -- (-1843.758) (-1846.325) (-1840.567) [-1842.337] * (-1844.699) (-1842.578) [-1850.931] (-1848.052) -- 0:00:21
909000 -- [-1844.318] (-1844.127) (-1843.039) (-1848.099) * (-1845.478) (-1843.960) (-1842.304) [-1843.074] -- 0:00:20
909500 -- (-1852.166) (-1844.779) [-1842.572] (-1857.620) * (-1845.430) [-1844.451] (-1847.932) (-1844.288) -- 0:00:20
910000 -- (-1847.811) (-1843.107) [-1841.670] (-1849.573) * (-1847.574) (-1848.637) (-1854.004) [-1848.447] -- 0:00:20
Average standard deviation of split frequencies: 0.001294
910500 -- (-1844.060) [-1845.755] (-1841.307) (-1848.835) * [-1843.913] (-1846.390) (-1842.030) (-1840.809) -- 0:00:20
911000 -- (-1846.104) (-1846.270) (-1840.813) [-1846.412] * (-1850.341) (-1847.942) [-1849.470] (-1842.666) -- 0:00:20
911500 -- (-1847.382) [-1842.143] (-1844.827) (-1840.577) * (-1840.698) (-1845.007) [-1843.048] (-1843.842) -- 0:00:20
912000 -- (-1842.747) [-1838.720] (-1848.250) (-1841.006) * [-1842.320] (-1857.417) (-1840.455) (-1850.602) -- 0:00:20
912500 -- (-1845.559) (-1842.190) (-1843.312) [-1842.182] * (-1840.974) (-1851.041) [-1841.908] (-1847.469) -- 0:00:20
913000 -- (-1842.183) [-1841.088] (-1844.753) (-1841.595) * (-1844.969) (-1840.625) (-1848.338) [-1843.767] -- 0:00:20
913500 -- [-1841.894] (-1848.730) (-1847.420) (-1846.225) * (-1845.715) [-1847.939] (-1841.492) (-1847.658) -- 0:00:19
914000 -- [-1841.050] (-1847.233) (-1844.676) (-1846.124) * (-1846.351) (-1844.682) [-1846.958] (-1846.175) -- 0:00:19
914500 -- (-1844.258) (-1848.474) (-1844.053) [-1841.706] * (-1850.421) (-1841.434) (-1845.380) [-1844.904] -- 0:00:19
915000 -- [-1840.337] (-1847.134) (-1853.351) (-1842.975) * (-1839.603) (-1849.706) [-1839.460] (-1841.653) -- 0:00:19
Average standard deviation of split frequencies: 0.001544
915500 -- (-1840.325) (-1846.986) [-1849.927] (-1842.519) * (-1843.164) (-1847.795) [-1843.585] (-1850.547) -- 0:00:19
916000 -- [-1841.901] (-1848.564) (-1858.697) (-1846.986) * (-1842.854) [-1847.796] (-1845.443) (-1844.323) -- 0:00:19
916500 -- (-1843.945) [-1847.908] (-1857.801) (-1844.639) * (-1841.830) (-1840.342) (-1854.881) [-1842.612] -- 0:00:19
917000 -- (-1848.342) (-1846.114) (-1854.831) [-1846.822] * (-1845.969) (-1844.440) (-1844.363) [-1839.709] -- 0:00:19
917500 -- (-1849.656) (-1850.607) [-1842.905] (-1841.895) * (-1850.546) [-1844.508] (-1841.727) (-1841.698) -- 0:00:18
918000 -- [-1839.435] (-1846.264) (-1860.767) (-1841.541) * (-1854.363) [-1850.530] (-1839.313) (-1842.378) -- 0:00:18
918500 -- (-1844.715) (-1849.990) (-1847.029) [-1841.695] * (-1848.665) (-1848.307) (-1846.483) [-1843.116] -- 0:00:18
919000 -- (-1844.683) [-1843.079] (-1844.626) (-1844.594) * (-1847.866) [-1845.705] (-1847.388) (-1846.683) -- 0:00:18
919500 -- (-1849.324) [-1851.093] (-1841.786) (-1841.604) * (-1846.304) (-1846.506) [-1843.872] (-1843.008) -- 0:00:18
920000 -- [-1847.906] (-1843.388) (-1842.677) (-1851.640) * [-1843.124] (-1843.584) (-1848.611) (-1844.642) -- 0:00:18
Average standard deviation of split frequencies: 0.001536
920500 -- (-1849.411) [-1842.579] (-1848.233) (-1843.721) * (-1856.710) (-1840.640) (-1847.562) [-1846.566] -- 0:00:18
921000 -- [-1844.868] (-1851.473) (-1844.395) (-1858.157) * (-1848.272) (-1840.842) [-1840.493] (-1840.929) -- 0:00:18
921500 -- [-1845.854] (-1848.466) (-1842.917) (-1842.633) * (-1853.344) [-1840.935] (-1846.535) (-1844.409) -- 0:00:18
922000 -- (-1844.087) (-1840.635) (-1842.882) [-1844.471] * (-1852.128) (-1848.664) [-1842.682] (-1846.252) -- 0:00:17
922500 -- (-1846.433) (-1850.642) (-1847.916) [-1838.615] * (-1844.985) (-1847.868) [-1839.440] (-1855.991) -- 0:00:17
923000 -- (-1841.868) (-1840.420) (-1852.458) [-1842.503] * [-1848.662] (-1853.153) (-1843.142) (-1853.724) -- 0:00:17
923500 -- (-1844.249) (-1842.002) [-1855.277] (-1843.801) * (-1844.433) [-1850.806] (-1842.550) (-1839.229) -- 0:00:17
924000 -- (-1841.692) (-1848.643) [-1850.619] (-1846.372) * (-1851.793) (-1845.717) [-1839.929] (-1844.488) -- 0:00:17
924500 -- (-1852.286) (-1839.841) [-1843.224] (-1844.670) * (-1847.804) (-1845.512) [-1844.565] (-1846.324) -- 0:00:17
925000 -- (-1848.459) (-1838.656) (-1842.945) [-1843.425] * (-1849.045) (-1849.747) [-1849.652] (-1850.071) -- 0:00:17
Average standard deviation of split frequencies: 0.001527
925500 -- (-1843.553) (-1842.718) [-1841.280] (-1855.623) * (-1847.130) (-1840.002) (-1838.858) [-1843.357] -- 0:00:17
926000 -- (-1841.587) [-1840.005] (-1842.561) (-1848.094) * (-1839.554) (-1841.631) [-1846.325] (-1846.560) -- 0:00:17
926500 -- (-1840.390) (-1839.796) [-1848.327] (-1850.147) * (-1844.436) (-1842.591) [-1843.057] (-1845.835) -- 0:00:16
927000 -- (-1842.264) [-1840.184] (-1844.030) (-1844.662) * (-1852.958) (-1845.022) [-1839.486] (-1846.772) -- 0:00:16
927500 -- [-1844.080] (-1842.802) (-1850.543) (-1843.918) * (-1847.542) [-1844.391] (-1845.649) (-1843.602) -- 0:00:16
928000 -- [-1842.705] (-1840.880) (-1850.197) (-1842.407) * (-1844.841) (-1843.111) (-1841.273) [-1841.972] -- 0:00:16
928500 -- (-1846.171) (-1843.239) (-1847.036) [-1847.391] * (-1847.089) [-1841.810] (-1844.913) (-1846.220) -- 0:00:16
929000 -- [-1842.861] (-1842.354) (-1846.545) (-1846.831) * [-1839.494] (-1846.902) (-1851.419) (-1840.688) -- 0:00:16
929500 -- (-1848.289) [-1840.205] (-1844.428) (-1843.536) * (-1841.979) [-1846.038] (-1848.208) (-1842.440) -- 0:00:16
930000 -- [-1842.183] (-1844.338) (-1850.354) (-1842.957) * (-1843.922) (-1845.284) (-1844.086) [-1841.553] -- 0:00:16
Average standard deviation of split frequencies: 0.001266
930500 -- [-1846.280] (-1841.653) (-1851.439) (-1843.636) * (-1843.817) (-1845.321) [-1844.218] (-1844.514) -- 0:00:15
931000 -- (-1839.691) [-1840.761] (-1847.100) (-1846.906) * [-1839.058] (-1846.049) (-1840.189) (-1847.388) -- 0:00:15
931500 -- (-1844.194) [-1841.097] (-1840.027) (-1842.172) * [-1839.731] (-1843.461) (-1844.335) (-1841.182) -- 0:00:15
932000 -- (-1841.468) [-1838.750] (-1850.388) (-1846.290) * (-1848.492) [-1840.008] (-1846.448) (-1841.278) -- 0:00:15
932500 -- (-1845.790) [-1844.125] (-1844.319) (-1839.706) * (-1846.920) (-1840.152) [-1844.509] (-1856.012) -- 0:00:15
933000 -- (-1845.890) (-1842.240) (-1842.647) [-1841.131] * (-1841.709) [-1846.171] (-1839.281) (-1843.531) -- 0:00:15
933500 -- (-1843.578) (-1848.371) (-1843.390) [-1849.024] * [-1840.184] (-1846.950) (-1844.034) (-1848.623) -- 0:00:15
934000 -- (-1851.707) (-1842.742) (-1845.715) [-1845.865] * (-1843.182) (-1850.714) [-1846.311] (-1844.415) -- 0:00:15
934500 -- (-1843.852) [-1842.673] (-1845.918) (-1857.504) * (-1841.498) [-1847.980] (-1847.536) (-1847.603) -- 0:00:15
935000 -- (-1843.745) (-1842.717) (-1847.590) [-1845.802] * (-1841.785) (-1850.260) (-1844.792) [-1844.021] -- 0:00:14
Average standard deviation of split frequencies: 0.001259
935500 -- [-1846.754] (-1844.812) (-1841.355) (-1841.924) * (-1842.525) [-1852.805] (-1840.191) (-1843.229) -- 0:00:14
936000 -- (-1844.603) (-1848.729) [-1841.308] (-1842.798) * (-1846.162) (-1853.876) (-1846.313) [-1843.365] -- 0:00:14
936500 -- (-1841.482) (-1848.339) (-1843.582) [-1850.373] * [-1844.131] (-1847.646) (-1854.423) (-1843.215) -- 0:00:14
937000 -- (-1842.501) (-1851.344) (-1841.354) [-1846.867] * (-1840.760) (-1841.659) (-1840.689) [-1844.122] -- 0:00:14
937500 -- (-1847.332) [-1841.544] (-1846.236) (-1850.946) * [-1840.472] (-1842.945) (-1844.589) (-1842.151) -- 0:00:14
938000 -- (-1850.602) (-1842.245) [-1841.990] (-1845.676) * [-1841.055] (-1840.615) (-1848.332) (-1842.183) -- 0:00:14
938500 -- (-1854.026) [-1855.690] (-1846.885) (-1844.136) * (-1847.882) [-1843.805] (-1846.058) (-1846.416) -- 0:00:14
939000 -- (-1842.286) (-1842.984) [-1842.439] (-1847.130) * (-1846.749) (-1849.728) (-1842.573) [-1842.543] -- 0:00:14
939500 -- (-1842.200) [-1843.754] (-1845.394) (-1840.667) * (-1843.956) [-1842.218] (-1851.517) (-1838.422) -- 0:00:13
940000 -- (-1843.533) (-1848.183) [-1846.617] (-1842.980) * [-1842.358] (-1840.594) (-1847.565) (-1842.668) -- 0:00:13
Average standard deviation of split frequencies: 0.001253
940500 -- [-1846.309] (-1847.200) (-1845.567) (-1845.007) * (-1844.742) (-1845.970) (-1844.318) [-1840.020] -- 0:00:13
941000 -- (-1843.887) (-1841.761) [-1845.089] (-1842.680) * [-1843.233] (-1844.779) (-1846.573) (-1842.072) -- 0:00:13
941500 -- (-1844.055) (-1847.465) (-1842.677) [-1845.275] * (-1851.168) (-1845.776) [-1843.086] (-1842.227) -- 0:00:13
942000 -- [-1841.723] (-1845.203) (-1843.798) (-1843.051) * (-1842.075) [-1842.397] (-1853.119) (-1849.064) -- 0:00:13
942500 -- (-1841.314) (-1845.170) [-1842.418] (-1846.175) * (-1845.620) (-1842.626) [-1840.842] (-1841.369) -- 0:00:13
943000 -- [-1838.440] (-1845.147) (-1844.653) (-1841.765) * (-1842.431) (-1844.664) [-1839.608] (-1848.479) -- 0:00:13
943500 -- [-1842.127] (-1844.557) (-1841.982) (-1851.651) * (-1844.083) (-1846.014) (-1839.691) [-1844.025] -- 0:00:12
944000 -- (-1840.076) (-1844.632) [-1845.495] (-1843.565) * [-1845.945] (-1840.532) (-1841.645) (-1842.426) -- 0:00:12
944500 -- [-1839.400] (-1846.306) (-1854.981) (-1842.620) * (-1841.134) (-1843.064) [-1844.345] (-1842.355) -- 0:00:12
945000 -- (-1839.841) [-1844.545] (-1841.640) (-1846.912) * (-1846.004) (-1852.653) [-1846.539] (-1854.753) -- 0:00:12
Average standard deviation of split frequencies: 0.001246
945500 -- (-1842.089) (-1841.900) [-1840.229] (-1843.218) * (-1843.321) [-1847.973] (-1840.190) (-1850.385) -- 0:00:12
946000 -- (-1846.376) [-1840.522] (-1842.233) (-1844.825) * [-1845.246] (-1845.615) (-1849.281) (-1844.779) -- 0:00:12
946500 -- [-1841.889] (-1840.795) (-1840.858) (-1840.787) * (-1850.494) [-1842.235] (-1850.765) (-1841.681) -- 0:00:12
947000 -- (-1847.175) (-1842.162) [-1840.163] (-1844.430) * (-1847.359) [-1843.730] (-1844.840) (-1838.177) -- 0:00:12
947500 -- (-1842.312) [-1841.545] (-1840.318) (-1841.764) * (-1843.229) [-1845.007] (-1843.581) (-1840.691) -- 0:00:12
948000 -- [-1844.228] (-1841.427) (-1839.872) (-1841.491) * (-1846.162) (-1845.850) (-1845.770) [-1841.717] -- 0:00:11
948500 -- (-1841.807) [-1840.705] (-1846.741) (-1844.222) * (-1844.859) [-1846.059] (-1851.246) (-1844.982) -- 0:00:11
949000 -- (-1839.723) (-1841.164) (-1845.432) [-1838.195] * (-1842.406) [-1854.277] (-1846.222) (-1845.457) -- 0:00:11
949500 -- (-1840.464) [-1845.691] (-1848.452) (-1846.620) * (-1843.431) (-1845.857) (-1842.830) [-1849.908] -- 0:00:11
950000 -- (-1848.892) [-1844.416] (-1841.251) (-1842.282) * [-1843.030] (-1853.630) (-1845.446) (-1844.310) -- 0:00:11
Average standard deviation of split frequencies: 0.000992
950500 -- [-1840.045] (-1852.443) (-1842.366) (-1854.404) * (-1847.223) (-1853.423) [-1839.855] (-1846.794) -- 0:00:11
951000 -- (-1841.151) (-1844.596) (-1843.313) [-1847.944] * (-1846.244) (-1843.658) (-1843.882) [-1852.205] -- 0:00:11
951500 -- (-1851.258) (-1842.732) [-1847.172] (-1848.043) * (-1844.198) [-1844.456] (-1843.658) (-1850.753) -- 0:00:11
952000 -- (-1841.982) [-1842.642] (-1846.527) (-1847.651) * [-1841.747] (-1842.370) (-1848.529) (-1844.881) -- 0:00:11
952500 -- (-1842.515) [-1841.350] (-1844.890) (-1844.358) * [-1838.558] (-1841.987) (-1846.382) (-1842.047) -- 0:00:10
953000 -- (-1848.154) (-1846.729) (-1839.241) [-1840.208] * (-1849.607) (-1846.869) (-1842.991) [-1840.055] -- 0:00:10
953500 -- [-1844.060] (-1840.385) (-1840.176) (-1844.253) * (-1853.925) [-1846.948] (-1850.965) (-1851.608) -- 0:00:10
954000 -- (-1842.649) (-1842.519) [-1844.408] (-1844.682) * (-1845.534) (-1841.550) [-1842.084] (-1845.226) -- 0:00:10
954500 -- (-1844.439) (-1848.229) (-1845.281) [-1841.213] * (-1843.874) [-1843.033] (-1848.826) (-1842.539) -- 0:00:10
955000 -- [-1842.273] (-1853.107) (-1846.081) (-1842.130) * (-1844.973) (-1844.948) (-1850.912) [-1842.691] -- 0:00:10
Average standard deviation of split frequencies: 0.000986
955500 -- (-1841.409) (-1848.696) (-1846.507) [-1840.562] * (-1845.959) [-1844.911] (-1853.939) (-1849.426) -- 0:00:10
956000 -- (-1847.859) [-1845.905] (-1845.459) (-1839.963) * [-1844.678] (-1845.313) (-1852.292) (-1848.647) -- 0:00:10
956500 -- [-1844.932] (-1847.451) (-1846.007) (-1848.771) * (-1852.671) (-1844.995) [-1846.106] (-1857.427) -- 0:00:10
957000 -- [-1841.756] (-1842.897) (-1851.046) (-1848.440) * [-1841.554] (-1843.868) (-1849.296) (-1853.630) -- 0:00:09
957500 -- [-1842.652] (-1844.642) (-1845.932) (-1844.857) * (-1843.913) [-1842.275] (-1842.811) (-1849.048) -- 0:00:09
958000 -- (-1842.109) (-1846.825) [-1844.977] (-1849.960) * (-1851.004) (-1846.399) (-1846.285) [-1848.107] -- 0:00:09
958500 -- (-1844.317) (-1853.011) [-1843.249] (-1845.013) * [-1839.079] (-1840.652) (-1841.744) (-1844.512) -- 0:00:09
959000 -- (-1847.912) (-1838.755) [-1849.975] (-1840.086) * [-1842.114] (-1850.202) (-1847.192) (-1845.689) -- 0:00:09
959500 -- (-1856.092) (-1837.829) (-1842.664) [-1843.047] * (-1842.241) (-1856.769) [-1846.354] (-1844.451) -- 0:00:09
960000 -- (-1849.645) (-1843.088) (-1844.924) [-1841.227] * [-1841.569] (-1846.873) (-1844.207) (-1840.827) -- 0:00:09
Average standard deviation of split frequencies: 0.000981
960500 -- (-1852.449) (-1843.013) [-1840.330] (-1850.855) * (-1842.938) (-1848.465) (-1844.449) [-1838.577] -- 0:00:09
961000 -- (-1847.368) [-1842.808] (-1845.229) (-1842.116) * (-1840.650) (-1839.798) [-1842.832] (-1846.053) -- 0:00:08
961500 -- [-1843.511] (-1844.146) (-1845.203) (-1845.590) * (-1846.179) [-1847.877] (-1843.381) (-1840.964) -- 0:00:08
962000 -- (-1843.495) (-1843.075) (-1850.190) [-1848.110] * (-1848.222) (-1844.716) [-1838.482] (-1843.636) -- 0:00:08
962500 -- (-1846.715) [-1844.329] (-1843.161) (-1845.810) * (-1851.152) [-1842.988] (-1843.579) (-1846.785) -- 0:00:08
963000 -- (-1850.195) (-1845.493) (-1848.053) [-1838.955] * (-1845.041) [-1843.553] (-1854.889) (-1845.255) -- 0:00:08
963500 -- (-1844.207) [-1844.478] (-1846.843) (-1845.744) * (-1843.945) [-1844.224] (-1839.757) (-1847.173) -- 0:00:08
964000 -- (-1842.262) [-1841.108] (-1846.159) (-1839.115) * (-1844.022) (-1842.060) (-1844.559) [-1847.447] -- 0:00:08
964500 -- (-1841.876) (-1845.143) [-1849.910] (-1843.083) * [-1842.627] (-1848.471) (-1844.525) (-1845.170) -- 0:00:08
965000 -- (-1850.103) [-1844.758] (-1844.838) (-1846.469) * (-1846.182) (-1842.535) [-1845.027] (-1840.251) -- 0:00:08
Average standard deviation of split frequencies: 0.000976
965500 -- [-1851.735] (-1840.415) (-1844.988) (-1842.746) * (-1841.451) [-1845.013] (-1845.493) (-1849.374) -- 0:00:07
966000 -- (-1843.735) (-1840.908) [-1845.505] (-1843.979) * (-1842.606) (-1849.993) (-1852.754) [-1840.235] -- 0:00:07
966500 -- (-1849.350) (-1841.423) [-1844.212] (-1845.554) * [-1839.531] (-1851.627) (-1841.669) (-1839.893) -- 0:00:07
967000 -- (-1845.089) (-1844.373) [-1844.684] (-1840.519) * (-1850.322) (-1851.880) (-1841.946) [-1837.822] -- 0:00:07
967500 -- [-1842.779] (-1851.109) (-1844.941) (-1844.139) * (-1849.396) (-1839.926) (-1844.986) [-1844.631] -- 0:00:07
968000 -- (-1845.908) [-1842.089] (-1843.706) (-1845.883) * [-1843.015] (-1844.317) (-1842.900) (-1844.615) -- 0:00:07
968500 -- (-1844.879) (-1843.158) (-1852.974) [-1840.309] * (-1845.172) (-1841.180) (-1853.216) [-1845.907] -- 0:00:07
969000 -- (-1844.637) (-1847.816) (-1844.138) [-1844.556] * (-1847.042) [-1841.320] (-1850.470) (-1847.480) -- 0:00:07
969500 -- (-1848.985) (-1842.521) (-1845.885) [-1840.183] * (-1841.111) (-1843.752) (-1847.708) [-1840.164] -- 0:00:07
970000 -- (-1853.465) (-1844.880) [-1839.549] (-1840.685) * [-1841.008] (-1845.766) (-1847.234) (-1840.670) -- 0:00:06
Average standard deviation of split frequencies: 0.000971
970500 -- (-1857.861) (-1840.375) [-1841.746] (-1847.311) * (-1841.773) (-1845.169) (-1852.090) [-1841.059] -- 0:00:06
971000 -- (-1843.921) [-1841.504] (-1845.858) (-1845.845) * (-1845.893) (-1844.709) (-1855.475) [-1843.379] -- 0:00:06
971500 -- [-1840.057] (-1853.314) (-1850.207) (-1847.564) * (-1840.419) (-1839.962) [-1840.917] (-1842.037) -- 0:00:06
972000 -- [-1841.387] (-1843.871) (-1850.558) (-1844.536) * (-1845.446) (-1848.820) (-1843.139) [-1842.174] -- 0:00:06
972500 -- (-1843.156) [-1843.455] (-1846.170) (-1848.132) * (-1842.056) [-1845.099] (-1842.957) (-1848.684) -- 0:00:06
973000 -- (-1843.913) (-1842.852) (-1849.534) [-1846.295] * [-1846.691] (-1845.361) (-1851.988) (-1850.933) -- 0:00:06
973500 -- [-1846.158] (-1847.575) (-1843.316) (-1846.769) * (-1846.530) (-1847.051) [-1844.477] (-1845.397) -- 0:00:06
974000 -- (-1846.735) [-1845.030] (-1849.727) (-1844.569) * (-1844.167) (-1844.108) (-1847.802) [-1839.250] -- 0:00:05
974500 -- (-1846.343) [-1842.951] (-1850.128) (-1845.428) * (-1843.743) (-1849.962) (-1842.693) [-1839.881] -- 0:00:05
975000 -- (-1843.373) (-1844.375) (-1847.955) [-1842.210] * (-1846.006) [-1844.535] (-1841.430) (-1842.116) -- 0:00:05
Average standard deviation of split frequencies: 0.000966
975500 -- (-1837.960) [-1840.128] (-1848.748) (-1846.292) * (-1845.672) (-1851.674) [-1844.295] (-1846.270) -- 0:00:05
976000 -- [-1843.764] (-1842.817) (-1845.402) (-1851.298) * (-1846.311) [-1840.736] (-1846.219) (-1843.199) -- 0:00:05
976500 -- (-1843.744) (-1853.386) (-1844.261) [-1848.697] * (-1845.027) (-1850.422) [-1845.599] (-1846.794) -- 0:00:05
977000 -- (-1841.372) (-1845.864) [-1851.491] (-1847.238) * (-1843.025) (-1847.757) (-1841.262) [-1839.613] -- 0:00:05
977500 -- (-1845.601) [-1842.754] (-1852.108) (-1845.714) * [-1844.333] (-1845.708) (-1842.331) (-1841.814) -- 0:00:05
978000 -- (-1839.412) (-1843.974) [-1848.075] (-1843.197) * (-1847.492) (-1841.368) (-1847.436) [-1848.032] -- 0:00:05
978500 -- (-1841.536) (-1849.884) (-1846.455) [-1844.653] * (-1847.038) (-1842.799) (-1847.387) [-1844.875] -- 0:00:04
979000 -- (-1842.318) (-1845.823) [-1846.610] (-1843.079) * [-1850.688] (-1845.010) (-1848.682) (-1840.080) -- 0:00:04
979500 -- [-1844.749] (-1841.676) (-1843.454) (-1844.111) * [-1842.327] (-1843.134) (-1844.185) (-1847.286) -- 0:00:04
980000 -- [-1838.462] (-1844.660) (-1849.122) (-1846.629) * [-1842.218] (-1846.268) (-1847.255) (-1842.494) -- 0:00:04
Average standard deviation of split frequencies: 0.000961
980500 -- (-1839.448) (-1851.271) [-1843.345] (-1842.313) * (-1840.459) (-1843.127) (-1847.612) [-1840.583] -- 0:00:04
981000 -- (-1844.663) (-1844.569) (-1843.338) [-1847.913] * (-1849.573) (-1850.171) [-1847.779] (-1842.452) -- 0:00:04
981500 -- (-1844.669) (-1842.224) [-1850.673] (-1847.885) * (-1843.126) [-1843.153] (-1847.524) (-1839.708) -- 0:00:04
982000 -- [-1843.267] (-1842.455) (-1849.514) (-1842.111) * (-1843.645) (-1841.597) [-1842.039] (-1846.983) -- 0:00:04
982500 -- [-1842.938] (-1839.453) (-1844.087) (-1845.581) * (-1839.563) [-1843.755] (-1848.032) (-1845.562) -- 0:00:04
983000 -- (-1840.539) [-1850.002] (-1844.786) (-1841.885) * (-1841.643) [-1842.759] (-1842.281) (-1842.330) -- 0:00:03
983500 -- (-1841.947) (-1866.507) [-1840.281] (-1840.421) * (-1852.543) (-1840.030) [-1843.390] (-1846.733) -- 0:00:03
984000 -- (-1845.417) (-1840.861) (-1849.457) [-1840.604] * [-1844.592] (-1839.175) (-1840.199) (-1842.706) -- 0:00:03
984500 -- (-1839.955) (-1839.420) (-1843.029) [-1847.381] * (-1843.390) [-1839.611] (-1843.772) (-1842.403) -- 0:00:03
985000 -- (-1845.958) (-1839.669) (-1848.470) [-1841.760] * (-1840.635) [-1842.220] (-1845.076) (-1846.665) -- 0:00:03
Average standard deviation of split frequencies: 0.000956
985500 -- [-1843.566] (-1848.810) (-1842.974) (-1847.618) * [-1843.198] (-1837.768) (-1841.649) (-1842.818) -- 0:00:03
986000 -- (-1845.689) (-1849.995) [-1840.746] (-1838.974) * (-1846.872) [-1840.198] (-1847.307) (-1845.040) -- 0:00:03
986500 -- (-1845.324) (-1843.278) [-1847.212] (-1847.361) * (-1843.842) (-1842.957) [-1843.364] (-1846.745) -- 0:00:03
987000 -- (-1837.300) (-1842.981) (-1842.405) [-1847.439] * (-1840.073) (-1847.583) [-1846.976] (-1848.941) -- 0:00:02
987500 -- [-1842.994] (-1849.441) (-1845.057) (-1850.697) * (-1841.694) (-1841.828) (-1843.540) [-1844.908] -- 0:00:02
988000 -- [-1842.610] (-1849.089) (-1844.607) (-1845.189) * [-1842.584] (-1843.104) (-1843.192) (-1840.998) -- 0:00:02
988500 -- (-1840.976) (-1839.588) [-1840.769] (-1846.231) * (-1841.946) (-1847.972) (-1844.982) [-1845.412] -- 0:00:02
989000 -- (-1840.643) (-1852.938) [-1839.358] (-1840.691) * [-1843.745] (-1851.018) (-1844.685) (-1843.781) -- 0:00:02
989500 -- (-1842.998) (-1850.087) (-1841.820) [-1842.711] * (-1842.459) (-1846.112) (-1846.649) [-1843.754] -- 0:00:02
990000 -- (-1844.295) (-1849.635) [-1840.345] (-1839.949) * (-1843.909) (-1843.757) (-1847.963) [-1852.219] -- 0:00:02
Average standard deviation of split frequencies: 0.000952
990500 -- (-1845.040) (-1850.027) (-1843.431) [-1843.792] * [-1846.811] (-1846.618) (-1847.250) (-1843.760) -- 0:00:02
991000 -- (-1841.700) (-1850.056) (-1845.733) [-1846.105] * (-1845.923) (-1849.104) [-1841.058] (-1843.462) -- 0:00:02
991500 -- (-1840.081) (-1844.929) (-1849.399) [-1849.212] * (-1842.395) (-1842.516) (-1847.282) [-1845.646] -- 0:00:01
992000 -- [-1843.605] (-1844.634) (-1847.901) (-1844.286) * [-1845.546] (-1849.380) (-1841.306) (-1848.600) -- 0:00:01
992500 -- [-1842.137] (-1847.847) (-1851.665) (-1842.168) * (-1845.506) (-1841.399) [-1838.588] (-1852.040) -- 0:00:01
993000 -- [-1838.902] (-1844.066) (-1850.441) (-1845.025) * [-1840.737] (-1841.178) (-1844.661) (-1844.038) -- 0:00:01
993500 -- (-1850.166) [-1843.507] (-1845.584) (-1844.177) * (-1842.454) (-1840.970) [-1841.130] (-1851.442) -- 0:00:01
994000 -- (-1842.081) (-1840.334) [-1840.125] (-1846.035) * (-1849.473) (-1842.379) (-1844.597) [-1842.619] -- 0:00:01
994500 -- (-1838.365) (-1846.889) [-1843.205] (-1845.662) * [-1841.733] (-1838.846) (-1844.266) (-1848.573) -- 0:00:01
995000 -- [-1845.944] (-1848.579) (-1843.328) (-1842.065) * (-1840.789) (-1847.261) (-1842.678) [-1845.896] -- 0:00:01
Average standard deviation of split frequencies: 0.000947
995500 -- (-1845.400) (-1846.117) (-1848.445) [-1847.337] * [-1847.318] (-1845.246) (-1849.842) (-1846.329) -- 0:00:01
996000 -- (-1843.076) (-1862.697) [-1839.830] (-1846.218) * (-1841.883) [-1841.582] (-1845.722) (-1849.875) -- 0:00:00
996500 -- [-1846.735] (-1844.247) (-1847.356) (-1843.159) * (-1853.306) [-1845.864] (-1853.698) (-1845.455) -- 0:00:00
997000 -- (-1850.236) (-1845.269) (-1850.788) [-1844.799] * (-1845.967) (-1848.476) [-1848.367] (-1847.373) -- 0:00:00
997500 -- (-1848.043) (-1840.160) (-1842.141) [-1841.424] * (-1849.455) [-1843.431] (-1843.177) (-1852.961) -- 0:00:00
998000 -- [-1844.778] (-1846.000) (-1848.233) (-1841.362) * (-1841.069) [-1843.711] (-1854.329) (-1846.492) -- 0:00:00
998500 -- (-1843.572) (-1845.926) (-1855.078) [-1843.388] * [-1846.105] (-1845.220) (-1846.996) (-1843.329) -- 0:00:00
999000 -- [-1840.173] (-1846.477) (-1846.867) (-1843.587) * (-1846.446) (-1841.886) (-1851.052) [-1838.843] -- 0:00:00
999500 -- [-1840.560] (-1844.785) (-1861.494) (-1844.687) * (-1839.495) (-1848.440) (-1850.108) [-1841.253] -- 0:00:00
1000000 -- [-1841.910] (-1846.947) (-1855.306) (-1849.538) * (-1839.595) (-1844.933) (-1840.212) [-1845.643] -- 0:00:00
Average standard deviation of split frequencies: 0.000942
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1841.910086 -- 10.149904
Chain 1 -- -1841.910087 -- 10.149904
Chain 2 -- -1846.947418 -- 11.608535
Chain 2 -- -1846.947418 -- 11.608535
Chain 3 -- -1855.306140 -- 7.517720
Chain 3 -- -1855.306140 -- 7.517720
Chain 4 -- -1849.538032 -- 8.715165
Chain 4 -- -1849.538032 -- 8.715165
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1839.594589 -- 9.728051
Chain 1 -- -1839.594589 -- 9.728051
Chain 2 -- -1844.932858 -- 13.459743
Chain 2 -- -1844.932860 -- 13.459743
Chain 3 -- -1840.211961 -- 10.639729
Chain 3 -- -1840.211962 -- 10.639729
Chain 4 -- -1845.642856 -- 10.384253
Chain 4 -- -1845.642855 -- 10.384253
Analysis completed in 3 mins 50 seconds
Analysis used 230.12 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1835.62
Likelihood of best state for "cold" chain of run 2 was -1835.62
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.0 % ( 45 %) Dirichlet(Revmat{all})
68.2 % ( 50 %) Slider(Revmat{all})
26.3 % ( 18 %) Dirichlet(Pi{all})
27.4 % ( 27 %) Slider(Pi{all})
60.9 % ( 41 %) Multiplier(Alpha{1,2})
46.2 % ( 26 %) Multiplier(Alpha{3})
59.1 % ( 24 %) Slider(Pinvar{all})
0.5 % ( 0 %) ExtSPR(Tau{all},V{all})
0.5 % ( 0 %) ExtTBR(Tau{all},V{all})
0.6 % ( 0 %) NNI(Tau{all},V{all})
0.7 % ( 1 %) ParsSPR(Tau{all},V{all})
26.2 % ( 19 %) Multiplier(V{all})
32.4 % ( 32 %) Nodeslider(V{all})
25.8 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
55.3 % ( 45 %) Dirichlet(Revmat{all})
68.8 % ( 60 %) Slider(Revmat{all})
26.3 % ( 23 %) Dirichlet(Pi{all})
28.4 % ( 30 %) Slider(Pi{all})
61.2 % ( 38 %) Multiplier(Alpha{1,2})
46.1 % ( 30 %) Multiplier(Alpha{3})
59.0 % ( 30 %) Slider(Pinvar{all})
0.5 % ( 0 %) ExtSPR(Tau{all},V{all})
0.5 % ( 0 %) ExtTBR(Tau{all},V{all})
0.6 % ( 0 %) NNI(Tau{all},V{all})
0.8 % ( 0 %) ParsSPR(Tau{all},V{all})
26.1 % ( 24 %) Multiplier(V{all})
32.4 % ( 36 %) Nodeslider(V{all})
25.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.57
2 | 166047 0.85 0.72
3 | 166689 166916 0.86
4 | 166734 166604 167010
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166506 0.85 0.71
3 | 166804 166790 0.86
4 | 166802 166244 166854
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1842.57
| 2 2 1 2 |
| 1 2 2 2 2 1 |
| 1 1 2 2 2 1 1 1|
| 1 1 2 |
| 21 1 1 2 * 1 1 |
| 1 2 1 122 2 11 22 221 112 |
| 12 2 2 22 * 2 * |
| 1 222 *1 121 111 2 2 2 22 1 1 2 |
| 1 2 2 1 1 2 2 2|
|2 22 11 1 1 2 1 |
|1 12 1 12 11 1 1 |
| 2 11 2 2 |
| 2 1 |
| 1 11 * |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1845.26
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1840.91 -1851.71
2 -1840.85 -1850.27
--------------------------------------
TOTAL -1840.88 -1851.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.604022 0.008092 0.432692 0.775354 0.595804 1087.02 1294.01 1.000
r(A<->C){all} 0.155688 0.001711 0.080626 0.238850 0.152153 839.50 939.82 1.002
r(A<->G){all} 0.233587 0.002300 0.148066 0.329988 0.229467 832.89 844.61 1.000
r(A<->T){all} 0.083681 0.001373 0.012998 0.154825 0.081445 820.23 857.39 1.000
r(C<->G){all} 0.045308 0.000370 0.011687 0.083857 0.043428 884.50 951.23 1.001
r(C<->T){all} 0.410770 0.003442 0.299526 0.524556 0.409477 813.38 842.99 1.001
r(G<->T){all} 0.070966 0.000601 0.026995 0.120696 0.068726 932.29 970.85 1.000
pi(A){all} 0.241139 0.000225 0.210460 0.268392 0.240507 1155.18 1203.80 1.002
pi(C){all} 0.255445 0.000219 0.226752 0.284879 0.255122 1043.90 1254.00 1.000
pi(G){all} 0.293829 0.000254 0.264040 0.326669 0.293878 1291.46 1300.31 1.000
pi(T){all} 0.209588 0.000192 0.181994 0.235297 0.209126 1241.31 1364.99 1.000
alpha{1,2} 0.058014 0.001463 0.000109 0.125964 0.053762 1031.87 1097.91 1.000
alpha{3} 2.216936 0.618578 0.925568 3.758775 2.082527 1465.36 1483.18 1.000
pinvar{all} 0.274660 0.006584 0.122201 0.436488 0.278309 1174.89 1182.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- .**..
7 -- ...**
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 2996 0.998001 0.000000 0.998001 0.998001 2
7 2988 0.995336 0.001884 0.994004 0.996669 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.045606 0.000167 0.021210 0.071040 0.044513 1.000 2
length{all}[2] 0.020542 0.000044 0.007879 0.032858 0.020015 1.000 2
length{all}[3] 0.006074 0.000014 0.000252 0.013282 0.005375 1.000 2
length{all}[4] 0.120358 0.001035 0.060668 0.185191 0.117149 1.001 2
length{all}[5] 0.320468 0.004691 0.194554 0.452419 0.312811 1.000 2
length{all}[6] 0.025274 0.000114 0.005668 0.046139 0.024143 1.001 2
length{all}[7] 0.065982 0.000732 0.013888 0.119007 0.063153 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000942
Maximum standard deviation of split frequencies = 0.001884
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C2 (2)
|----------------100----------------+
+ \------------------------------------ C3 (3)
|
| /------------------------------------ C4 (4)
\----------------100----------------+
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/--------- C1 (1)
|
| /--- C2 (2)
|----+
+ \- C3 (3)
|
| /----------------------- C4 (4)
\-----------+
\------------------------------------------------------------ C5 (5)
|--------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (5 trees sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 747
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
24 ambiguity characters in seq. 1
24 ambiguity characters in seq. 2
30 ambiguity characters in seq. 3
27 ambiguity characters in seq. 4
15 ambiguity characters in seq. 5
11 sites are removed. 83 84 85 98 99 244 245 246 247 248 249
Sequences read..
Counting site patterns.. 0:00
147 patterns at 238 / 238 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
143472 bytes for conP
19992 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
215208 bytes for conP, adjusted
0.077218 0.062572 0.041428 0.010849 0.092687 0.172531 0.432236 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1933.448555
Iterating by ming2
Initial: fx= 1933.448555
x= 0.07722 0.06257 0.04143 0.01085 0.09269 0.17253 0.43224 0.30000 1.30000
1 h-m-p 0.0000 0.0004 233.0696 +++ 1917.275648 m 0.0004 15 | 0/9
2 h-m-p 0.0000 0.0001 12323.0223 +YCYCCC 1840.445516 5 0.0001 37 | 0/9
3 h-m-p 0.0003 0.0013 2064.7290 YYYCCC 1811.806705 5 0.0003 56 | 0/9
4 h-m-p 0.0001 0.0007 340.9065 +YYYYYC 1791.493961 5 0.0005 74 | 0/9
5 h-m-p 0.0001 0.0007 507.1237 +YYYYCC 1764.762094 5 0.0006 93 | 0/9
6 h-m-p 0.0001 0.0005 869.6725 +YYYYCCCC 1728.668863 7 0.0004 116 | 0/9
7 h-m-p 0.0004 0.0021 76.9689 CCCC 1726.939940 3 0.0007 134 | 0/9
8 h-m-p 0.0005 0.0066 117.3477 CYCC 1725.567452 3 0.0006 151 | 0/9
9 h-m-p 0.0021 0.0141 30.8422 CCC 1725.299407 2 0.0007 167 | 0/9
10 h-m-p 0.0827 3.0286 0.2775 ++YYCCC 1715.921430 4 1.1325 187 | 0/9
11 h-m-p 0.7369 3.6846 0.2255 CYCCC 1713.307809 4 0.5452 215 | 0/9
12 h-m-p 0.3285 1.6727 0.3742 YCCCC 1706.941515 4 0.6934 243 | 0/9
13 h-m-p 0.9437 4.7184 0.0908 CCCC 1705.931069 3 1.0146 270 | 0/9
14 h-m-p 1.6000 8.0000 0.0357 YC 1705.672791 1 0.9798 292 | 0/9
15 h-m-p 1.6000 8.0000 0.0123 CCCC 1705.389043 3 2.4774 319 | 0/9
16 h-m-p 1.6000 8.0000 0.0127 +CYC 1704.826833 2 5.9283 344 | 0/9
17 h-m-p 0.8770 4.3852 0.0164 YCCC 1704.478507 3 1.6730 370 | 0/9
18 h-m-p 0.9598 8.0000 0.0285 CC 1704.409094 1 1.0043 393 | 0/9
19 h-m-p 1.6000 8.0000 0.0075 C 1704.354230 0 1.6000 414 | 0/9
20 h-m-p 0.5547 8.0000 0.0216 +CCC 1704.279555 2 2.7345 440 | 0/9
21 h-m-p 1.6000 8.0000 0.0152 CC 1704.264617 1 1.5098 463 | 0/9
22 h-m-p 1.6000 8.0000 0.0076 YC 1704.253121 1 3.1767 485 | 0/9
23 h-m-p 1.6000 8.0000 0.0080 CC 1704.245710 1 2.0162 508 | 0/9
24 h-m-p 1.6000 8.0000 0.0024 C 1704.244976 0 1.4435 529 | 0/9
25 h-m-p 1.6000 8.0000 0.0002 Y 1704.244967 0 1.0054 550 | 0/9
26 h-m-p 1.6000 8.0000 0.0000 C 1704.244967 0 1.2820 571 | 0/9
27 h-m-p 1.0963 8.0000 0.0000 ------C 1704.244967 0 0.0001 598
Out..
lnL = -1704.244967
599 lfun, 599 eigenQcodon, 4193 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
0.077218 0.062572 0.041428 0.010849 0.092687 0.172531 0.432236 1.783106 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.075013
np = 10
lnL0 = -1785.755380
Iterating by ming2
Initial: fx= 1785.755380
x= 0.07722 0.06257 0.04143 0.01085 0.09269 0.17253 0.43224 1.78311 0.57321 0.49224
1 h-m-p 0.0000 0.0003 123.0320 ++CYYCC 1783.579829 4 0.0002 24 | 0/10
2 h-m-p 0.0000 0.0003 1018.5999 ++ 1740.625224 m 0.0003 37 | 0/10
3 h-m-p 0.0000 0.0002 1322.9409 +YYYYCC 1719.213522 5 0.0002 57 | 0/10
4 h-m-p 0.0000 0.0001 302.3776 ++ 1717.816546 m 0.0001 70 | 0/10
5 h-m-p 0.0009 0.0056 33.4057 CC 1717.386739 1 0.0009 85 | 0/10
6 h-m-p 0.0014 0.0069 18.8625 YCC 1717.304484 2 0.0006 101 | 0/10
7 h-m-p 0.0008 0.0508 15.4621 +YCCC 1717.014110 3 0.0047 120 | 0/10
8 h-m-p 0.0028 0.0536 26.3645 CCC 1716.652594 2 0.0042 137 | 0/10
9 h-m-p 0.0018 0.0212 63.2589 YCCC 1715.982771 3 0.0036 155 | 0/10
10 h-m-p 0.0010 0.0049 70.9191 +YCC 1715.280779 2 0.0034 172 | 0/10
11 h-m-p 0.0267 0.1336 0.2014 -------------.. | 0/10
12 h-m-p 0.0000 0.0004 237.4575 ++CYCCC 1708.225341 4 0.0002 228 | 0/10
13 h-m-p 0.0001 0.0003 383.1510 ++ 1695.454247 m 0.0003 241 | 0/10
14 h-m-p 0.0001 0.0003 429.5778 YCCCC 1693.010822 4 0.0001 261 | 0/10
15 h-m-p 0.0001 0.0005 181.6230 CYCCC 1690.982349 4 0.0002 281 | 0/10
16 h-m-p 0.0005 0.0048 73.4186 YCCC 1688.698552 3 0.0012 299 | 0/10
17 h-m-p 0.0017 0.0085 32.4241 YCCC 1688.366905 3 0.0008 317 | 0/10
18 h-m-p 0.0039 0.0542 7.0848 YC 1688.327682 1 0.0017 331 | 0/10
19 h-m-p 0.0019 0.1007 6.3587 +CCC 1688.239682 2 0.0069 349 | 0/10
20 h-m-p 0.0010 0.0225 43.7441 +CCC 1687.891116 2 0.0040 367 | 0/10
21 h-m-p 0.0026 0.0338 66.8994 +YCCC 1686.899057 3 0.0071 386 | 0/10
22 h-m-p 0.6837 3.4185 0.0581 CCCC 1686.687464 3 1.1665 405 | 0/10
23 h-m-p 1.1425 5.7125 0.0218 YYC 1686.664017 2 0.8855 430 | 0/10
24 h-m-p 1.6000 8.0000 0.0025 YC 1686.662076 1 0.8760 454 | 0/10
25 h-m-p 1.6000 8.0000 0.0011 YC 1686.662008 1 0.9753 478 | 0/10
26 h-m-p 1.6000 8.0000 0.0002 Y 1686.662006 0 0.6432 501 | 0/10
27 h-m-p 1.6000 8.0000 0.0000 Y 1686.662006 0 1.0494 524 | 0/10
28 h-m-p 1.6000 8.0000 0.0000 Y 1686.662006 0 1.1179 547 | 0/10
29 h-m-p 1.6000 8.0000 0.0000 Y 1686.662006 0 0.7516 570 | 0/10
30 h-m-p 1.6000 8.0000 0.0000 C 1686.662006 0 0.4000 593 | 0/10
31 h-m-p 0.5735 8.0000 0.0000 -----------Y 1686.662006 0 0.0000 627
Out..
lnL = -1686.662006
628 lfun, 1884 eigenQcodon, 8792 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
initial w for M2:NSpselection reset.
0.077218 0.062572 0.041428 0.010849 0.092687 0.172531 0.432236 1.833307 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.675332
np = 12
lnL0 = -1797.443894
Iterating by ming2
Initial: fx= 1797.443894
x= 0.07722 0.06257 0.04143 0.01085 0.09269 0.17253 0.43224 1.83331 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0006 121.0163 +++ 1792.570763 m 0.0006 18 | 0/12
2 h-m-p 0.0000 0.0002 3759.8366 ++ 1753.144470 m 0.0002 33 | 1/12
3 h-m-p 0.0057 0.1681 68.9146 CYCCC 1746.047486 4 0.0048 55 | 0/12
4 h-m-p 0.0002 0.0037 2042.2747 CCCC 1743.988919 3 0.0001 76 | 0/12
5 h-m-p 0.0036 0.0385 33.4128 +YYCCCCC 1736.780025 6 0.0149 102 | 0/12
6 h-m-p 0.0192 0.0961 13.6226 YCCCCC 1730.716512 5 0.0370 126 | 0/12
7 h-m-p 0.0040 0.0202 30.4240 +YCYCCC 1723.848137 5 0.0113 150 | 0/12
8 h-m-p 0.0033 0.0164 60.5715 +YCYCCC 1708.250750 5 0.0099 174 | 0/12
9 h-m-p 0.0009 0.0045 79.6950 YCYCCC 1704.874455 5 0.0020 197 | 0/12
10 h-m-p 0.0077 0.0384 10.5574 CCCCC 1703.854973 4 0.0094 220 | 0/12
11 h-m-p 0.0013 0.0075 73.9856 YCYCCC 1701.135321 5 0.0034 243 | 0/12
12 h-m-p 0.0538 0.6648 4.6844 +YYYYCCCCCC 1695.943736 9 0.2455 273 | 0/12
13 h-m-p 0.9711 4.8557 1.0552 CCC 1693.801626 2 0.8783 292 | 0/12
14 h-m-p 0.4379 2.1894 1.4646 CCCCC 1692.397451 4 0.5913 315 | 0/12
15 h-m-p 1.0630 5.3150 0.4364 CYCC 1691.013983 3 0.8025 335 | 0/12
16 h-m-p 0.2065 1.2181 1.6960 CYCCC 1689.820259 4 0.3045 369 | 0/12
17 h-m-p 0.2866 1.4329 0.7801 +YYCCC 1687.687954 4 1.0125 391 | 0/12
18 h-m-p 0.6009 3.0045 0.3151 CCCC 1687.104948 3 0.8324 424 | 0/12
19 h-m-p 1.6000 8.0000 0.1475 CCC 1686.983425 2 0.5713 455 | 0/12
20 h-m-p 0.3280 3.2479 0.2570 +YCC 1686.865974 2 0.9291 486 | 0/12
21 h-m-p 0.8188 4.0942 0.2096 CCC 1686.783836 2 0.9898 517 | 0/12
22 h-m-p 0.3589 1.7945 0.3027 YC 1686.734548 1 0.8675 545 | 0/12
23 h-m-p 0.2599 1.2994 0.1989 ++ 1686.692770 m 1.2994 572 | 1/12
24 h-m-p 0.6369 8.0000 0.2094 CCC 1686.665810 2 1.0579 603 | 1/12
25 h-m-p 1.6000 8.0000 0.0275 YC 1686.662214 1 0.7837 630 | 1/12
26 h-m-p 1.6000 8.0000 0.0099 YC 1686.662016 1 0.9200 657 | 1/12
27 h-m-p 1.6000 8.0000 0.0015 Y 1686.662007 0 0.8656 683 | 1/12
28 h-m-p 1.6000 8.0000 0.0003 Y 1686.662006 0 0.9593 709 | 1/12
29 h-m-p 1.6000 8.0000 0.0001 Y 1686.662006 0 1.0643 735 | 1/12
30 h-m-p 1.6000 8.0000 0.0000 Y 1686.662006 0 1.2735 761 | 1/12
31 h-m-p 1.6000 8.0000 0.0000 C 1686.662006 0 1.6000 787 | 1/12
32 h-m-p 1.6000 8.0000 0.0000 Y 1686.662006 0 1.6000 813 | 1/12
33 h-m-p 1.6000 8.0000 0.0000 -----------C 1686.662006 0 0.0000 850
Out..
lnL = -1686.662006
851 lfun, 3404 eigenQcodon, 17871 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1697.035167 S = -1615.334909 -72.856786
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 147 patterns 0:12
did 20 / 147 patterns 0:13
did 30 / 147 patterns 0:13
did 40 / 147 patterns 0:13
did 50 / 147 patterns 0:13
did 60 / 147 patterns 0:13
did 70 / 147 patterns 0:13
did 80 / 147 patterns 0:13
did 90 / 147 patterns 0:13
did 100 / 147 patterns 0:13
did 110 / 147 patterns 0:13
did 120 / 147 patterns 0:13
did 130 / 147 patterns 0:13
did 140 / 147 patterns 0:13
did 147 / 147 patterns 0:13
Time used: 0:13
Model 3: discrete
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
0.077218 0.062572 0.041428 0.010849 0.092687 0.172531 0.432236 1.833306 0.331355 0.382499 0.041924 0.104661 0.175243
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 15.108253
np = 13
lnL0 = -1701.776640
Iterating by ming2
Initial: fx= 1701.776640
x= 0.07722 0.06257 0.04143 0.01085 0.09269 0.17253 0.43224 1.83331 0.33136 0.38250 0.04192 0.10466 0.17524
1 h-m-p 0.0000 0.0002 113.5125 ++CYCCC 1700.090037 4 0.0002 28 | 0/13
2 h-m-p 0.0000 0.0000 676.5908 ++ 1696.935524 m 0.0000 44 | 1/13
3 h-m-p 0.0001 0.0004 196.2064 ++ 1693.469473 m 0.0004 60 | 1/13
4 h-m-p 0.0000 0.0000 260.4272
h-m-p: 3.40400355e-21 1.70200178e-20 2.60427237e+02 1693.469473
.. | 1/13
5 h-m-p 0.0000 0.0007 651.3479 YYYC 1692.218416 3 0.0000 92 | 1/13
6 h-m-p 0.0001 0.0007 63.8688 ++ 1690.231922 m 0.0007 108 | 2/13
7 h-m-p 0.0002 0.0025 141.4832 YC 1688.769068 1 0.0006 125 | 2/13
8 h-m-p 0.0011 0.0055 57.8686 YCCC 1688.332598 3 0.0006 146 | 2/13
9 h-m-p 0.0013 0.0100 25.7449 YCCC 1688.160107 3 0.0008 167 | 2/13
10 h-m-p 0.0062 0.0557 3.4041 C 1688.151107 0 0.0016 183 | 2/13
11 h-m-p 0.0009 0.3672 6.3202 ++CC 1688.012138 1 0.0173 203 | 2/13
12 h-m-p 0.0047 0.0714 23.0690 CCC 1687.892693 2 0.0043 223 | 2/13
13 h-m-p 0.0918 1.3162 1.0710 -YC 1687.886596 1 0.0102 241 | 1/13
14 h-m-p 0.0034 0.8029 3.1628 YC 1687.885639 1 0.0005 258 | 1/13
15 h-m-p 0.0031 1.5306 2.4370 ++YCCC 1687.744557 3 0.1129 281 | 1/13
16 h-m-p 0.1362 4.4933 2.0211 YCCC 1687.429328 3 0.3059 302 | 0/13
17 h-m-p 0.0803 1.2897 7.7024 --CC 1687.423500 1 0.0012 322 | 0/13
18 h-m-p 0.0376 1.2802 0.2468 +++ 1687.017490 m 1.2802 339 | 1/13
19 h-m-p 1.4751 8.0000 0.2141 CCC 1686.754204 2 1.4048 372 | 0/13
20 h-m-p 0.0024 0.0191 123.7355 -CC 1686.752071 1 0.0002 403 | 0/13
21 h-m-p 0.0692 0.6517 0.4310 +CCC 1686.706670 2 0.3403 424 | 0/13
22 h-m-p 1.6000 8.0000 0.0570 CYC 1686.607664 2 2.1242 456 | 0/13
23 h-m-p 1.6000 8.0000 0.0311 CC 1686.595501 1 1.4063 487 | 0/13
24 h-m-p 1.1718 8.0000 0.0373 YC 1686.594386 1 0.6557 517 | 0/13
25 h-m-p 1.6000 8.0000 0.0042 Y 1686.594233 0 1.2485 546 | 0/13
26 h-m-p 1.6000 8.0000 0.0019 +YC 1686.594085 1 4.3093 577 | 0/13
27 h-m-p 1.6000 8.0000 0.0037 ++ 1686.592652 m 8.0000 606 | 0/13
28 h-m-p 0.4455 8.0000 0.0662 YC 1686.591170 1 0.9151 636 | 0/13
29 h-m-p 1.6000 8.0000 0.0220 YYC 1686.590016 2 2.3878 667 | 0/13
30 h-m-p 1.6000 8.0000 0.0183 YC 1686.589819 1 0.9679 697 | 0/13
31 h-m-p 1.6000 8.0000 0.0050 Y 1686.589779 0 0.7814 726 | 0/13
32 h-m-p 0.6946 8.0000 0.0056 Y 1686.589765 0 1.4013 755 | 0/13
33 h-m-p 1.6000 8.0000 0.0010 Y 1686.589764 0 1.2518 784 | 0/13
34 h-m-p 1.6000 8.0000 0.0002 C 1686.589764 0 1.5162 813 | 0/13
35 h-m-p 1.6000 8.0000 0.0000 C 1686.589764 0 1.3683 842 | 0/13
36 h-m-p 1.6000 8.0000 0.0000 C 1686.589764 0 1.6000 871 | 0/13
37 h-m-p 1.6000 8.0000 0.0000 C 1686.589764 0 1.6000 900 | 0/13
38 h-m-p 1.6000 8.0000 0.0000 -C 1686.589764 0 0.1000 930 | 0/13
39 h-m-p 0.0160 8.0000 0.0000 -------------.. | 0/13
40 h-m-p 0.0160 8.0000 0.0001 ------------- | 0/13
41 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1686.589764
1051 lfun, 4204 eigenQcodon, 22071 P(t)
Time used: 0:22
Model 7: beta
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
0.077218 0.062572 0.041428 0.010849 0.092687 0.172531 0.432236 1.813408 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.160074
np = 10
lnL0 = -1720.259836
Iterating by ming2
Initial: fx= 1720.259836
x= 0.07722 0.06257 0.04143 0.01085 0.09269 0.17253 0.43224 1.81341 0.66567 1.54913
1 h-m-p 0.0000 0.0004 91.8822 ++YCYCCC 1718.907945 5 0.0003 35 | 0/10
2 h-m-p 0.0000 0.0018 500.4284 +CYCCC 1715.269833 4 0.0002 66 | 0/10
3 h-m-p 0.0005 0.0029 221.0709 +YYYCCC 1695.567113 5 0.0018 97 | 0/10
4 h-m-p 0.0003 0.0016 145.8835 YCCCCC 1694.090331 5 0.0004 129 | 0/10
5 h-m-p 0.0027 0.0165 19.3984 CCC 1693.941765 2 0.0009 156 | 0/10
6 h-m-p 0.0017 0.0531 10.1254 +YCCC 1693.306990 3 0.0135 185 | 0/10
7 h-m-p 0.0051 0.0311 26.9074 CCC 1692.709438 2 0.0055 212 | 0/10
8 h-m-p 0.0023 0.0150 65.7426 CC 1692.138785 1 0.0023 237 | 0/10
9 h-m-p 0.0094 0.0573 15.7127 YCCC 1691.929667 3 0.0040 265 | 0/10
10 h-m-p 0.0548 1.8516 1.1574 +CCCCC 1690.479900 4 0.3953 297 | 0/10
11 h-m-p 0.2256 1.1279 1.1213 CCCC 1689.169704 3 0.2334 326 | 0/10
12 h-m-p 0.7444 4.7760 0.3516 CCCC 1688.784614 3 0.8205 355 | 0/10
13 h-m-p 0.9574 6.4725 0.3013 +YYCCCC 1687.652273 5 2.9794 387 | 0/10
14 h-m-p 0.2646 1.3231 0.7975 CYCCC 1687.312226 4 0.4342 417 | 0/10
15 h-m-p 0.3743 1.8715 0.1286 YYCC 1687.017081 3 0.2853 444 | 0/10
16 h-m-p 0.2888 8.0000 0.1270 YC 1686.933640 1 0.6210 468 | 0/10
17 h-m-p 1.6000 8.0000 0.0379 YC 1686.926229 1 0.7973 492 | 0/10
18 h-m-p 1.6000 8.0000 0.0052 YC 1686.925762 1 0.9126 516 | 0/10
19 h-m-p 1.6000 8.0000 0.0016 YC 1686.925702 1 0.9957 540 | 0/10
20 h-m-p 1.6000 8.0000 0.0004 Y 1686.925699 0 1.0011 563 | 0/10
21 h-m-p 1.6000 8.0000 0.0000 Y 1686.925699 0 0.7915 586 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1686.925699 0 0.4000 609 | 0/10
23 h-m-p 0.8078 8.0000 0.0000 C 1686.925699 0 0.2020 632 | 0/10
24 h-m-p 0.4037 8.0000 0.0000 ------Y 1686.925699 0 0.0000 661
Out..
lnL = -1686.925699
662 lfun, 7282 eigenQcodon, 46340 P(t)
Time used: 0:40
Model 8: beta&w>1
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
initial w for M8:NSbetaw>1 reset.
0.077218 0.062572 0.041428 0.010849 0.092687 0.172531 0.432236 1.799679 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.717592
np = 12
lnL0 = -1719.333767
Iterating by ming2
Initial: fx= 1719.333767
x= 0.07722 0.06257 0.04143 0.01085 0.09269 0.17253 0.43224 1.79968 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0006 223.4818 +++ 1701.602503 m 0.0006 30 | 1/12
2 h-m-p 0.0005 0.0027 150.8672 YCYCCC 1695.278406 5 0.0011 65 | 1/12
3 h-m-p 0.0001 0.0005 363.3193 YCYCCC 1691.553776 5 0.0002 99 | 1/12
4 h-m-p 0.0012 0.0059 33.8945 CYC 1691.383065 2 0.0004 128 | 0/12
5 h-m-p 0.0001 0.0063 127.7238 YCCC 1690.019124 3 0.0002 159 | 0/12
6 h-m-p 0.0015 0.0100 18.7105 YCC 1689.827228 2 0.0012 189 | 0/12
7 h-m-p 0.0019 0.0317 11.8810 +YCC 1689.570957 2 0.0049 220 | 0/12
8 h-m-p 0.0050 0.0518 11.6790 CCC 1689.301984 2 0.0068 251 | 0/12
9 h-m-p 0.0016 0.0172 50.6345 CCC 1688.931116 2 0.0023 282 | 0/12
10 h-m-p 0.0033 0.0165 35.1221 +YYCCC 1687.663373 4 0.0104 316 | 0/12
11 h-m-p 0.1972 0.9862 1.1839 CCCC 1687.402083 3 0.2436 349 | 0/12
12 h-m-p 0.0952 0.4762 1.5810 +YCCC 1687.133277 3 0.2521 382 | 0/12
13 h-m-p 0.4482 2.2409 0.4118 YYC 1687.012684 2 0.3443 411 | 0/12
14 h-m-p 0.9160 4.5800 0.1319 YC 1686.951114 1 0.7081 439 | 0/12
15 h-m-p 0.6526 3.2630 0.0855 YC 1686.879693 1 1.4631 467 | 0/12
16 h-m-p 0.6003 3.0017 0.0517 YC 1686.853116 1 1.4721 495 | 0/12
17 h-m-p 0.9278 4.6388 0.0181 CC 1686.847993 1 1.4041 524 | 0/12
18 h-m-p 1.6000 8.0000 0.0095 CC 1686.845663 1 2.2948 553 | 0/12
19 h-m-p 0.6270 3.1352 0.0178 +YC 1686.844257 1 1.9287 582 | 0/12
20 h-m-p 0.8237 8.0000 0.0416 YC 1686.841934 1 1.3513 610 | 0/12
21 h-m-p 0.5320 2.6598 0.0729 ++ 1686.826992 m 2.6598 637 | 1/12
22 h-m-p 0.3332 8.0000 0.5766 +YCC 1686.801240 2 1.0334 668 | 1/12
23 h-m-p 1.0272 8.0000 0.5801 YC 1686.779541 1 0.5449 695 | 1/12
24 h-m-p 0.7140 8.0000 0.4426 +YCC 1686.751637 2 2.2853 725 | 1/12
25 h-m-p 1.6000 8.0000 0.3003 CCC 1686.734320 2 2.2914 755 | 1/12
26 h-m-p 0.7798 8.0000 0.8824 YCC 1686.717464 2 1.6109 784 | 1/12
27 h-m-p 1.6000 8.0000 0.5463 YCC 1686.703241 2 3.5195 813 | 1/12
28 h-m-p 1.6000 8.0000 1.0820 CC 1686.692318 1 1.7762 841 | 1/12
29 h-m-p 1.6000 8.0000 0.7693 YCC 1686.685669 2 2.5323 870 | 1/12
30 h-m-p 0.8518 8.0000 2.2873 CCC 1686.680698 2 1.2765 900 | 1/12
31 h-m-p 1.6000 8.0000 1.7324 CYC 1686.676491 2 1.8280 929 | 1/12
32 h-m-p 1.6000 8.0000 1.8577 YC 1686.671943 1 3.5734 956 | 1/12
33 h-m-p 1.6000 8.0000 2.3636 YC 1686.669147 1 3.0065 983 | 1/12
34 h-m-p 1.6000 8.0000 4.3928 C 1686.667778 0 1.7322 1009 | 1/12
35 h-m-p 1.5590 8.0000 4.8808 C 1686.666691 0 1.5590 1035 | 1/12
36 h-m-p 1.0788 7.3973 7.0532 YC 1686.665510 1 2.6846 1062 | 1/12
37 h-m-p 1.1618 5.8092 5.7218 +YC 1686.664868 1 3.0167 1090 | 1/12
38 h-m-p 0.2280 1.1399 14.0175 ++ 1686.664483 m 1.1399 1116 | 2/12
39 h-m-p 0.0513 0.3271 9.7851 -CC 1686.663778 1 0.0039 1145 | 2/12
40 h-m-p 1.6000 8.0000 0.0071 YC 1686.663632 1 1.1529 1171 | 2/12
41 h-m-p 1.6000 8.0000 0.0001 Y 1686.663631 0 0.9321 1196 | 2/12
42 h-m-p 1.6000 8.0000 0.0000 Y 1686.663631 0 0.8622 1221 | 2/12
43 h-m-p 1.6000 8.0000 0.0000 ----------C 1686.663631 0 0.0000 1256
Out..
lnL = -1686.663631
1257 lfun, 15084 eigenQcodon, 96789 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1698.944225 S = -1615.372470 -75.388075
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 147 patterns 1:18
did 20 / 147 patterns 1:18
did 30 / 147 patterns 1:18
did 40 / 147 patterns 1:18
did 50 / 147 patterns 1:18
did 60 / 147 patterns 1:19
did 70 / 147 patterns 1:19
did 80 / 147 patterns 1:19
did 90 / 147 patterns 1:19
did 100 / 147 patterns 1:19
did 110 / 147 patterns 1:20
did 120 / 147 patterns 1:20
did 130 / 147 patterns 1:20
did 140 / 147 patterns 1:20
did 147 / 147 patterns 1:20
Time used: 1:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=249
D_melanogaster_312-PA MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
D_sechellia_312-PA MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
D_simulans_312-PA MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
D_yakuba_312-PA MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
D_suzukii_312-PA MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
**************************:*****. :.** *..* *.****
D_melanogaster_312-PA VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPD-LELDHYYGLNLKR--G
D_sechellia_312-PA VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQE-LELDHYYGLNLKR--G
D_simulans_312-PA VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQ---ELDHYYGLNLKR--G
D_yakuba_312-PA VQNKYKIFRDEEATEIFDVEEARNLEQELPEQE-VEPDQYYGLNLKR--G
D_suzukii_312-PA VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
**:***************:****: **:*** * *:******** *
D_melanogaster_312-PA VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
D_sechellia_312-PA VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
D_simulans_312-PA VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
D_yakuba_312-PA VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
D_suzukii_312-PA VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
*************************************************:
D_melanogaster_312-PA TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
D_sechellia_312-PA TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
D_simulans_312-PA TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
D_yakuba_312-PA TAEFVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
D_suzukii_312-PA TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
*************.:***********************************
D_melanogaster_312-PA YDLESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKTooo--
D_sechellia_312-PA YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKTooo--
D_simulans_312-PA YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKTooooo
D_yakuba_312-PA YDLESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLKoooo--
D_suzukii_312-PA YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET-----
***********::****** ***.******** :. .***:
>D_melanogaster_312-PA
ATGCTGACCCGCGTGTTCCGCCTAGTGCACGACAGGCGCCTGAGTGTGCC
TGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
CGAAGGGCCAGGAAATCGAAGGCAATCCCGAAAAGACTTTGGTTGCCGGC
GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAAGCCACGGAGATTTT
TGATGTGGAAGAGGCACGCCACCAGGAGCAGCAACTTCCAGAGCCGGAC-
--CTGGAGCTGGATCACTATTACGGCCTCAATTTAAAGCGA------GGT
GTTCGCGGAGTGTTCGACGTTGAGGACTTGGTGGAGCTGCTCCGCAAGGA
GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTACG
TTGACCACCTGGTGGTTTGCAGTGGTCGCAGTTACCGACACATGCTGTCC
ACCGCGGAGTTCGTGCGCCGAATGTTCAAGATCAAGCGGGGCAAGGGTGA
CATATTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAATTCGACCGCGAAAG
CCAAAAACCCACCAATCCCTATGGCGATATTTTCATGGCTCAAACACCCC
TTTCTTTCGTAGACAAATCGAAACTAAAGACG---------------
>D_sechellia_312-PA
ATGCTGACCCGCGTGTTCCGCCTGGTGCACGACAGGCGCCTGAGTGTGCC
GGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
CGAATGGCCAGGAAATCGAGGGTAATCCCGAAAAGACTTTGGTTGCCGGC
GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAGGCCACGGAGATTTT
TGATATAGAAGAGGCGCGCCACCAGGAGCAGCAACTTCCAGAGCAGGAA-
--CTGGAGTTGGATCACTATTACGGACTAAATTTAAAGAGA------GGC
GTTCGCGGAGTGTTTGACGTTGAGGACTTGGTGGAGCTGCTCCGTAAGGA
GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTATG
TTGACCACCTGGTAGTTTGCAGTGGTCGCAGCTACCGGCACATGCTGTCC
ACGGCGGAGTTTGTGCGCCGAATGTTCAAGATTAAGCGCGGCAAGGGTGA
CATTTTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGTTCCGAATTCGACCGCGAAAG
CCAAAAGCCTCACAATCCCTATGGCGATATTTTCATGGCCCAAACCCCCC
GTTCTTTTGTAGACTCGTCAAAACTAAAGACG---------------
>D_simulans_312-PA
ATGCTGACCCGCGTGTTCCGCCTGGTGCACGACAGGCGCCTGAGTGTGCC
TGTCCTGCGTTGCTTCCACCACGAGTTCTCCAAGCCGCCACAACAGGCAG
CAAATGGCCAGGAAATCGAAGGTAATCCCGAAAAGACTTTGGTTGCCGGC
GTGCAAGACAAGTACAAAATATTCCGCGATGAGGAGGCCACGGAGATTTT
TGATGTAGAAGAGGCGCGCCACCAGGAGCAGCAACTTCCAGAGCAG----
-----GAGTTGGATCACTATTACGGGCTAAATTTAAAGAGA------GGC
GTTCGCGGAGTGTTCGACGTTGAGGACTTGGTGGAGCTGCTGCGTAAGGA
GAATGTGGACGACATATTCGTCTGCTACGTGCCGGAGAACCTGAAGTATG
TTGACCACCTGGTAGTTTGCAGTGGTCGCAGCTACCGGCACATGCTGTCC
ACGGCGGAGTTCGTGCGCCGAATGTTCAAGATTAAGCGCGGCAAGGGTGA
CATTTTGCCGCGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCGAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAATTCGACCGCGAAAG
CCAAAAGCCCCACAATCCCTATGGCGATATTTTCATGGCCCAAACCCCCC
TTTCTTTTGTAGACTCGTCGAAACTAAAGACG---------------
>D_yakuba_312-PA
ATGCTGACCCGCGTGTTCCGCCTGGTTCACGACAGACGACTGAGTGTGCC
TGTCCTGCGTTGCTTCCACCACGAGTTTACAAAGCCGCCACAGCAGCCAG
TCAAGGGCCAGGAAGTCGAAGGCAATCCCGCAAAGACTTTGGTTGCCGGC
GTGCAGAACAAGTACAAAATATTCCGTGATGAGGAGGCCACGGAGATTTT
TGATGTGGAGGAGGCGCGAAATCTGGAGCAAGAACTTCCAGAGCAGGAA-
--GTGGAGCCGGATCAGTATTACGGCCTAAACTTAAAGCGT------GGA
GTTCGCGGAGTTTTTGATGTTGAGGACTTGGTTGAGCTGCTCCGAAAGGA
GAATGTGGACGATATATTCGTCTGCTACGTGCCGGAAAACCTGAAGTATG
TGGACCACCTGGTGGTCTGCAGTGGACGCAGCTACCGGCACATGCTGACC
ACGGCGGAATTCGTGCGCAGAATGTTCAAGATCAAGCGCTCCAAGGGTGA
CATTCTGCCACGCATCGAGGGCGATAAGAGCCGGGATTGGATGGCCATGG
ACTTGGGCAACATTGCCCTGCACATATTTTCACCCAGTGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCACAATACGACCGCGAAAG
CCAAAAGCTGCACAATCCCTATGACGATATTTTCATGGCCCAAACGCCCA
TTTCTGTTGTGGAAAATTCGAAACTAAAG------------------
>D_suzukii_312-PA
ATGCTGACCCGCGTATTCCGCCTGGTCCACGACAGGCGCCTGAGTGTGCC
TGTCCTGCGCTGCTTCCACCACGAGTTCTCAAAACCGCCCCAACAGCCTG
GAAAGAGCCAGGAAACTGAGGATAGTCCCGGCAAGAACTTGGTGGCCGGT
GTGCAGGACAAGTACAAAATATTCCGGGATGAGGAGGCCACGGAGATTTT
CGATGTGGAGGAGGCACGCCACCAGGAGCAGCAGCTTCCCGAGGACTCTG
AACTTGAGCAGGATCACTACTATGGCCTGAATTTAAAGCGTAAGTTAGGT
GTTCGTGGCGTTTTCGATGTGGAGGATTTGGTGGAGCTGCTCCGCAAGGA
GAATGTGGACGACATATTCGTCTGCTATGTGCCGGAGAACCTGAAATATG
TGGACCACCTCGTGGTCTGCAGTGGACGCAGTTATCGGCACATGCTGACC
ACGGCTGAGTTTGTGCGTCGCATGTTCAAGATCAAGCGGAACAGAGGCGA
CATTCTGCCCCGCATCGAGGGCGACAAGAGTCGGGATTGGATGGCCATGG
ATTTAGGCAACATTGCCCTGCATATATTTTCACCGAGCGCTCGCGAGGAA
TACGATCTGGAGTCGCTGTGGGCCATTGGCTCCGAGTACGATCGCGAGAG
CCAAAAGCCGCATAATCCCTATGGCGATATATTCATGGCTCAAACTCCTC
TCACCGTTTCGGGTAATTCGAAACTGGAGACG---------------
>D_melanogaster_312-PA
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAAKGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEPD-LELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPTNPYGDIFMAQTPLSFVDKSKLKT
>D_sechellia_312-PA
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDIEEARHQEQQLPEQE-LELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPRSFVDSSKLKT
>D_simulans_312-PA
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQAANGQEIEGNPEKTLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEQ---ELDHYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLS
TAEFVRRMFKIKRGKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEFDRESQKPHNPYGDIFMAQTPLSFVDSSKLKT
>D_yakuba_312-PA
MLTRVFRLVHDRRLSVPVLRCFHHEFTKPPQQPVKGQEVEGNPAKTLVAG
VQNKYKIFRDEEATEIFDVEEARNLEQELPEQE-VEPDQYYGLNLKR--G
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRSKGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSQYDRESQKLHNPYDDIFMAQTPISVVENSKLK-
>D_suzukii_312-PA
MLTRVFRLVHDRRLSVPVLRCFHHEFSKPPQQPGKSQETEDSPGKNLVAG
VQDKYKIFRDEEATEIFDVEEARHQEQQLPEDSELEQDHYYGLNLKRKLG
VRGVFDVEDLVELLRKENVDDIFVCYVPENLKYVDHLVVCSGRSYRHMLT
TAEFVRRMFKIKRNRGDILPRIEGDKSRDWMAMDLGNIALHIFSPSAREE
YDLESLWAIGSEYDRESQKPHNPYGDIFMAQTPLTVSGNSKLET
#NEXUS
[ID: 7355314233]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_312-PA
D_sechellia_312-PA
D_simulans_312-PA
D_yakuba_312-PA
D_suzukii_312-PA
;
end;
begin trees;
translate
1 D_melanogaster_312-PA,
2 D_sechellia_312-PA,
3 D_simulans_312-PA,
4 D_yakuba_312-PA,
5 D_suzukii_312-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04451274,(2:0.02001486,3:0.005374785)0.998:0.02414294,(4:0.1171491,5:0.3128108)0.995:0.06315292);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04451274,(2:0.02001486,3:0.005374785):0.02414294,(4:0.1171491,5:0.3128108):0.06315292);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1840.91 -1851.71
2 -1840.85 -1850.27
--------------------------------------
TOTAL -1840.88 -1851.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/312-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.604022 0.008092 0.432692 0.775354 0.595804 1087.02 1294.01 1.000
r(A<->C){all} 0.155688 0.001711 0.080626 0.238850 0.152153 839.50 939.82 1.002
r(A<->G){all} 0.233587 0.002300 0.148066 0.329988 0.229467 832.89 844.61 1.000
r(A<->T){all} 0.083681 0.001373 0.012998 0.154825 0.081445 820.23 857.39 1.000
r(C<->G){all} 0.045308 0.000370 0.011687 0.083857 0.043428 884.50 951.23 1.001
r(C<->T){all} 0.410770 0.003442 0.299526 0.524556 0.409477 813.38 842.99 1.001
r(G<->T){all} 0.070966 0.000601 0.026995 0.120696 0.068726 932.29 970.85 1.000
pi(A){all} 0.241139 0.000225 0.210460 0.268392 0.240507 1155.18 1203.80 1.002
pi(C){all} 0.255445 0.000219 0.226752 0.284879 0.255122 1043.90 1254.00 1.000
pi(G){all} 0.293829 0.000254 0.264040 0.326669 0.293878 1291.46 1300.31 1.000
pi(T){all} 0.209588 0.000192 0.181994 0.235297 0.209126 1241.31 1364.99 1.000
alpha{1,2} 0.058014 0.001463 0.000109 0.125964 0.053762 1031.87 1097.91 1.000
alpha{3} 2.216936 0.618578 0.925568 3.758775 2.082527 1465.36 1483.18 1.000
pinvar{all} 0.274660 0.006584 0.122201 0.436488 0.278309 1174.89 1182.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/312-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 238
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 2 5 3 4 2 | Ser TCT 1 1 1 1 0 | Tyr TAT 2 3 3 3 5 | Cys TGT 0 0 0 0 0
TTC 11 8 10 7 9 | TCC 3 3 3 1 1 | TAC 6 5 5 6 4 | TGC 3 3 3 3 3
Leu TTA 1 1 1 1 2 | TCA 1 2 1 2 2 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 4 5 5 3 2 | TCG 2 2 3 2 3 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 1 2 1 1 | Pro CCT 1 1 1 1 3 | His CAT 0 0 0 0 2 | Arg CGT 1 3 2 3 3
CTC 2 1 0 1 3 | CCC 4 3 4 4 5 | CAC 8 9 9 7 7 | CGC 12 12 12 9 11
CTA 2 2 2 2 0 | CCA 2 2 2 4 0 | Gln CAA 5 5 5 4 3 | CGA 3 1 1 3 0
CTG 11 11 12 14 13 | CCG 5 5 4 3 4 | CAG 4 5 5 6 7 | CGG 2 2 2 2 4
----------------------------------------------------------------------------------------------------------------------
Ile ATT 4 6 6 6 4 | Thr ACT 1 1 1 1 2 | Asn AAT 4 5 5 5 4 | Ser AGT 4 3 3 3 5
ATC 3 2 2 2 2 | ACC 3 2 2 2 3 | AAC 2 2 2 4 4 | AGC 2 3 3 3 3
ATA 4 4 3 3 4 | ACA 1 0 0 1 0 | Lys AAA 4 2 2 2 4 | Arg AGA 0 1 1 2 1
Met ATG 6 6 6 6 6 | ACG 1 2 2 3 2 | AAG 12 12 12 13 9 | AGG 1 1 1 0 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 7 3 | Ala GCT 2 1 1 1 3 | Asp GAT 7 7 7 9 11 | Gly GGT 3 4 3 1 3
GTC 2 2 2 5 4 | GCC 5 6 6 6 5 | GAC 11 11 11 8 8 | GGC 9 7 8 7 8
GTA 1 2 3 0 1 | GCA 2 1 2 1 1 | Glu GAA 8 6 7 8 2 | GGA 1 2 1 3 2
GTG 11 9 9 10 11 | GCG 2 3 2 2 0 | GAG 15 17 16 15 21 | GGG 0 0 1 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_312-PA
position 1: T:0.15966 C:0.26891 A:0.21849 G:0.35294
position 2: T:0.29832 C:0.15126 A:0.36975 G:0.18067
position 3: T:0.16387 C:0.36134 A:0.14706 G:0.32773
Average T:0.20728 C:0.26050 A:0.24510 G:0.28711
#2: D_sechellia_312-PA
position 1: T:0.16807 C:0.26471 A:0.21849 G:0.34874
position 2: T:0.29412 C:0.14706 A:0.37395 G:0.18487
position 3: T:0.19328 C:0.33193 A:0.13025 G:0.34454
Average T:0.21849 C:0.24790 A:0.24090 G:0.29272
#3: D_simulans_312-PA
position 1: T:0.16807 C:0.26471 A:0.21429 G:0.35294
position 2: T:0.29832 C:0.14706 A:0.37395 G:0.18067
position 3: T:0.18067 C:0.34454 A:0.13025 G:0.34454
Average T:0.21569 C:0.25210 A:0.23950 G:0.29272
#4: D_yakuba_312-PA
position 1: T:0.14706 C:0.26891 A:0.23529 G:0.34874
position 2: T:0.30252 C:0.14706 A:0.37815 G:0.17227
position 3: T:0.19328 C:0.31513 A:0.15126 G:0.34034
Average T:0.21429 C:0.24370 A:0.25490 G:0.28711
#5: D_suzukii_312-PA
position 1: T:0.14706 C:0.27731 A:0.22689 G:0.34874
position 2: T:0.28151 C:0.14286 A:0.38235 G:0.19328
position 3: T:0.21429 C:0.33613 A:0.09244 G:0.35714
Average T:0.21429 C:0.25210 A:0.23389 G:0.29972
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 16 | Ser S TCT 4 | Tyr Y TAT 16 | Cys C TGT 0
TTC 45 | TCC 11 | TAC 26 | TGC 15
Leu L TTA 6 | TCA 8 | *** * TAA 0 | *** * TGA 0
TTG 19 | TCG 12 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 7 | Pro P CCT 7 | His H CAT 2 | Arg R CGT 12
CTC 7 | CCC 20 | CAC 40 | CGC 56
CTA 8 | CCA 10 | Gln Q CAA 22 | CGA 8
CTG 61 | CCG 21 | CAG 27 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 26 | Thr T ACT 6 | Asn N AAT 23 | Ser S AGT 18
ATC 11 | ACC 12 | AAC 14 | AGC 14
ATA 18 | ACA 2 | Lys K AAA 14 | Arg R AGA 5
Met M ATG 30 | ACG 10 | AAG 58 | AGG 4
------------------------------------------------------------------------------
Val V GTT 25 | Ala A GCT 8 | Asp D GAT 41 | Gly G GGT 14
GTC 15 | GCC 28 | GAC 49 | GGC 39
GTA 7 | GCA 7 | Glu E GAA 31 | GGA 9
GTG 50 | GCG 9 | GAG 84 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15798 C:0.26891 A:0.22269 G:0.35042
position 2: T:0.29496 C:0.14706 A:0.37563 G:0.18235
position 3: T:0.18908 C:0.33782 A:0.13025 G:0.34286
Average T:0.21401 C:0.25126 A:0.24286 G:0.29188
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_312-PA
D_sechellia_312-PA 0.0720 (0.0156 0.2162)
D_simulans_312-PA 0.0610 (0.0110 0.1798) 0.0561 (0.0036 0.0646)
D_yakuba_312-PA 0.1267 (0.0469 0.3702) 0.1556 (0.0531 0.3414) 0.1523 (0.0483 0.3170)
D_suzukii_312-PA 0.0711 (0.0487 0.6851) 0.0728 (0.0549 0.7540) 0.0689 (0.0501 0.7270) 0.0837 (0.0575 0.6873)
Model 0: one-ratio
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 9): -1704.244967 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.078674 0.064165 0.046502 0.007245 0.098947 0.213340 0.427845 1.783106 0.083849
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.93672
(1: 0.078674, (2: 0.046502, 3: 0.007245): 0.064165, (4: 0.213340, 5: 0.427845): 0.098947);
(D_melanogaster_312-PA: 0.078674, (D_sechellia_312-PA: 0.046502, D_simulans_312-PA: 0.007245): 0.064165, (D_yakuba_312-PA: 0.213340, D_suzukii_312-PA: 0.427845): 0.098947);
Detailed output identifying parameters
kappa (ts/tv) = 1.78311
omega (dN/dS) = 0.08385
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.079 550.1 163.9 0.0838 0.0075 0.0892 4.1 14.6
6..7 0.064 550.1 163.9 0.0838 0.0061 0.0727 3.4 11.9
7..2 0.047 550.1 163.9 0.0838 0.0044 0.0527 2.4 8.6
7..3 0.007 550.1 163.9 0.0838 0.0007 0.0082 0.4 1.3
6..8 0.099 550.1 163.9 0.0838 0.0094 0.1121 5.2 18.4
8..4 0.213 550.1 163.9 0.0838 0.0203 0.2417 11.2 39.6
8..5 0.428 550.1 163.9 0.0838 0.0407 0.4848 22.4 79.5
tree length for dN: 0.0890
tree length for dS: 1.0615
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 10): -1686.662006 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.081373 0.067252 0.048374 0.006660 0.098909 0.227844 0.464046 1.833307 0.914809 0.029853
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99446
(1: 0.081373, (2: 0.048374, 3: 0.006660): 0.067252, (4: 0.227844, 5: 0.464046): 0.098909);
(D_melanogaster_312-PA: 0.081373, (D_sechellia_312-PA: 0.048374, D_simulans_312-PA: 0.006660): 0.067252, (D_yakuba_312-PA: 0.227844, D_suzukii_312-PA: 0.464046): 0.098909);
Detailed output identifying parameters
kappa (ts/tv) = 1.83331
dN/dS (w) for site classes (K=2)
p: 0.91481 0.08519
w: 0.02985 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.081 549.2 164.8 0.1125 0.0096 0.0855 5.3 14.1
6..7 0.067 549.2 164.8 0.1125 0.0079 0.0706 4.4 11.6
7..2 0.048 549.2 164.8 0.1125 0.0057 0.0508 3.1 8.4
7..3 0.007 549.2 164.8 0.1125 0.0008 0.0070 0.4 1.2
6..8 0.099 549.2 164.8 0.1125 0.0117 0.1039 6.4 17.1
8..4 0.228 549.2 164.8 0.1125 0.0269 0.2393 14.8 39.4
8..5 0.464 549.2 164.8 0.1125 0.0548 0.4874 30.1 80.3
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 12): -1686.662006 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.081373 0.067252 0.048374 0.006660 0.098909 0.227844 0.464046 1.833306 0.914809 0.073467 0.029853 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99446
(1: 0.081373, (2: 0.048374, 3: 0.006660): 0.067252, (4: 0.227844, 5: 0.464046): 0.098909);
(D_melanogaster_312-PA: 0.081373, (D_sechellia_312-PA: 0.048374, D_simulans_312-PA: 0.006660): 0.067252, (D_yakuba_312-PA: 0.227844, D_suzukii_312-PA: 0.464046): 0.098909);
Detailed output identifying parameters
kappa (ts/tv) = 1.83331
dN/dS (w) for site classes (K=3)
p: 0.91481 0.07347 0.01172
w: 0.02985 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.081 549.2 164.8 0.1125 0.0096 0.0855 5.3 14.1
6..7 0.067 549.2 164.8 0.1125 0.0079 0.0706 4.4 11.6
7..2 0.048 549.2 164.8 0.1125 0.0057 0.0508 3.1 8.4
7..3 0.007 549.2 164.8 0.1125 0.0008 0.0070 0.4 1.2
6..8 0.099 549.2 164.8 0.1125 0.0117 0.1039 6.4 17.1
8..4 0.228 549.2 164.8 0.1125 0.0269 0.2393 14.8 39.4
8..5 0.464 549.2 164.8 0.1125 0.0548 0.4874 30.1 80.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_312-PA)
Pr(w>1) post mean +- SE for w
44 E 0.503 1.382 +- 0.779
82 P 0.509 1.443 +- 0.801
159 G 0.669 1.657 +- 0.922
234 K 0.658 1.739 +- 1.191
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.703 0.195 0.052 0.020 0.010 0.006 0.004 0.004 0.003 0.003
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011 0.988
sum of density on p0-p1 = 1.000000
Time used: 0:13
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
check convergence..
lnL(ntime: 7 np: 13): -1686.589764 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.081343 0.066620 0.048213 0.006756 0.098669 0.226572 0.461973 1.813408 0.135156 0.767394 0.026392 0.026395 0.848602
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99015
(1: 0.081343, (2: 0.048213, 3: 0.006756): 0.066620, (4: 0.226572, 5: 0.461973): 0.098669);
(D_melanogaster_312-PA: 0.081343, (D_sechellia_312-PA: 0.048213, D_simulans_312-PA: 0.006756): 0.066620, (D_yakuba_312-PA: 0.226572, D_suzukii_312-PA: 0.461973): 0.098669);
Detailed output identifying parameters
kappa (ts/tv) = 1.81341
dN/dS (w) for site classes (K=3)
p: 0.13516 0.76739 0.09745
w: 0.02639 0.02640 0.84860
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.081 549.5 164.5 0.1065 0.0092 0.0868 5.1 14.3
6..7 0.067 549.5 164.5 0.1065 0.0076 0.0711 4.2 11.7
7..2 0.048 549.5 164.5 0.1065 0.0055 0.0515 3.0 8.5
7..3 0.007 549.5 164.5 0.1065 0.0008 0.0072 0.4 1.2
6..8 0.099 549.5 164.5 0.1065 0.0112 0.1053 6.2 17.3
8..4 0.227 549.5 164.5 0.1065 0.0258 0.2418 14.2 39.8
8..5 0.462 549.5 164.5 0.1065 0.0525 0.4930 28.9 81.1
Naive Empirical Bayes (NEB) analysis
Time used: 0:22
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 10): -1686.925699 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.081352 0.065751 0.048013 0.006947 0.099013 0.224687 0.458499 1.799679 0.085372 0.727691
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.98426
(1: 0.081352, (2: 0.048013, 3: 0.006947): 0.065751, (4: 0.224687, 5: 0.458499): 0.099013);
(D_melanogaster_312-PA: 0.081352, (D_sechellia_312-PA: 0.048013, D_simulans_312-PA: 0.006947): 0.065751, (D_yakuba_312-PA: 0.224687, D_suzukii_312-PA: 0.458499): 0.099013);
Detailed output identifying parameters
kappa (ts/tv) = 1.79968
Parameters in M7 (beta):
p = 0.08537 q = 0.72769
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00001 0.00015 0.00154 0.01087 0.05741 0.23663 0.72146
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.081 549.8 164.2 0.1028 0.0090 0.0877 5.0 14.4
6..7 0.066 549.8 164.2 0.1028 0.0073 0.0709 4.0 11.6
7..2 0.048 549.8 164.2 0.1028 0.0053 0.0518 2.9 8.5
7..3 0.007 549.8 164.2 0.1028 0.0008 0.0075 0.4 1.2
6..8 0.099 549.8 164.2 0.1028 0.0110 0.1068 6.0 17.5
8..4 0.225 549.8 164.2 0.1028 0.0249 0.2423 13.7 39.8
8..5 0.458 549.8 164.2 0.1028 0.0508 0.4944 27.9 81.2
Time used: 0:40
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 12): -1686.663631 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.081373 0.067221 0.048367 0.006668 0.098885 0.227813 0.463847 1.831993 0.915886 3.159170 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99417
(1: 0.081373, (2: 0.048367, 3: 0.006668): 0.067221, (4: 0.227813, 5: 0.463847): 0.098885);
(D_melanogaster_312-PA: 0.081373, (D_sechellia_312-PA: 0.048367, D_simulans_312-PA: 0.006668): 0.067221, (D_yakuba_312-PA: 0.227813, D_suzukii_312-PA: 0.463847): 0.098885);
Detailed output identifying parameters
kappa (ts/tv) = 1.83199
Parameters in M8 (beta&w>1):
p0 = 0.91589 p = 3.15917 q = 99.00000
(p1 = 0.08411) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09159 0.09159 0.09159 0.09159 0.09159 0.09159 0.09159 0.09159 0.09159 0.09159 0.08411
w: 0.00896 0.01429 0.01835 0.02212 0.02592 0.02999 0.03461 0.04025 0.04809 0.06320 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.081 549.2 164.8 0.1121 0.0096 0.0856 5.3 14.1
6..7 0.067 549.2 164.8 0.1121 0.0079 0.0707 4.4 11.6
7..2 0.048 549.2 164.8 0.1121 0.0057 0.0509 3.1 8.4
7..3 0.007 549.2 164.8 0.1121 0.0008 0.0070 0.4 1.2
6..8 0.099 549.2 164.8 0.1121 0.0117 0.1040 6.4 17.1
8..4 0.228 549.2 164.8 0.1121 0.0269 0.2395 14.7 39.5
8..5 0.464 549.2 164.8 0.1121 0.0547 0.4877 30.0 80.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_312-PA)
Pr(w>1) post mean +- SE for w
34 A 0.537 1.139 +- 0.831
44 E 0.625 1.278 +- 0.805
82 P 0.637 1.321 +- 0.808
159 G 0.870 1.661 +- 0.792
229 L 0.573 1.210 +- 0.879
232 V 0.530 1.130 +- 0.834
234 K 0.811 1.605 +- 0.896
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.004 0.022 0.071 0.161 0.291 0.451
ws: 0.781 0.164 0.034 0.010 0.004 0.002 0.001 0.001 0.001 0.001
Time used: 1:20
Model 1: NearlyNeutral -1686.662006
Model 2: PositiveSelection -1686.662006
Model 0: one-ratio -1704.244967
Model 3: discrete -1686.589764
Model 7: beta -1686.925699
Model 8: beta&w>1 -1686.663631
Model 0 vs 1 35.16592200000014
Model 2 vs 1 0.0
Model 8 vs 7 0.5241359999999986